states of matter Word Searches

Unit 5 Word Search 2023-03-08

10 Items: XVILOCKEOF RIGHTSOF POWERSBONAPARTECOURT OATHROBESPIERREphilosopherOF BASTILLEOF THE RIGHTS OF MAN

Mathcounts Terms 3 2023-12-09

44 Items: Half of a circle.A positive integer.A polygon with four sides.Having the same shape and size.The sum of the digits of a number.A positive or negative whole number.A number without fractions or decimals.The average value of a random variable.The point where a line crosses the y-axis.A set of equations with the same variables....

Chapter 6 Chemistry Review 2023-01-10

10 Items: 6.022·10^23The mass in grams of 1 mol of the substance.A small unit of mass equal to 1.66·10^-24 grams.Which has more mass, 1 mol of silver or 1 mol of lead?The number equal to the number of carbon atoms in 12.01g of carbon.The weighted average of the masses of all the isotopes of an element....

Word Search 2024-04-05

34 Items: corefogscrusthazesveilspallsmistscavummuruscaudamantlematterflumencirrusshadowsshroudsmantlesvolutusvolutusfluctusculumusstratusbiospheregeosphereatmosphereconvectionhydrospherelithospheresilvagenituscumulonimbusasthenosphereflammagenitusphotosynthesiscataractagenitus

Physics Skills 2025-10-09

34 Items: TimeMathsForcesAtomicFusionForcesMatterEnergyOpticsQuantumNuclearEthicalDynamicsParticleVelocityResearchteamworkMechanicsAstronomySubatomicRelativitysolidstateLaboratorynetworkingElectricityAstrophysicswordsearchesCommunicationComputationalFluidmechanicsThermodynamicsProblemsolvingElectromagnetismsuperconductivity

Growing Media & Soil Word Search 2025-12-02

30 Items: SoilSandPeatMossMediaGasesMatterGrowingPerliteOrganicLiquidsClimateErosionContourTerraceNo-TillCocoCoirSphagnumNutrientMineralsPhysicalChemicalMulchingInorganicRoot-HeaveGlaciationCover-CropVermiculiteSpeleogenesisMicroorganisms

Sicily’s Halloween Word Search 2022-10-05

15 Items: Sweet foodWolf monsterMagical womanCar of a witchApposite of dayOrange vegetableDemonic creatureBones of a personMonth of HalloweenBlack bug with 8 legsSoul of a dead personBlood drinking monsterOutfits worn on HalloweenMakes werewolves come aliveResting place of a dead person

Saints 2025-10-26

12 Items: MaryLucyof ArcPatrickDe PaulNicholasAnthonhyof assisiValentineElizabethof LisieuxChristopher

Animals of the World 2024-09-15

15 Items: The largest animal on Earth, found in all oceans.A long-living reptile found in the Galápagos Islands.The largest land animal, known for its long trunk and tusks.The largest primate, native to the forests of central Africa.This bird of prey is the national symbol of the United States.A large, herbivorous mammal with one or two horns on its nose....

Sociology Final Word Search (1) 2024-12-13

15 Items: data that you collect firsthandsomething that is usual, typical, or standardWorking towards ending or resolving inequalityWhen you internalize all the behaviors of a groupEvery individual evaluates behavior by that behavior’s worthPrior court decisions must be recognized as precedent case law...

Participles 2022-06-23

9 Items: past participle of bepast participle of buypast participle of wakepast participle of comepast participle of knowpast participle of givepast participle of drinkpast participle of beginpast participle of break

verbs 2025-04-05

10 Items: the past of gothe past of eatthe past of buythe past of seethe past of tellthe past of tellthe past of havethe past of writethe past of speakthat past of sleep

World Word Search 2025-06-27

19 Items: GodPoollifelovedSavedof GodHeavenchosenhealedFamilySpiritChangerMatthewforgivenKids Campto win itmasterpieceof the weekof the world

Chapter 11 Word Search 2024-05-03

37 Items: the outermost layer of our atmospherethe lowest layer of Earth's atmospherean instrument that measures temperaturemeasures the distance north or south of the equatorwinds that occur in belts that go all around the planetan instrument that measures wind speed and wind pressure.heat-driven cycles that occur in the air, ocean, and mantle...

