states of matter Word Searches

Canadian History 2023-11-06

40 Items: furrulecabotharshpeltsbattledefeatempirehockeyquebecsprucestatesunitedbritishcoastalcontrolsailingvictoryvikingsweaponscoloniesdiscoverfortresslacrossemedicinemontrealreligionsoldiersthirteenestablishexplorerseuropeansloyalistssnowshoesindigenousprotectionresponsiblesettlementsindependencerepresentatives

Spelling Words 2025-04-03

40 Items: tinyheelweakbeaneagleanklecameltowelpilotlimitmodelcovertigercreekgreencleanfieldyearstwinstraysfoxesfliesskiesbottletravelpuzzlepickleglobalmiddlesilentspiderplanetfrozenstreetfreezespeaksstatesinchescitieslunches

Current Events 5-1-25 2025-05-01

40 Items: signdealGazafirmfaceurgeaftertensetalksWhiteHousetradeTrumpAdminLibyanearsafterChinaIndiaUnitedStatesmonthsbuildsweighsRwandafamineIsraelUkrainemineralanxietysendingtariffseconomicmigrantsblockadestandingPakistanconflictimpatientde-escalation

America Word Search 2025-08-11

40 Items: FUNPIEREDBELLBLUECORNFOODEAGLEPRIDESTARSTAXESANTHEMFAMILYFLOATSPICNICRIGHTSSTATESSUMMERTREATYUNITEDAMERICAFREEDOMJUSTICELIBERTYPARADESSTRIPESBARBEQUEBASEBALLCARNIVALCOLONIESCONCERTSCONGRESSREUNIONSDEMOCRACYSPARKLERSPATRIOTISMWATERMELONCELEBRATIONCONSTITUTIONFIRECRACKERS

Cell Word Search 2025-01-31

27 Items: The variety of genes within a given speciesAny living factor in an organism’s environmentThe variety of ecosystems within a given regionNumber of different species living in a specific areaAnything that has or once had all the characteristics of lifeSpecies that normally live and thrive in a particular ecosystem...

Focus on Greek Roots 2024-03-04

19 Items: Study of living organismsEarly sound-reproducing machinePerson trained for space travelA person's signature, often as a mementoA sudden event causing great damage or lossVisual representation of data or informationAn account of someone's life written by someone elseAn account of a person's life written by that person...

Good Friday 2025-04-14

10 Items: tombcrossJesusnailsdeathdarknesssalvationlamb-of-Godking-of-kingscrown-of-thorns

Travelling Europe 2025-09-25

18 Items: Boat TourCity of LoveBay of SilenceCanel Boat RideCapital of BelgiumCapital of DenmarkCapital for FashionRome Pregnancy TourSwedish Shipyard TownHome of the Royal MileThe Infamous Tube FightFavourite Italian HotelDeclan and Megans WeddingCity of the Magnum DesertFavourite Italian ResterauntDamons Favourite Italian Drink...

Math Vocab 2025-10-08

19 Items: SumSlopeLinearProductSegmentSimplifyQuotientVariableFunctionParallelEquationSolutionConstantExponentof ChangeDifferenceY-Interceptof OperationsPerpendicular

Harry potter 2023-06-12

14 Items: Scared of spidersHeir of slytherinA Hufflepuff girlFriends with GoyleFriends with CrabbeA twin brother of FredHe killed Nagini the snakeA Chinese girl from RavenclawThe main character of the movieA Weasley that died in the last movieThe smartest one out of the group of 3A lovegood member taken by the death eater...

polynomial class x 2025-04-21

15 Items: most A polynomial of degree 'n' can have at most 'n' zeroespolynomial A linear polynomial is a polynomial having a degree of 1.The degree of a polynomial is the highest power of the variable in it.If 'α' is a zero of a polynomial p(x), then (x - α) is a factor of p(x).The zeroes of a polynomial p(x) are the values of x for which p(x) equals 0....

