states of matter Word Searches

4th of July 2024-07-04

40 Items: bbqredflagribsbluejulystarspartywhiteparadefamilyhotdogstatesholidaylibertyamericafreedomfreedomstripespicnicscarnivalamericanapplepiesparklerpopsicleicecreampatrioticcherrypiehamburgersparklingpresidentsbakedbeanswatermeloncelebrationcelebrationgrilledcornpotatosaladpeachcobbleramericanflagindependenceday

Report Writing 2025-02-19

9 Items: clearly defined or identifiedability for a text to be read quickly in a glancenot clearly expressed: stated in indefinite termsthe truth about events as opposed to interpretationthe arrangement of things following one after another in timespoken or written account of something observed, heard or done...

Network security 2025-05-14

16 Items: foreverunaltered infopart of red hatour everyday usewas a macro virusnetworking devicepart of wanna cryiris, fingerprintsgroup of computerspart of the CIA triadmesh, ring and otherssecond part of the wanna cryderived from the work triangleprevents you to access your deviceold device rarely used in networkingdeals with different types of hackers

Cell Word Search 2025-01-31

27 Items: The variety of genes within a given speciesAny living factor in an organism’s environmentThe variety of ecosystems within a given regionNumber of different species living in a specific areaAnything that has or once had all the characteristics of lifeSpecies that normally live and thrive in a particular ecosystem...

Pichwai Word Search 2023-05-12

20 Items: The old name of Nathdwara was ___.Deccani or Golconda style of Pichwais originated in _____.A day at Shreenathji ki Haveli is divided into ____ darshans.He was an ardent devotee of Shrinathji and a devotional philosopher.Every Pichwai painting relates to a specific celebration of a ______....

Animals, Colors, Jobs 2023-03-08

20 Items: Animal that barksthe color of dirtThe color of grassThe color of a roseThe color of the skyanimal that slithersThe color of a grapeThe color of the sunThe color of a whiteboardA animal that you can rideA person that likes to singTakes care of people(female)animal that likes to hop(female)A professional at acting(female)...

ART IN EARLY CIVILIZATION (GROUP 2 BSPT 1C) 2025-03-29

20 Items: KaGizaHorusMummyLascauxPharaohPaletteof BullsEgyptianPyramidsNeolithicPaintingsSculptureAfterlifeMesolithicStonehengePaleolithicHieroglyphsTutankhamenof Willendorf

Salon Skin Care 2023-07-10

20 Items: Foul-smelling perspirationCapable of destroying fungiA large blister containing clear, watery fluidThe study of muscles - their structure, function and diseasesAny material that allows or supports the flow of electric currentSmall, red elevated protrusion of the skin, usually containing no pus...

Chapter 16 - Key Terms 2023-11-01

29 Items: A legally enforceable agreement.The cost of the coverage provided by an insurance policy.Payment by the insurer or by the patient of more than the amount due.A person designated by an insurance policy to receive benefits or funds.The determination of the exact coverage to which the insured is entitled....

American Alligator 2024-10-21

39 Items: LakeJawsSkinApexFishTeethSnoutScalyBirdsSmallGatorHolesUnitedStatesSwampsRiversMatingSeasonReptileMarshesArmoredPredatoTurtlesMammalsCarrionStealthAmericanPowerfulAlligatorBellowingFreshwaterEcosystemsCarnivoresEndangeredCamouflageEctothermicSoutheasternConservationMississippiensis

Madison & Wyatt 2025-01-21

20 Items: The wedding date.The name of the groom.The name of the bride.The name of the venue.For cards from guests.The month of the wedding.A favorite candy of the groom.What is the groom’s favorite drink.Dessert being served at every table.One of the bride’s favorite candies.Carries a basket during the ceremony.The main entrée for the dinner buffet....

Ancient China Word Search 2025-03-26

25 Items: complete disorder and confusionthe sovereign ruler of an empirea class of people of high social ranka sequence of rulers from the same familya white vitrified translucent ceramic; chinaa Hindu or Buddhist temple or sacred buildingan official order or commission to do somethingdecorative handwriting or handwritten lettering...

Female Inventors Who Changed the World 2023-08-02

15 Items: First name Marie, discovered radioactivity.First name Margaret, creator of the paper bag.First name Mary, creator of the windshield wiper.First name Melitta, creator of the coffee filter.First name Ayla, creator of the Kindling Cracker.First name Maria, creator of the pop up life raft.First name Katharine, created non-reflective glass....