Congress Word Search 2025-10-06

19 Items: meaning two chambersOne of your US Senatorsthe lawmaking branch of governmentthe vote taken to end a filibusterthe number of members in the Senatethe process of redrawing district linesthe type of representation in the Housethe type of representation in the SenateYour US House Representative for District 5...

Socialisation, culture and identity 2024-05-21

17 Items: going against the normsmeaning variety or differenceexpected patterns of behaviourthings enjoyed by the majoritya merging of two or more thingssmaller group within a larger groupsocial control from family or peersideas that society sees as importantprocess of learning norms and valuessocial control from the police or laws...

Writings of Wisdom 2025-12-13

12 Items: JobGloryIsaiahWorkerPraiseof LifeEternalWorshipof SolomonDeliveranceof the WorldResurrection

Enlightenment and French Revolution 2024-10-04

19 Items: clergynobilitylouisxviJohnlockeadamsmithof powersof terrorguillotinenaturallawsmontesquieubourgeoisierobespierreThomashobbeslaissezfairethreeestatesnaturalrightssocialcontractcongressofviennanapoleonbonaparte

word search 2025-10-22

12 Items: XVIFranceDantonestatesnapoleonmonarchyof terrorguillotinerevolutionAntoinetterobespierreof the rights of men

Zack & Kyli 2024-11-10

23 Items: Guns UpBest ManHometownDog's NameRing BearerMaid of HonorYears TogetherCollege MascotWhere They LiveBride's Maiden NameMonth Zack ProposedMother of the GroomMother of the BrideGroom's Middle NameBride's Middle NameGroom's Zodiac SignCollege They Went ToGroom's Favorite TeamColor of Groom's EyesBride's Birthday MonthBride's Favorite Movie...

Science 2024-05-06

38 Items: and diffusedpressure exerted by aira measure of the amount of storagedevice for measuring atmospheric pressurethe quality of being hot; high temperature.the outermost region of a planet's atmosphere.winds that occur in belts that go all around the planetvapor water in a vaporous form especially when below boiling...

6.2 Thermal Energy 2025-01-16

33 Items: gaslidheatlightmodelsolidenergyliquidsystemopaquemattervacuumcelsiuskineticvibratethermalcriteriaparticlesradiationreflectedabsorptionconductionopensystemconstrainttransmittedevaporationtemperaturetransparentcondensationclosedsystemcontrolvariabledependentvariableindependentvariable

verbs 2025-04-05

10 Items: the past of gothe past of eatthe past of buythe past of seethe past of tellthe past of tellthe past of havethe past of writethe past of speakthat past of sleep

Gerrie 2025-12-15

16 Items: Your NFL TeamYour last nameYouur bosses nameYour husbands nameYou wear these to seeFriend that plays golfthe color of your hairFriend that likes DisneyThe company you work forYour husband had this jobFriend that plays poly hockeyYou celebrate this holiday in DecemberWe went to this city in Florida in 2024We played this activity at Hinkle Fun Center...

Endocrine System 2022-10-03

24 Items: master glandsugar in urinetumor of a glandeyeball protrusiongland making insulinhormone from testiclesmyx/o is combining formword for increased thirstabnormally low blood sugardry, waxy swelling of skinhormone of body metabolismglucose-lowering medicationstimulator of fight or flightgland located above each kidneyremoval of a non-specific gland...

Human and Social Biology 2022-12-09

22 Items: Gas to SolidSolid to GasLiquid to GasGas to LiquidLiquid to solidSolid to liquidTightly compactedMovement of WATERSlightly sepraratedNeeded for photosynthesiscollection of different cellsFewer molecules and separatedThe shape of the red blood cell.collection of different tissues.Form tissues that line the body cavities....

Integumentary Search 2022-09-26

30 Items: fat layerpiercing woundfriction woundcovers the bodycavity with pusdeath of tissueabsence of germskilling bacterialice infestationfluid filled sacsolid lesion >1cmtorn, jagged woundblue color of skindeep linear splitscaused by itch mitewasting of epidermisabnormal hair patternanother name for boilanother name for hivesanother name for armpit...