Washington, Word Search 2024-09-08

12 Items: (Japan)(China)(Egypt)(France)(Canada)(Brazil)(Russia)(Germany)(Australia)Delhi (India)(United Kingdom)D.C. (United States)

Pichwai Word Search 2023-05-12

20 Items: The old name of Nathdwara was ___.Deccani or Golconda style of Pichwais originated in _____.A day at Shreenathji ki Haveli is divided into ____ darshans.He was an ardent devotee of Shrinathji and a devotional philosopher.Every Pichwai painting relates to a specific celebration of a ______....

Pathophysiology Practice 2025-06-15

15 Items: Plantar wartItching sensationMalignant bone tumorOily secretion of integumentFixation or immobility at jointNoise of broken bone rubbing togetherScratching that results in abrasion or woundExcessive forward curvature of thoracic spineInflammatory disease of the eye's uveal tractPlug of keratin and sebum within hair follicle...

Science Word Search 2025-11-21

14 Items: Everything.Transfer of heat in a fluid.Movement of air due to convection.Heat source for convection on Earth.Daily conditions of the air around us.Last stage of a main sequence star's life.Average weather conditions over a long period.Movement of water in the ocean due to convection.Area of gas and dust in space where stars can form....

Animals, Colors, Jobs 2023-03-08

20 Items: Animal that barksthe color of dirtThe color of grassThe color of a roseThe color of the skyanimal that slithersThe color of a grapeThe color of the sunThe color of a whiteboardA animal that you can rideA person that likes to singTakes care of people(female)animal that likes to hop(female)A professional at acting(female)...

G7 WWI Vocabulary from The Great War Dr. E 2025-01-15

13 Items: EasternFrontA formal agreement of peace or trade between countriesThe murder of someone for political reasons, often a political leaderAn agreement made by opposing sides in a war to stop fighting for a certain time; a truce.Also known as the Central Empires or the Quadruple Alliance (Germany, Austro-Hungarian Empire,...

ART IN EARLY CIVILIZATION (GROUP 2 BSPT 1C) 2025-03-29

20 Items: KaGizaHorusMummyLascauxPharaohPaletteof BullsEgyptianPyramidsNeolithicPaintingsSculptureAfterlifeMesolithicStonehengePaleolithicHieroglyphsTutankhamenof Willendorf

Ancient China Word Search 2025-03-26

25 Items: complete disorder and confusionthe sovereign ruler of an empirea class of people of high social ranka sequence of rulers from the same familya white vitrified translucent ceramic; chinaa Hindu or Buddhist temple or sacred buildingan official order or commission to do somethingdecorative handwriting or handwritten lettering...

JoiningThePak Wedding Word Search 2022-11-01

19 Items: Amber's jobwhere we methoneymoon locationfirst date activitywhere Alex proposedAlex's favorite foodone of Alex's hobbiesname of our first dogsomebody once told mename of our first catAmber's favorite foodone of Amber's hobbiesname of our second dogblue flower red thornsname of our second catmonth we started datingyears we've been together...

Female Inventors Who Changed the World 2023-08-02

15 Items: First name Marie, discovered radioactivity.First name Margaret, creator of the paper bag.First name Mary, creator of the windshield wiper.First name Melitta, creator of the coffee filter.First name Ayla, creator of the Kindling Cracker.First name Maria, creator of the pop up life raft.First name Katharine, created non-reflective glass....

Executive Branch 2025-10-27

17 Items: A legal act of forgivenessHead of the executive branchSecond in the line of successionCancel or postpone the punishmentGroup of advisors for the presidentReducing a sentence to one less severeThe executive branch is set to ____ laws.Primary location for the executive officesLocation of the outline of the Executive Branch...

ART IN EARLY CIVILIZATION (GROUP 2 BSPT 1C) 2025-03-29

20 Items: KaGizaHorusMummyLascauxPharaohPaletteof BullsEgyptianPyramidsNeolithicPaintingsSculptureAfterlifeMesolithicStonehengePaleolithicHieroglyphsTutankhamenof Willendorf

Biodiversity Vocab 2023-05-16

19 Items: Environment lacking oxygenVariety and variability of lifeSpecies dwindling toward extinctionAmount of organic mass in an ecosystemOrganisms' natural home or environmentSpecies with no living members remainingSpecies indigenous to the given ecosystemLarge, regional habitat of flora and faunaFormation of new species due to env. change...