Harry potter 2023-06-12

14 Items: Scared of spidersHeir of slytherinA Hufflepuff girlFriends with GoyleFriends with CrabbeA twin brother of FredHe killed Nagini the snakeA Chinese girl from RavenclawThe main character of the movieA Weasley that died in the last movieThe smartest one out of the group of 3A lovegood member taken by the death eater...

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Cohesion Word Search 2025-02-14

15 Items: - Regard and consideration for others.- The ability to guide and direct others.- The act or state of forming a unified whole.- The state of being united or joined as a whole.- To defeat or prevail over challenges or obstacles.- The state of having different elements or qualities.- The process of teaching or learning specific skills....

Energy and Matter in Living Systems 2024-10-27

31 Items: ATPlumengranawaterbiomestromamatrixoxygencristaeglucoseaerobicfoodwebproducerconsumerthylakoidanaerobiccommunityautotrophmixotrophglycolysiskrebscyclepopulationchloroplastcalvincycleheterotrophmitochondrioncarbondioxidephotosynthesischemosynthesisbiogeochemicalcellularrespiration

Taxonomy Word Search 2024-01-22

24 Items: organisms.relationships.characteristics.characteristics.The study of the form and structure of organisms.The study of evolutionary relationships among organisms.Structures in different species that share a common ancestry.The science of classification, organizing and naming living organisms....

Health Sciences Word Search 2024-09-11

20 Items: Means "red"Means "self"Means "vein"Means "slow""Anti" means:"Intra" means:Means "around"Between statesMeans "between"Means "lung(s)""Erythrocyte" means:"Intravenous" means:"Pulmonology" is the:Around a certain areaSomeone who draws bloodsomeone's "Tachy" means:Someone who studies lungsThe process of drawing blood...

Communication 2025-04-17

20 Items: the information being relayedthe transfer of information between individualsthe person who sends information to someone elsethe recipient of the message given by the senderanything that may inhibit effective communicationcommunication completed via transfer of electronic messagesrelay of information in as clear and concise a method as possibe...

Study Guide Crossword 2024-04-17

31 Items: viewed from all sidessoft or workable materialclay is fired once in kilnclay is NOT fired in kiln yetrepetition of one or more elementhigh water content, most workablea single material an artist may useliquid material is poured into moldhard less water, but still workablecompletely air dried & very brittlea difference in the use of two elements...

50 U.S. States Uncle Sam 2025-04-14

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaHawaiiKansasNevadaOregonAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahomaVirginiaLouisianaMinnesotaNewJerseyNewMexicoTennesseeWisconsinCaliforniaWashingtonConnecticutMississippiNorthDakotaRhodeIslandSouthDakotaNewHampshire...

States and Capitals Word Search 2025-05-22

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaHawaiiKansasNevadaOregonAlabamaArizonaFloridaGeorgiaIndianaMontanaVermontWyomingColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaNew YorkOklahomaVirginiaLouisianaMinnesotaTennesseeWisconsinCaliforniaNew JerseyNew MexicoWashingtonConnecticutMississippiNorth DakotaPennslyvaniaRhode IslandSouth Dakota...

Early Industrialization 2023-12-01

24 Items: the "working class"money used to investbusiness organizationinventor of Cotton Ginthe new "middle class"perfected the steam enginemovement of people to citiesprocess of combining farmlandterm meaning country/ farmlandsecond country to industrializemade up most of new middle classprocess of removing iron from its ore...

How Well Do You Know Your Model A #5 2023-12-30

20 Items: Charging gaugeA theft deterrent.Leaf spring hanger.______________ bowlA grouping of wires.A vintage brand of tire.pulls air thru the radiator.Center of the wheel assembly.Controls carb and distributorDraws additional gas to start.Original color of radiator hoses.A common brand of updraft carburetor.Wire junction box on top of generator....