Vayera 2024-11-10

18 Items: יִצְחָקהִנֵּנִיYeshua’s mother.Rebekkah’s father“And he appeared”“The Feast of Trumpets”The Holy One’s appointed time.His name means, “father of a king”This place means “place of sojourners”Eastern border of Egypt, name means “wall”The place Abraham took Isaac for sacrificeThis place means “well of the sevenfold oath”...

Masthead Word Search 2023-02-21

28 Items: journalista reportercapital letterstype of letteringtitle of an articlea piece of reportinga thick visible printa popular type of papera news article or bulletinnewspaper published everydayline giving the date of writingnewspaper published once a weekthe main article in a newspaper.information about current eventsnewspaper appearing every 4-weeks...

Pathophysiology Word Search 2025-09-07

20 Items: Something you can see or measureHow often a disease causes deathCause behind why a disease startsWhen a disease suddenly gets worseYou are born with it, doesn’t develop overtimeWhen symptoms get better or disappear for a whileShape,Structure, or Appearance of cells or tissuesDiscovery of what disease or condition someone has...

Shaping Earth's Surface 2025-09-25

20 Items: Melted rock found beneath Earth’s surface.A plate boundary where two plates move apart.A small tectonic plate located near Indonesia.A mountain formed when magma, ash, and gases erupt.A measure of the energy released during an earthquake.A small tectonic plate in Southeast Asia, near Myanmar.An ancient mountain range in the eastern United States....

Word Search 2024-04-05

34 Items: corefogscrusthazesveilspallsmistscavummuruscaudamantlematterflumencirrusshadowsshroudsmantlesvolutusvolutusfluctusculumusstratusbiospheregeosphereatmosphereconvectionhydrospherelithospheresilvagenituscumulonimbusasthenosphereflammagenitusphotosynthesiscataractagenitus

science 2024-09-20

30 Items: GasSolidForceChainCycleMatterLiquidEnergySystemGravityMeltingMixtureHabitatWeatherClimateFrictionFreezingSolutionProducerConsumerOrganismMagnetismEcosystemPollutionDecomposerAdaptationEvaporationElectricityCondensationPhotosynthesis

Radioactive Thanksgiving 2025-11-19

25 Items: pieHamatomlifefeastgasessaladgravygreensmattersolidsturkeyharvestisotopeliquidsneutronprotonsdressingthankfulparticlesparticlesradiationgratituderadiationpotato pie

Valley Word Search 2023-02-23

25 Items: a combination of tread and riserthe upper interior surface of a rooma upper horizontal portion of a stepthe horizontal member of the shutterdevice giving protection from the suna vertical distance between two successive treadthe lowest part of the base of an architectural columnThe angle formed at The intersection of two roof slopes...

Assessments and teaching 2023-12-01

21 Items: any curriculum not included in classroom discussioncurriculum that is formally written and tested in the classroomcurriculum that has been implemented into classrooms but not explicitly taughta set of teaching behaviors that have been validated in research such as direct instruction...

History - Chapter 3: The Fertile Crescent 2016-07-11

37 Items: dikesSumerAkkadTorahMosesSinaiDavidJudahstylusTigrisSargonExodusCanaanIsraelPersianBabylonJudaismcontactHebrewsAbrahamGoliathSolomonHittitescovenantpromisedzigguratscuneiformHammurabiEuphratesAssyriansJerusalemMesopotamiacity-statesPhoeniciansPhilistinesCommandmentsFertileCrescent

4th of July 2024-07-04

40 Items: bbqredflagribsbluejulystarspartywhiteparadefamilyhotdogstatesholidaylibertyamericafreedomfreedomstripespicnicscarnivalamericanapplepiesparklerpopsicleicecreampatrioticcherrypiehamburgersparklingpresidentsbakedbeanswatermeloncelebrationcelebrationgrilledcornpotatosaladpeachcobbleramericanflagindependenceday