Study Guide Crossword 2024-04-17

31 Items: viewed from all sidessoft or workable materialclay is fired once in kilnclay is NOT fired in kiln yetrepetition of one or more elementhigh water content, most workablea single material an artist may useliquid material is poured into moldhard less water, but still workablecompletely air dried & very brittlea difference in the use of two elements...

Cohesion Word Search 2025-02-14

15 Items: - Regard and consideration for others.- The ability to guide and direct others.- The act or state of forming a unified whole.- The state of being united or joined as a whole.- To defeat or prevail over challenges or obstacles.- The state of having different elements or qualities.- The process of teaching or learning specific skills....

Taxonomy Word Search 2024-01-22

24 Items: organisms.relationships.characteristics.characteristics.The study of the form and structure of organisms.The study of evolutionary relationships among organisms.Structures in different species that share a common ancestry.The science of classification, organizing and naming living organisms....

Early Industrialization 2023-12-01

24 Items: the "working class"money used to investbusiness organizationinventor of Cotton Ginthe new "middle class"perfected the steam enginemovement of people to citiesprocess of combining farmlandterm meaning country/ farmlandsecond country to industrializemade up most of new middle classprocess of removing iron from its ore...

Words Matter: Disability Etiquette Edition 2025-08-29

15 Items: EquityEmpathyRespectSupportAdvocacyInclusionAssistiveDiversityAwarenessPersonFirstAccessibilityAccommodationServiceAnimalCommunicationRepresentation

"Your word is a lamp to my feet and a light to my path" - Psalms 119:105 2025-01-25

15 Items: The MessiahThe Son of GodTalking to GodFollower of JesusComplete trust in GodThe birthplace of JesusUnmerited favor from GodThe good news about JesusEternal dwelling with GodThe first book of the BibleLove and kindness in actionSongs and poems in the BibleThe holy book of ChristianityStory told by Jesus with moral lessons...

Kinetic Word Search 2025-12-04

17 Items: soundkineticelasticthermalnuclearradiantchemicalpotentialradiationmechanicalelectricalconductionconvectiongravitationaltransformationelectromagneticof conservation of energy

Network security 2025-05-14

16 Items: foreverunaltered infopart of red hatour everyday usewas a macro virusnetworking devicepart of wanna cryiris, fingerprintsgroup of computerspart of the CIA triadmesh, ring and otherssecond part of the wanna cryderived from the work triangleprevents you to access your deviceold device rarely used in networkingdeals with different types of hackers

Salon Skin Care 2023-07-10

20 Items: Foul-smelling perspirationCapable of destroying fungiA large blister containing clear, watery fluidThe study of muscles - their structure, function and diseasesAny material that allows or supports the flow of electric currentSmall, red elevated protrusion of the skin, usually containing no pus...

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Manifest Destiny 2025-03-11

30 Items: WarActLineTrailFolly49ersDebateDestinyK. PolkPioneerCessionof 1850PurchasePurchaseRailroadof TearsFrontierDisputesGold RushExpansionAnnexationRemoval ActForty-NinersReservationsAssimilationHomesteadersof the AlamoExpansionismof Guadalupe Hidalgoand Clark Expedition

Interactive Cafe Chapter 12 Word Search 2025-02-28

12 Items: a party that forms to oppose immigrantsa part that is exactly like another parta native-born American who wanted to eliminate Foreign Influencecompleted in 1825, this waterway connected New York City and Buffalo, New Yorka plan introduced in 1815 to make the United States economically self-sufficient...