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Manifest Destiny 2025-03-11

30 Items: WarActLineTrailFolly49ersDebateDestinyK. PolkPioneerCessionof 1850PurchasePurchaseRailroadof TearsFrontierDisputesGold RushExpansionAnnexationRemoval ActForty-NinersReservationsAssimilationHomesteadersof the AlamoExpansionismof Guadalupe Hidalgoand Clark Expedition

NORTHEAST REGION STATES AND CAPITALS 2016-11-21

22 Items: mainedoveralbanybostonnewyorkvermontaugustatrentonconcordmarylanddelawarehartfordnewjerseyannapolisharrisburgprovidencemontpelierrhodeislandconnecticutpennsylvanianewhampshiremassachusetts

United States and it's allies 2023-05-17

51 Items: italyspainegyptjapanqatarcanadafrancegreecenorwaypolandturkeybrazilisraeljordankuwaitalbaniabelgiumcroatiaczechiadenmarkestoniafinlandgermanyhungaryicelandlativiaromaniabahrainmoroccotunisiaukrainebulgariaportugalslovakiasloveniacolumbiapakistanthailandlithuaniaargentinaaustraliagreenlandluxembourgmontenegronewzealandsouthkoreanetherlands...

50 States Word Search Pack 2025-05-31

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaHawaiiKansasNevadaOregonAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahomaVirginiaLouisianaMinnesotaNewJerseyNewMexicoTennesseeWisconsinCaliforniaWashingtonConnecticutMississippiNorthDakotaRhodeIslandSouthDakotaNewHampshire...

JoiningThePak Wedding Word Search 2022-11-01

19 Items: Amber's jobwhere we methoneymoon locationfirst date activitywhere Alex proposedAlex's favorite foodone of Alex's hobbiesname of our first dogsomebody once told mename of our first catAmber's favorite foodone of Amber's hobbiesname of our second dogblue flower red thornsname of our second catmonth we started datingyears we've been together...

​🇨​​🇦​​🇷​​🇸​​🇴​​🇳​ ​🇼​​🇴​​🇷​​🇩​ ​🇸​​🇪​​🇦​​🇷​​🇨​​🇭​ 2024-05-16

15 Items: What humans BreatheThe end of A long boneAre ocean currents related to windHow Carbon moves out of the atmosphereThe process were liquid turns into gasZone of the ocean that has a lot of sunlightA flexible material found on the ends of bonesThe less muscular of the two types of blood vesselsThe more muscular of the two types of blood vessels...

Pathophysiology Practice 2025-06-15

15 Items: Plantar wartItching sensationMalignant bone tumorOily secretion of integumentFixation or immobility at jointNoise of broken bone rubbing togetherScratching that results in abrasion or woundExcessive forward curvature of thoracic spineInflammatory disease of the eye's uveal tractPlug of keratin and sebum within hair follicle...

Biodiversity Vocab 2023-05-16

19 Items: Environment lacking oxygenVariety and variability of lifeSpecies dwindling toward extinctionAmount of organic mass in an ecosystemOrganisms' natural home or environmentSpecies with no living members remainingSpecies indigenous to the given ecosystemLarge, regional habitat of flora and faunaFormation of new species due to env. change...

G7 WWI Vocabulary from The Great War Dr. E 2025-01-15

13 Items: EasternFrontA formal agreement of peace or trade between countriesThe murder of someone for political reasons, often a political leaderAn agreement made by opposing sides in a war to stop fighting for a certain time; a truce.Also known as the Central Empires or the Quadruple Alliance (Germany, Austro-Hungarian Empire,...

1. Word Search 2025-04-09

14 Items: A tax imposed on imported goods.The increase in the number of people in a country or region.Financial or other assistance provided by one country to another.The unrestricted exchange of goods and services between countries.The quality of life and economic well-being of people in a country....

Adam and Eve 2022-07-18

15 Items: evegodmanadamgoodevillovefruitangelwomandeathserpentof Lifeof Edenfreewill

Unit IV Review: Abs-sci-ment 2024-05-17

22 Items: ______ the Terrible_______ WollstonecraftThe Index of _____________The belief that one should doubt everythingEmpress of Russia known for her Enlightened ideasThe spread and mixing of various cultures and ideasThe idea that the sun is at the center of the solar systemA child who ascends to the throne following a parent's death...

Countries 2022-10-04

17 Items: 🏔🇵🇱🇦🇺🇫🇷🇳🇬🇮🇳🇮🇹🇩🇪🇭🇳🇧🇷🇵🇹🇨🇳🇪🇸🇯🇵🇮🇪🇨🇦States 🇺🇸

Ancient Greece 2025-07-02

20 Items: God of WarThe countryThe languageGod of the seaAlexander the ...Half man, Half goatHalf man, Half bullThe symbol of PoseidonQueen of the underworldLeader of the Greek godsFlew too close to the sunThe colour of Greek easter eggsCity with the fiercest warriorsThe games that started in GreeceGod villain in the Hercules myth...