Veterans Day Word Search 2025-11-10

35 Items: WWIARMYFLAGNAVYWWIIFORCEGUARDFLEETSERVETROOPBATTLECOMBATDEFENDHEROESMARINESTATESWEAPONBRAVERYBULLETSCOUNTRYCOURAGEFREEDOMPROTECTTRIBUTEVETERANVICTORYVIETNAMINFANTRYMEMORIALMILITARYREMEMBERSOLDIERSAMERICANSPATRIOTICSACRIFICE

American Alligator 2024-10-21

39 Items: LakeJawsSkinApexFishTeethSnoutScalyBirdsSmallGatorHolesUnitedStatesSwampsRiversMatingSeasonReptileMarshesArmoredPredatoTurtlesMammalsCarrionStealthAmericanPowerfulAlligatorBellowingFreshwaterEcosystemsCarnivoresEndangeredCamouflageEctothermicSoutheasternConservationMississippiensis

The skeletal system 2025-10-01

18 Items: This is the long shaft of a bone.This bone is located in the upper legThis is the side-to-side curve of your spine.metacarpals are which classification of bone?The sternum is an example of this type of boneThis is the single large bone of the upper armThis is the main core or axis of the skeleton.This is the process of creating new bone growth....

Species Word Search 2025-10-27

18 Items: Physical characteristicObtaining Nutrients from foodMolecule used to store energyProcesses necessary for survivalOrganism that consumes only plantsThe interactions between organismsOrganism that consumes only animalsTrait that helps an organism surviveSpecies that is necessary for ecosystemOrganism that consumes plant and animals...

US Symbols 2024-12-18

20 Items: SamFlagBellSealBillEagleHouseJerseyDonkeyLincolnBuildingRushmoreElephantPentagonof the USWashingtonof Justiceof LibertyConstitutionCourt Building

Revelation 4 2025-11-20

26 Items: doorlioncalfeaglewingsgloryhonorpowerjasperthronebeastsof mancrownsthankscrystalsardinetrumpetof goldraimentcreatedof glasspleasurethe spiritlightningsthunderingsfour elders

Mattot - Massei 2024-07-27

18 Items: מֹשֶהמַטוֹת“Neder”שְׁבֻעָהיִשְׂרָאֵלSon of Nun.Son of JephunnehHe died on Mt. Hor at age 123To grant pardon for an offense.Anyone who kills anyone may flee here.After leaving Ritmah, Israel camped here.You are not to pollute the land with this: ______“My house shall be called a house of ______ for all nations.”...

Earth's Landscapes 2025-11-18

11 Items: moving to and froevidence of past lifecarved by the Colorado riverlayer in earth with lots of fossilsvisible features of earth's surfacemethod for determining age of objectstudy of fossils of animals and plants30 ft below surface used to be under waterlayers of mud + sand/over time become rocklayer of rock often formed on top of another...

family and sports 2024-12-24

18 Items: leapingslow runninga female childthe son of one's siblingthe sister of one’s parentthe brother of one’s parentthe daughter of one's siblinga child of your uncle or aunta father's or mother's fatherthe world’s most popular ball gamesport in which people lift weightsthe sport takes place in pools or open water...

Greek Gods 2023-11-09

9 Items: God of WarKing of GodsGod of the UnderworldGod of music and the artsGoddess of home and familyGoddess of love and beautyWife of Zeus;goddess of marriageGod of Sea, earthquakes, and horsesGoddess of wisdom, crafts, and cities

FSE 116-Mod. 2 2025-08-28

10 Items: What term generally implies being related by blood to the deceased?How is the right to disposition described in terms of its shareability?What entity grants the power to take possession and control of a dead body for disposition?What is the term for the process of arranging for the handling and final placement of a dead body?...

NORTHEAST REGION STATES AND CAPITALS 2016-11-21

22 Items: mainedoveralbanybostonnewyorkvermontaugustatrentonconcordmarylanddelawarehartfordnewjerseyannapolisharrisburgprovidencemontpelierrhodeislandconnecticutpennsylvanianewhampshiremassachusetts

United States and it's allies 2023-05-17

51 Items: italyspainegyptjapanqatarcanadafrancegreecenorwaypolandturkeybrazilisraeljordankuwaitalbaniabelgiumcroatiaczechiadenmarkestoniafinlandgermanyhungaryicelandlativiaromaniabahrainmoroccotunisiaukrainebulgariaportugalslovakiasloveniacolumbiapakistanthailandlithuaniaargentinaaustraliagreenlandluxembourgmontenegronewzealandsouthkoreanetherlands...