Madison & Wyatt 2025-01-21

20 Items: The wedding date.The name of the groom.The name of the bride.The name of the venue.For cards from guests.The month of the wedding.A favorite candy of the groom.What is the groom’s favorite drink.Dessert being served at every table.One of the bride’s favorite candies.Carries a basket during the ceremony.The main entrée for the dinner buffet....

Cognitive Word Search 2019-10-16

35 Items: axonlobegreypinkbrainfoldsshortsmelltastetouchmattermemoryvisionthoughtemotionfrontalbarrierhearingtemporallongtermdopamineamygdalabreathingdendritesoccipitalbrainstempituitaryserotoninprocessingCerebellumneurologistelectricityhemispheresneuroscienceneurotrasmitters

Word Search 1 2024-01-16

35 Items: billfelttestmoonmindloverainbluewishreadydancecellspaintcausetrainmattersquarecenterenergyregionreturnpickedsimplefarmersdividedgeneralsubjectbelievememberssuddenlyanythingexercisesyllablesdirectiondeveloped

Science Word Search 2023-05-25

25 Items: The ability to dissolveThe harmful rays that come from the sunAn animal that hunts and eats other animalsA scale that shows the acidity of substancesThe SI base unit of thermodynamic temperatureThe type of cloud that tells you a storm is comingWhen different species work together, BOTH benefitThe layer of the atmosphere where weather occurs in...

Latitude Word Search 2025-01-11

30 Items: A group or chain of islandsWhere the land meets the oceanA body of water surrounded by landA large area covered mainly with treesA cold, treeless region with frozen groundA large area of flat or gently rolling landA nation with its own government and bordersA low area of land between hills or mountainsA piece of land completely surrounded by water...

ATOMS  2020-09-24

35 Items: BOHRWAVEATOMSCLOUDGASESMODELREPELENERGYMATTERPROTONQUARKSATTRACTCOMBINEELEMENTISOTOPELIQUIDSMOSELEYNEUTRALNEUTRONNUCLEUSADHESIONELECTRONMOLECULENEGATIVEPOSITIVEFLAMETESTSUBATOMICATOMICMASSDEMOCRITUSJOHNDALTONRUTHERFORDATOMICNUMBERATOMICWEIGHTSCHROEDINGERQUANTUMTHEORY

MP1 Word Search 2025-10-21

35 Items: AtomMassForceEnergyMatterVolumeMotionFlummoxElementMixtureDensityGravityInertiaErosionHabitatCompoundMoleculeChemicalPhysicalFrictionVelocityRadiationEcosystemConductionConvectionWeatheringAdaptationTemperatureEvaporationEnvironmentAccelerationCondensationSchadenfreudePrecipitationPhotosynthesis

Acts 2025-11-08

35 Items: GodActsLukePaulwillLOWMGhostMosesPetersavedfaithheartJesusPeterchurchburdeneldersgospelmatterChristdebatedfathersSamariawitnesscommandPhenicePulliambrethrenapostlesGentilesBarnabasmiraclesJerusalemPhariseescircumcised

Watercycle Word Search 2025-12-17

29 Items: bends or curves in a streammaximum load a stream can carrywater within the zone of saturationcourse the water in a stream followsnaturally formed underground chamberupper limit of the zone of saturationunending cycle of Earth's water supplyslope or steepness of a stream channelarea where water fills all pore spaces...

Art Chapter 1-2 2025-11-12

19 Items: ARTMEDIUMOF ARTDESIGNOF ARTSUBJECTCERAMICABSTRACTANALYSISCRITICISMOF DESIGNFORMALISMEXPERIENCEEVALUATIONTRADITIONALDESCRIPTIONCOMPOSITIONINTERPRETATIONEXPRESSIVENESS

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Executive branch 2025-04-23

17 Items: The spread of a secretCovering of a wrongdoingHighest-ranking diplomatic officerlead staff member of an administrationWritten directive, signed by the president,Process of electing president & vice presidentResponsible for the day-to-day management of the governmentOversees the performance of federal agencies, and administers...

US History Eras 2024-12-02

10 Items: 1890s to the 1920s - period of political and social reform1929-1939 - period of economic crisis and government response with New Deal programs1945-1991 - the power struggle between the Soviet Union and the United States after World War II...