8th Grade Forces and Energy Chapter 4 Hints 2024-01-04

13 Items: scientific ruleenergy of electric chargesability to do work or cause changeenergy of stretched or compressed objectsenergy that an object has due to its motionpotential energy stored in the nucleus of an atompotential energy that depends on the height of an objectform of potential energy that is stored in chemical bonds between atoms...

CCES Wisers Extended: Word Search 2023-02-22

15 Items: ilayaparademinifairfielddemoboardgamesartcontestthewitnesssportsgamesName of your schooltheme for this yeargroup _____ of Todaygroup ____ of Tomorrowgroup _____ of Yesterdaybeing celebrated right nowWhat you call the students who goes to your school

West African Capitals 2025-02-27

9 Items: Lomé, The capital of TogoAccra, The capital of GhanaBamako, The capital of MaliDakar, The capital of SenegalAbuja, The capital of NigeriaConakry, The capital of GuineaCotonou, The capital of BeninAbidjan, The capital of Ivory CoastFreetown, The capital of Sierra Leone

ART IN EARLY CIVILIZATION (GROUP 2 BSPT 1C) 2025-03-29

20 Items: KaGizaHorusMummyLascauxPharaohPaletteof BullsEgyptianPyramidsNeolithicPaintingsSculptureAfterlifeMesolithicStonehengePaleolithicHieroglyphsTutankhamenof Willendorf

States 2024-03-22

4 Items: JuneauPhoenixMontgomeryLittle Rock

Unit 13 Vocabulary Word Search 2023-03-29

20 Items: To charmDull, boringGive care forTo set on fireNoisy confusionExtremely funnyLarge and heavyWell thought ofTo humble oneselfWork done by handOf or like a motherTo lose interest inTo change continuallyTo make or become smallerTo love and respect dearlyA narrative of heroic exploitsTo say suddenly or without thinking...

Class 4 Science Exam 2023-06-12

35 Items: gasheavylightsolidwaterlightsounddecaywasteopaquematterliquidplasmalivingsafetymethodmeltingheatingcoolingmixturesolublescienceclassifyfreezingsolutiondissolvedecomposefiltrationtransparenttranslucentdecantationsedimentationbiodegradablemicroorganismcharacteristic

Vocabulary Vines Word Search 63-66 2024-09-20

12 Items: of a shiplike a startoward a shipthe wrong namethe act of namingwritten with lighta particle of lightsailor of the starsnaming of the starssailor of the universeput together with lightdistribution in the environment

Executive branch 2025-04-23

17 Items: The spread of a secretCovering of a wrongdoingHighest-ranking diplomatic officerlead staff member of an administrationWritten directive, signed by the president,Process of electing president & vice presidentResponsible for the day-to-day management of the governmentOversees the performance of federal agencies, and administers...

Documents & Correspondence - Glossary and more 2024-12-18

31 Items: Consecutive hoursConsectutive daysReceiver of the cargoStowage plan for containersAlternative term for insurerSynonym for Bare Boat CharterDuplicate of a bill of ladingType of grain; Barley and oatsArchaic term for charter partyVessel sailing along a fixed routeAdditional sum of money to be paidType of grain; wheat, rye and corn...

CVA Review Game 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Breed Word Search 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

"Your word is a lamp to my feet and a light to my path" - Psalms 119:105 2025-01-25

15 Items: The MessiahThe Son of GodTalking to GodFollower of JesusComplete trust in GodThe birthplace of JesusUnmerited favor from GodThe good news about JesusEternal dwelling with GodThe first book of the BibleLove and kindness in actionSongs and poems in the BibleThe holy book of ChristianityStory told by Jesus with moral lessons...

Europe Before the 1700s 2025-04-15

36 Items: RomeAthensSenateSpartaVeniceCrusadeMigrateMosaicsCarthageFlorenceHolylandHumanismRepublicAqueductsGoldenAgeMegalithsLandBridgeMiddleAgesPrehistoryAgricultureCity-statesHellenisticProtestantsReformationFeudalsystemNation-stateNeolithicEraReinaissanceDomesticationMesolithicEraPalolithicEraConstantinopleByzantineEmpireHunter-gatherers...