50 States Word Search Pack 2025-05-31

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaHawaiiKansasNevadaOregonAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahomaVirginiaLouisianaMinnesotaNewJerseyNewMexicoTennesseeWisconsinCaliforniaWashingtonConnecticutMississippiNorthDakotaRhodeIslandSouthDakotaNewHampshire...

States and Capitals Word Search 2025-12-12

100 Items: IowaOhioUtahIdahoMaineTexasBoiseDoverSalemAlaskaHawaiiKansasNevadaOregonHelenaJuneauAustinTopekaDenverBostonAlbanyPierreAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingAtlantaTrentonLansingMadisonConcordAugustaPhoenixLincolnJacksonRaleighSantaFeOlympiaArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahoma...

Alive Word Search 2025-05-28

20 Items: flowmoresoulpacedownsoulaliveflowsvibesoftenrisesheartmatterwithininsideinsideradiatepeacefulyourselflimitless

Reconstruction 2024-02-20

8 Items: Lincoln's successorThis is what happened to Lincolnperiod of reunifying the country between 1865-1877The amendment the ended slavery except as penalty for a crime.The 15th Amendment protected the right to this regardless of race.prohibited Black people from owning property, firearms, occupying certain places, and testifying in court...

Devarim 2024-08-03

18 Items: King of BashanKing of Heshbon.יַרְדֵּן (English)הַדְבָרִים (English)Brother of the Master.synonymous with “overseer”Number of men it takes for a minyan.The 12 spies are better known as ______.Moab and Ammon were descendants of ____.Moses’ farewell speech to the sons of Israel.The original inhabitants of the territory of Mt. Seir....

irregular verbs 2023-06-06

10 Items: the yo form of pedirthe tu form of medirthe yo form of medirthe tu form of pedirthe tu form of servirthe nosotros form of repetirthe el,ella,usted form of servirthe el,ella,usted form of repetirthe ellas,ellos,ustedes form of medirthe nosotros,nosotras form of competir

Open Word Search 2025-05-28

20 Items: soulzonerealsoulfreeselflovebraveoftenstartvibesheartworthyjoyfulinsidematterbelievemindfulyourselfbeautiful

Reeh 2024-08-24

20 Items: Re’ehTorahThe NameThe Placegood works“THE Prophet”The Feast of Booths“Dreamer of dreams”Instruction, for life!faith cometh by _______.The Diana cult. Acts19:28New Jerusalem’s foundationThe 3rd son of Jacob and Leah.The Jewish method of slaughter.the first pilgrimage festival of the year.“Our struggle is not against _____ ____ ______. “...

World Landmarks 2025-11-30

15 Items: BenGaeDameAbbeyTowerMahalUluruLouvreSphinxof GizaAlcatrazof LondonStonehengeof LibertyPaul's Cathedral

The Jefferson Era 2024-09-03

20 Items: legal authorityprotection moneyleader of the Shawneeloose constructioniststaxes on imported goodsstrict constructioniststype of wagon used to move westhero of the battle of new orleanstreaty that ended the war of 1812site of the death of "The Prophet"explored the purchase north and westexplored the purchase south and west...

Famous Venues 2025-09-14

20 Items: Home of English rugbyHome of Manchester UnitedParis venue of the French OpenIconic New York baseball venueHome of the Los Angeles DodgersStadium of FC Barcelona until 2023Historic home of the Boston Red SoxKentucky racetrack hosting the DerbyIconic London stadium rebuilt in 2007Home of the US Open tennis tournament...

Cycle 1 S2 Week 2 2025-01-21

10 Items: A list of numbers or objects in a special order.a measure of the force applied over a unit area.The use of statistics to determine the probability that a given hypothesis is trueords and phrases that provide a connection between ideas, sentences, and paragraphs...