You Word Search 2025-05-28

20 Items: realmindmorecarefullsoulflowsrootsheartmattergoldenhopefulmindfulforwardgot thislight inserenitycheerfulthoughtshappiness

Toes and Foot Word Search 2024-07-16

20 Items: For an AP foot, the central ray is angled ___ ___ degrees.What part of the 5th metatarsal is on profile on an oblique foot?When positioning for lateral toes the 1st-3rd toes require ___ ____.When positioning for lateral toes the 4th-5th toes require ___ ____.For all positions of the toes how much of the metatarsals in required?...

US States Part 3 2025-05-14

13 Items: OhioNevadaOregonMontanaNewYorkNebraskaOklahomaNewJerseyNewMexicoNorthDakotaNewHampshirePennsylvaniaNorthCarolina

US States Part 2 2025-05-14

13 Items: IowaMaineKansasIndianaIllinoisKentuckyMarylandMichiganMissouriLouisianaMinnesotaMississippiMassachusetts

spelling words 2016-01-14

41 Items: 1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.16.17.18.19.20.areastaredairylargeforcesquaredaringbewarebeforeUnitedStatesJanuarypartnerarticleargumentguardingordinaryAmericanorchestraimportantdictionary

Communication 2025-04-17

20 Items: the information being relayedthe transfer of information between individualsthe person who sends information to someone elsethe recipient of the message given by the senderanything that may inhibit effective communicationcommunication completed via transfer of electronic messagesrelay of information in as clear and concise a method as possibe...

TERRESTRIAL BIOMES 2025-10-02

20 Items: It is the most arid terrestrial biomeIt protects the Earth from the harmful UVA permanently frozen area of tundra and taigaGrasslands caters for the feeding habit of these animalsIt refers to the amount of water vapor present in the airIt describes the daily climatic condition in an specific area...

​🇨​​🇦​​🇷​​🇸​​🇴​​🇳​ ​🇼​​🇴​​🇷​​🇩​ ​🇸​​🇪​​🇦​​🇷​​🇨​​🇭​ 2024-05-16

15 Items: What humans BreatheThe end of A long boneAre ocean currents related to windHow Carbon moves out of the atmosphereThe process were liquid turns into gasZone of the ocean that has a lot of sunlightA flexible material found on the ends of bonesThe less muscular of the two types of blood vesselsThe more muscular of the two types of blood vessels...

Vocabulary Vines Word Search 63-66 2024-09-20

12 Items: of a shiplike a startoward a shipthe wrong namethe act of namingwritten with lighta particle of lightsailor of the starsnaming of the starssailor of the universeput together with lightdistribution in the environment

How Well Do You Know Your Model A #5 2023-12-30

20 Items: Charging gaugeA theft deterrent.Leaf spring hanger.______________ bowlA grouping of wires.A vintage brand of tire.pulls air thru the radiator.Center of the wheel assembly.Controls carb and distributorDraws additional gas to start.Original color of radiator hoses.A common brand of updraft carburetor.Wire junction box on top of generator....

Adam and Eve 2022-07-18

15 Items: evegodmanadamgoodevillovefruitangelwomandeathserpentof Lifeof Edenfreewill

Genetics Word Search 2025-02-18

25 Items: The study of heredityDifferent versions of a genePassing of traits from parents to offspringAn organism's physical appearance, or visible traitsAn organism's genetic makeup, or allele combinationsAn organism that has two identical alleles for a traitAn organism that has two different alleles for a trait...