Cultural universal 2025-09-22

46 Items: ArtFoodrolestrademoneyGoodsToolsMusicSportfamilyverbalvaluesbeliefritualFormalclimatesymbolsshelterclassesWeaponsLeisureof waterlanguageof laborclothingreligionInformalof YouthGeographylandformsResourceseconomicsEducationand OrderproductionGovernmentTechnologytechnologyExpressionLiteratureof survivalconsumptionenforcementDistributioncommunication...

united 2022-12-08

66 Items: rosesagebiomecamelbridgeantigenacologybiologybiofuelbiotechbiomassparsleyaerologyairplaneaccepterantibodybackbonebiometerbroadwaybrooklynconsumercompounddolphinscardamomlavenderaerospaceanabolismastronomyacidulantbiospherebiologistchinatownchemistryatmosphereabsolutismabsorptionantibioticabsorbancecapitalismcryospherecardiologyaerodynamic...

MS13 Ch 8 Vocab 2025-03-14

45 Items: sidesamewallmovievoicemeetingagainstdenyingbusinessfaithfulto returnyou have tountil / evendisappointedabout / overto yell at meyou have donebetween / amongmatters / affairsto leave / to letto hurt / to injurethrowing at him/herto manage / to drivefurthermore / besidesto be able to / powergo (subjunctive form)cinema / movie theater...

BÚSQUEDA DE PALABRAS 2025-06-20

20 Items: SaularmyDavidGiantStoneFaithJesseSlingArmourIsraelBattleGoliathCourageVictoryChampionof HostsSlingshotof IsraelPhilistineUncircumcised

Ambiguity Word Search 2024-12-04

12 Items: This exists when something can have more than one interpretation.______Ambiguity is present when a sentence has two possible tree structures.occurs when a word that has different meanings that derive from a common originthe aspect of a verb which indicates that an event/action is proceeding or on-going...

Part Of Building 2022-09-15

25 Items: is situated above the ground levelis vertical member of step on stairis horizontal member of step on stairis the vertical component of any structureis an isolated vertical load bearing memberare the main entry and exit point of any houseare the horizontal load bearing member of a buildingis a part of a wall just under an opening like a window....

Ancient China Vocabulary 2025-02-18

26 Items: to make the sameable to live foreverpassed along from parent to childto improve the quality of somethingto come into possession of somethinga large group of family members and friendsan official who watches others for correct behaviora Chinese philosophy that emphasizes proper behaviora violent action in opposition of a government or law...

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Chapter 2: Fundamentals of Ecology Vocabulary Review Part 2 2025-09-11

25 Items: The ocean water in an ocean basin.An organism’s role in its environment.An energy-storing level in a food chain.The water that covers the deep ocean basins.Organisms that float or drift in the sea’s currents.A symbiotic relationship in which both organisms benefit.The ocean bottom that extends from a depth of 4,000 to 6,000m...

Chapter 5 Media Name: _________________________ 2025-12-01

8 Items: The apparatuses that bring networks of technology into existence.Media produced by and for indigenous communities often outside of the commercial mainstream.One-to-many communication that privileges the sender and/or owner of the technology that transmits the media....

Genshin Impact 2025-06-18

102 Items: ChildeWolf BoyVoid StarMale twinVago MundoFlame-ManeGolden VowFemale twinEons AdriftShining IdolFrozen ArdorBlazing RiffMujina NinjaTrial by FireValley OrchidStage LucindaTurnfire HuntDire BalemoonWindborne BardKreideprinz(e)Plenilune GazeEclipsing StarWise InnocenceCanine WarriorLens of VerityDriving ThunderVigilant YakshaJuvenile Galant...

Environment Word Search 2025-12-10

39 Items: a small, narrow rivera net made by a spiderthe land next to the seanot harming the environmentcompletely broken or damagedthe colorful parts of a flowerthe height of the sea’s surfacea very large body of salt waterthe layers of air around the Earththe soft covering on a bird’s bodythe thick hair on an animal’s body...

Unit 1 Vocab 2022-09-16

33 Items: lawfactatomcellaniontheorymattercationsolutesolventmonomerpolymerisotopescompoundmoleculesolutionprincipleconstantstechnologyqualitativeengineeringhydrophilichydrophobicquantitativecontrolgroupsurfacetensionmacromoleculesmonosaccharidepolysaccharidevalenceelectronsdependentvariableexperimentalgroupindependentvariable

Unit 1: Energy and Forces 2025-10-31

34 Items: LawNetMassWorkForceThirdFirstSpeedNewtonDirectMotionMatterWeightSecondKineticInertiaGravityConvertInverseThermalTransferReactionVelocityKilogramMomentumReactionBalancedFrictionPotentialCollisionUnbalancedMechanicalElectricalAcceleration

Ecosystems 2025-12-05

33 Items: PreyApexSugarBioticMatterEnergyOxygenArcticPlantsAbioticPrimaryGlucoseSavannaHabitatAnimalsFoodwebMicrobeConsumerProducerTertiaryPredatorTransferSunlightInteractSecondaryWoodlandsEcosystemCommunityFoodchainLifeCycleDecomposerCarbonDioxidePhotosynthesis

Services Word Search 2024-11-14

49 Items: – Government agency that promotes tourism.- What is the act of traveling to and from work called?- What is the activity of traveling for pleasure called?– The promotional name for tourism in the west of Ireland.- What is an urban railway system, often underground, called?- What primary activity involves catching fish and other seafood?...

Brooks and Hannah OO 2024-08-27

24 Items: BRIDE'S DOGWHERE THEY MET?THEIR FIRST DATEHANNAH’S SORORITYGROOM'S FIRST DOGWHERE THEY’LL LIVEBROOKS’ MIDDLE NAMETheir favorite lakeWHO WILL MARRY THEMMAID OF HONOR’S NAMEBROOKS’ FAVORITE BEERCOLOR OF GROOM'S EYESGROOM'S BIRTHDAY MONTHMOTHER OF GROOM'S NAMEMOTHER OF BRIDE’S NAMETHEIR FAVORITE TV SHOWBRIDE'S BIRTHDAY MONTHWHERE THEY’LL HONEYMOON...

Med Terms Midterm Review 2023-04-03

20 Items: cell eatera bone cellsuture a tendondischarge of oildisease producingdifficult movementrecord of a vesselpertaining to bloodcutting into a veinfat tumor or swellingdestruction of a clotexcessively large heartlymph gland inflammationpertaining to against lifesurgical repair of a wrinkleinflammation inside the heartabnormal condition of no sweat...

Constellation Word Search 2023-12-18

20 Items: giving off lighta milky band of lightbig bear constellationsmall bear constellationa floating rock in spacesomeone who explores spacerevolving around somethingthe coldest day of the yearthe hottest day of the yearthe study of celestial bodiesa group of stars that form a shapemirroring light that is put on themthe belief system of constellations...

Coding 2025-06-18

20 Items: RISKPAYERAUDITSDETAILREVENUETHERAPYTEAMWORKSPECIALTYREPLACEMENTSThrough the skinMIS procedure to treat VCFStandard or degree of excellenceWithout variation or contradictionA pulling force applied to a part of the bodyMIS Procedure with balloon assistance to treat VCFConforming to a set of predefined rules, laws, regs...

Elves & Dwarves in Norse Mythology 2022-07-24

10 Items: Sif, Thor’s wife, has her hair cut off by ____ as a prank.In stanza 10, we have the names of two apparently powerful dwarves, ______and Durin, but little is known of them.However, for pagan ________, the lines drawn between these creatures must have been much blurrier than it is for us....

Office Word Search 2023-10-17

36 Items: desmondO_S _ _ _ _ _ _ORV example _ _ _80+ _ _ _ _ _ _ _H_A _ _ _ _ _ _ _R_PDO _ _ _ _ _ _New driver _ _ _ _ _ _Not sober _ _ _ _ _ _ _ _MM _ _ _ _ _ _ _ _ _ _ _ _ _Annual report by REO _ _ _ _ _VRU example _ _ _ _ _ _ _ _ _ _What we call a road _ _ _ _ _ _ _Form of stunt driving _ _ _ _ _ ________, move over _ _ _ _ _ _ _ _...