Lesson 1-5 Vocab 7th 2025-08-25

35 Items: fatmassatommodelmatterproteinbiomassbiofueldensitycrystalpolymerelementconsumerproducerpropertymoleculecriteriacellulosesubstancesolubilityconstraintatomicmasschloroplastchlorophyllmacroscopicmitochondriacarbohydratechemicalbondphotosynthesischemicalsymbolatomiccompositionchemicalstructureextendedstructurecellularrespirationperiodictableofelements

sadfasdf 2025-10-21

38 Items: DotBohrAtomRuleAtomModelLevelForceRepelReactOctetLewisGroupShellShellForceTableEnergyStablePeriodProtonMatterAtomicNumberSymbolChargeNeutralAttractDiagramNeutronNucleusElementMoleculeCompoundElectronPeriodicNegativeElectromagnetic

Documents & Correspondence - Glossary and more 2024-12-18

31 Items: Consecutive hoursConsectutive daysReceiver of the cargoStowage plan for containersAlternative term for insurerSynonym for Bare Boat CharterDuplicate of a bill of ladingType of grain; Barley and oatsArchaic term for charter partyVessel sailing along a fixed routeAdditional sum of money to be paidType of grain; wheat, rye and corn...

Unit 13 Vocabulary Word Search 2023-03-29

20 Items: To charmDull, boringGive care forTo set on fireNoisy confusionExtremely funnyLarge and heavyWell thought ofTo humble oneselfWork done by handOf or like a motherTo lose interest inTo change continuallyTo make or become smallerTo love and respect dearlyA narrative of heroic exploitsTo say suddenly or without thinking...

8th Grade Forces and Energy Chapter 4 Hints 2024-01-04

13 Items: scientific ruleenergy of electric chargesability to do work or cause changeenergy of stretched or compressed objectsenergy that an object has due to its motionpotential energy stored in the nucleus of an atompotential energy that depends on the height of an objectform of potential energy that is stored in chemical bonds between atoms...

Unit 3: Electrons in Atoms 2023-09-26

20 Items: 3.00 x 10^8 m/sHeight of a waveparticles of lightthe arrangement of electrons in an atomElectrons on the outermost energy level of an atomthe clockwise or counterclockwise motion of an electronthe possible energies that electrons in an atom can havenumber of complete wavelengths that pass a point in a given time...

Happy Birthday, Michael!! 2025-08-02

14 Items: FunMexicoEnsenadaAdultsonlyto the leftto the righta great leapgroup of twomonth of loveseven of themmost of Earthbackwards loopdrive with easebefore an audience

Psychology chapter two 2025-03-07

10 Items: solvingEnables reasoning, planning, creating,Drive vital functions, such as heart rate, breathing, digestionsystem Adds emotions, complex motives, increased memory abilities–Topmost layer of the brain; the bulbous cap over the limbic systemTightly coiled threadlike structures along which the genes are organized...

Video Games 2025-11-10

34 Items: GTAPeakPUBGFIFABlurSkateRobloxMaddenPortalBurnoutDestinyFar-CryFortniteThe-SimsValorantMinecraftOverwatchHelldiversBattlefieldAngry-BirdsClash-RoyaleNo-Man's-SkyHollow-KnightPath-of-ExileMarvel-RivalsCounter-StrikeNeed-for-SpeedThe-Last-of-UsCrash-BandicootMetal-Gear-SolidLeague-of-LegendsKirby's-Dream-LandRed-Dead-RedemptionThe-Legend-of-Zelda

Chemistry Midterm Exam Wordsearch 2014-01-21

35 Items: IonGasAtomBetaMassJouleGroupMetalAlphaGammaEnergymatterPhotonFamilyAlkaliRadiusProtonLiquidQuantumHalogenValenceNeutronNucleusIsotopechemicalSpectrumPeriodicAlkalineNonmetalElectronRadiationIonizationTemperatureconfigurationElectronegativity

Science Vocabulary 2015-08-23

35 Items: ionatombasecellgenemetalorganvirusarterydeserthybridkidneymatterprotontissuetundrabladdercontrolelementerosionhabitatmixturenucleusvaccinewetlandantibodypathogensolutiondigestionecosystemrecyclingsubstancechromosomefloodplaingrasslands

Let Word Search 2025-05-28

20 Items: gonowsidesoulminddowncheckheartcleargentlybrightmatterinsidepresenthopefulmindfulbalanceforwardpeacefulmotivation

Unit 1 Vocab 2025-09-03

15 Items: mass/volumesolute + solvent =not shiny, true for non-metalsshiny, characteristic of metals2 or more different elements bondedwhat dissolves in solvent, example: saltWhat something dissolves in, example: watertype of mixture where you can pick out parts1 type of atom, defined by number of protonsproperty of metals, can be shaped into wires...