Theme A word search 2025-04-01

14 Items: gravity forceair resistancerate of change of velocityforce in a stretched rope/stringquantity described only by magnitudeshape of projectile's path of motionquantity with magnitude and directionstudy of forces and their effect on motionreference system describing an object's motionmeasure of an objects resistance to acceleration...

vocabulary building 2023-02-20

25 Items: an entrydoor handlea set of stepsthe frame of doorwaybuilding upper storeya level of a buildingspread between two limitshorizontal upper of stairsthe top surface of a buildingtwo roof surfaces meet each otheran opening in a wall of a buildingthe lowest load bearing part of a buildingstructural element used to divide or enclose...

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

Wave Terms 2025-11-06

21 Items: Unit of frequency.Lowest point of a wave.Highest point of a wave.Material through which a wave travels.The passage of light through an object.Wave changes direction because its speed changes.A wave that requires a medium through which to travel.The number of wavelengths that pass by a point each second....

Cnidarians Word Search 2024-01-29

20 Items: Having a diet consisting of other animals.The ability of cnidarians to regrow lost body parts.Stinging organelles within cnidocytes, injecting toxins into prey.The union of egg and sperm outside the body, common in many cnidarians.Symmetry around a central point, a characteristic feature of cnidarians....

Unit 10 APES Review 2024-05-02

20 Items: Cancer causing agentsType of source pollution from a specific locationType of water with high biodiversity and productivityArea of permeable rock, gravel, or sand that holds waterCover 71% of earths surface and moderate earths temperatureType of water that is clear and has low biological productivity...

6th Grade Unit 1 Lesson 1 Vocabulary 2025-09-26

23 Items: to the third power.to the second powerthe space inside of a shapeEach flat side of a polyhedronEach straight side of a polygon(of a parallelogram or triangle)a type of polygon that has 4 sidesside of a parallelogram or triangletell you how many factors to multiplya point where two or more edges meet....

Fundamental Word Search 2023-11-18

20 Items: A type of suppressed demandTourism arrivals number refers to ____________ demand.___________demand is when geographical location of demand is changed.Tourism __________ are expenditures by international inbound visitors.Visitor arrivals into Singapore are also known as ___________ tourists....

Building Component ANF 2023-02-20

25 Items: rounded stairs edgeswall separating two independent plotlittle room that projects from a roofany level part of a building with a floorthe lowest load-bearing part of a buildingthe horizontal portion of a stair assemblysteel rods that building engineers set in concreteconnect the highest point of intersected roof sides...

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Polish Verb Chcieć 2025-11-04

24 Items: the form of "chcieć" in present tense for "ja" (I) meaning "I want"the form of "chcieć" in past tense for "on" (he) meaning "he wanted"the form of "chcieć" in present tense for "my" (we) meaning "we want"the form of "chcieć" in past tense for "ona" (she) meaning "she wanted"the form of "chcieć" in future tense for "ja" (I) meaning "I will want"...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

Griot Word Search 2025-11-17

25 Items: RulerStorytellersInbetweenersCapital cityMeans "people"Group of travelersSole control of tradeImportant trading cityRuled from 1307 to 1332Reported Muslim historyBoat with triangular sailCenter of trade and learningFounder of a line of emperorsFertile grassland, South of SahelDescendants from a common ancestorCulture of Bantu speaking migrants...

Moose Lodge 509 Nov 2023 Word-Search 2023-10-11

20 Items: Our Lodge MascotMan's best friendCurrent US PresidentCurrent Chapter Senior RegentFirst name of the LOOM ChaplainNumber of barstools we have in useEditor of Anderson Moose HighlightsLast name of our Lodge AdministratorThese Members deserve our many THANKSThe largest planet in our solar systemLast name of our 2022/23 LOOM President...

Revolution Word Search 2025-01-18

20 Items: Queen of France, married to Louis XVIThe state of being free within societyA form of government without a monarchBrotherhood, a spirit of unity among peopleA period of violent repression and executionsThe state of having the same rights and statusThe social classes in pre-Revolutionary FranceA radical political club during the Revolution...