Unit IV Review: Abs-sci-ment 2024-05-17

22 Items: ______ the Terrible_______ WollstonecraftThe Index of _____________The belief that one should doubt everythingEmpress of Russia known for her Enlightened ideasThe spread and mixing of various cultures and ideasThe idea that the sun is at the center of the solar systemA child who ascends to the throne following a parent's death...

CVA Review Game 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Breed Word Search 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Year 9 English 2024-07-05

35 Items: The ____ Plot 1605______ kills Duncan'half-formed ______''Be the ____ under't'Tennyson was Poet _______Genre of Macbeth: ________'I carving out me _______'Who kills Macbeth? ___________A commanding verb is an ______Poem by Carole Rumes 'The ____'Post __________ Stress Disorder'Straight I unloosed her ______'Playwright of 'Macbeth': _________...

Vocabulary year 7 2015-09-17

41 Items: fallChinaKoreathanksmemberMexicoBrazilschoolfathermothersistersummerautumnCanadaUnitedStatespartnerAmericastudentteacherbrothercollegecountrywelcomeeveningmorningaverageActuallyspeakingexcitingvacationstudentsgreetingtomorrowclassmatelisteningcafeteriachemistryafternoonuniversityconversation

Alexandria Ocasio-Cortez 2023-10-01

27 Items: YorkTermRicanbronxStateslatinainternelectedKennedySandersoctobersenatorDistrictDirectorcongresscampaignCampaignamericaneconomicsRelationsCommunityUniversityadvocatingalexandriapoliticiansocasio-cortezrepresentative

James Buchanan 2024-10-11

41 Items: WarDredCivilCourtScottIssueLegalNorthUnionCareerCrisisDebatePublicRulingStatesUnitedAfricanFederalServiceSlaverySupremeBuchananConflictDecisionFlexibleHandlingNationalSouthernAmericansDivisionsMovementsPoliticalPresidentSecessionSecretarySectionalAmbassadorDemocraticObligationResolutionPartnership

Countries of the World 2025-11-10

40 Items: CubaItalyJapanSpainChinaKoreaSyriaEgyptStatesCanadaRussiaFranceMexicoBelizeSwedenTurkeyGreecePolandNorwayIsraelEnglandGermanyBelgiumIrelandAustriaVietnamUkraineMoroccoLebanonJamaicaPortugalScotlandThailandArgentinaAustraliaVenezuelaLithuaniaNewZealandSwitzerlandNetherlands

West African Capitals 2025-02-27

9 Items: Lomé, The capital of TogoAccra, The capital of GhanaBamako, The capital of MaliDakar, The capital of SenegalAbuja, The capital of NigeriaConakry, The capital of GuineaCotonou, The capital of BeninAbidjan, The capital of Ivory CoastFreetown, The capital of Sierra Leone

Quest 2 2022-10-15

12 Items: The Ancient of Knowledge.Home to the Vermilion elves.A young keeper, blind at birth.Known as the "Jewel of the South."The main antagonist of the Warminster Series.The animal species the Faircloth family breeds.Incanus Dru'Waith is a ____ elf and an assassin.Erud's magical tome is called The Tome of ________....

Renal Function 2025-12-02

18 Items: Loop of __________elevated blood ureaprimary protein nitrogenincreases RBC productionprimary extracellular cationfunctional unit of the kidneydecreased profusion of kidneysconverted to urea in the livertubular absorptions and ______high levels of lipids in the blooddirectly proportional to muscle massbuild up of uric acid crystals in joints...

Ancient Greece 2025-07-02

20 Items: God of WarThe countryThe languageGod of the seaAlexander the ...Half man, Half goatHalf man, Half bullThe symbol of PoseidonQueen of the underworldLeader of the Greek godsFlew too close to the sunThe colour of Greek easter eggsCity with the fiercest warriorsThe games that started in GreeceGod villain in the Hercules myth...

Ch. 4 Medterm Vocab Signs, Symptoms, Diseases, Disorders 2025-04-10

50 Items: scaringrown naila torn or jagged woundabnormally smooth skinfibrous tumor of the skina pinpoint skin hemorrhagean overgrowth of scar tissuea symptom of intense itchingabnormal redness of the skinskin wound caused by scrapinginflammation of a sweat glandtissue related death of cellsabnormally light colored skina discolored flat spot, freckle...

States 2024-03-22

4 Items: JuneauPhoenixMontgomeryLittle Rock

States 2024-03-22

4 Items: JuneauPhoenixMontgomeryLittle Rock

BIOLOGY 2025-10-31

20 Items: SA and AVPhagocytosisRelaxation of heartValves of left sideProduces antibodiesContraction of heartValves of right sideSmallest blood vesselsLargest artery in the bodyCarries oxygen and carbon dioxideThinner-walled chambers of the heartThicker-walled chambers of the heartWhen blood goes from atria to ventricle...

Photo 1 - Semester 1 2025-12-17

18 Items: A device to take photos.Different between light and dark.The ability to take close-up photos.The lightness or darkness of a colorHow the elements in a photo are arrangedUsing reflective surfaces to mirror an image.The images displayed together as one artwork.How much of the image is in focus from front to back....

Vocabulary unit 11 2025-05-19

18 Items: A mark indicating the quality of a student's work.The grounds and buildings of a university or college.A college or university student who's not a graduate student.A first-year student at a university, college, or high school.Based on or characterized by the methods and principles of science....

Yom Kippur 5.0 2024-10-06

20 Items: “Rest” Hebrew“Soul” Hebrew“holy” Hebrew“peace” HebrewA trumpet blast“Passover”Hebrew“Oil Press” Hebrewa rams horn, HebrewThe Day of Atonement“appointed time” HebrewUnleavened Bread, Hebrewa unit of measure, Hebrewof or related to the moon.“make an appointment” Hebrewliterally, Head of the Year”“statute” or “ordinance” Hebrew...

Heart Ridge Word Search (get 10 of 30 to proceed...) 2025-06-23

30 Items: BirdCodeCareDevotionKateri...Theotokos50 Psalms... Ricky... MartinSon of GodHippy internLodging hereYou are hereI love my...Current PopeBigfoot's nameDown by the...Bigfoot speciesMost recent PopeFalling with styleSong about clothingLily of the MohawksFoster father of JesusWiped the face of ChristI've got... like a riverMost recent Papal Encyclical...

Beshelach 5.0 2025-02-02

16 Items: “Yam Suf”“mitzvot”The Seventh DayWho saved Israel?“Bread from heaven”The meaning of “Beshelach”The place of extreme hunger.The place of the bitter waters.The seabed for the children of Israel.at this stop there was no water supplyThis stop was at the edge of the wilderness.The place of the 12 springs and 70 palm trees...

Chapter 3 2025-02-10

15 Items: fallforceforcefieldforceweightgravityinertiafrictionvelocityresistance1st law of motion2nd law of motion3rd law of motionof conservation of momentum

Force and Motion 2025-05-15

27 Items: speed in a directionan object changes its positiona push or pull acting on an objecta force that pulls objects toward each other\a measure of the amount of matter in a samplethe process of energy changing from one form to anothera force that acts in the opposite direction to movementfor every action, there is an equal and opposite reaction...

Room 217 is The Best 2022-08-29

28 Items: samavaremyliamandyjackmateohazeljacobcarsonannikaoliviadominozephyrsawyeradriancedricpolinacharlierussellamolikacarolineannamikabrooklyncharlotteThe name of our schoolThe name of your teacherThe name of Principal Malone's pug