Toes and Foot Word Search 2024-07-16

20 Items: For an AP foot, the central ray is angled ___ ___ degrees.What part of the 5th metatarsal is on profile on an oblique foot?When positioning for lateral toes the 1st-3rd toes require ___ ____.When positioning for lateral toes the 4th-5th toes require ___ ____.For all positions of the toes how much of the metatarsals in required?...

Random Thoughts 2015-01-28

39 Items: cardogyouredhugsnowfallrainsaltBestyoloThatintodataHippohellonightlighttodaygamesafterwomenthinkbrightjacketfriendwantedstatesrandompopcorntappingtomorrowsandwichSaturdayspellingtogetherthoughtsdifferenthappening

Year 9 English 2024-07-05

35 Items: The ____ Plot 1605______ kills Duncan'half-formed ______''Be the ____ under't'Tennyson was Poet _______Genre of Macbeth: ________'I carving out me _______'Who kills Macbeth? ___________A commanding verb is an ______Poem by Carole Rumes 'The ____'Post __________ Stress Disorder'Straight I unloosed her ______'Playwright of 'Macbeth': _________...

Vocabulary unit 11 2025-05-19

18 Items: A mark indicating the quality of a student's work.The grounds and buildings of a university or college.A college or university student who's not a graduate student.A first-year student at a university, college, or high school.Based on or characterized by the methods and principles of science....

Science Word Search 2023-05-25

25 Items: The ability to dissolveThe harmful rays that come from the sunAn animal that hunts and eats other animalsA scale that shows the acidity of substancesThe SI base unit of thermodynamic temperatureThe type of cloud that tells you a storm is comingWhen different species work together, BOTH benefitThe layer of the atmosphere where weather occurs in...

Latitude Word Search 2025-01-11

30 Items: A group or chain of islandsWhere the land meets the oceanA body of water surrounded by landA large area covered mainly with treesA cold, treeless region with frozen groundA large area of flat or gently rolling landA nation with its own government and bordersA low area of land between hills or mountainsA piece of land completely surrounded by water...

Ch. 4 Medterm Vocab Signs, Symptoms, Diseases, Disorders 2025-04-10

50 Items: scaringrown naila torn or jagged woundabnormally smooth skinfibrous tumor of the skina pinpoint skin hemorrhagean overgrowth of scar tissuea symptom of intense itchingabnormal redness of the skinskin wound caused by scrapinginflammation of a sweat glandtissue related death of cellsabnormally light colored skina discolored flat spot, freckle...

Room 217 is The Best 2022-08-29

28 Items: samavaremyliamandyjackmateohazeljacobcarsonannikaoliviadominozephyrsawyeradriancedricpolinacharlierussellamolikacarolineannamikabrooklyncharlotteThe name of our schoolThe name of your teacherThe name of Principal Malone's pug

Quest 2 2022-10-15

12 Items: The Ancient of Knowledge.Home to the Vermilion elves.A young keeper, blind at birth.Known as the "Jewel of the South."The main antagonist of the Warminster Series.The animal species the Faircloth family breeds.Incanus Dru'Waith is a ____ elf and an assassin.Erud's magical tome is called The Tome of ________....

Chemical Reactions BONUS Word Search 2024-11-08

34 Items: lawplusodormuirarrowatomscolorbondsyieldsmatterchangeokeefemiddleschoolformulacreatedfizzingsciencechemicalreactionequationproductsbalancedmoleculecompoundreactantssubscriptdestroyedsubstancechemistryrearrangedcoefficientprecipitateconservation

Chemistry Word Search 2025-05-22

35 Items: ionssilkplusoxideminussolidarrowmatterprotoncottonoxygenDiamondneutronstripedelementelectronbracketsmixtureshydrogenchlorinechlorinepressureequationreactionsubstancechemistrymetalloidsubscriptlaboratorydecomposedcombustionfertiliserfundamentalevaporationelectrochemistry

Slappy Word Search 2024-07-22

20 Items: NightZombiesBeware!of a Dummyof the Jack!in DreamlandFriend SlappyBlood Is Backand the Beastwith the StarsBirthday to YouGhost of Slappyof the SquawkerAlive! It's Alive!from Shudder Mansionof the Invisible BoyAm Slappy's Evil TwinDo Not Feed the WeirdoDummy Meets the Mummy!Call Me the Night Howler!

Mitosis 2023-02-21

17 Items: The life of a cell.Two Identical Cells.The last phase of mitosis.The second stage of meiosisThe first stage in cell division.An organism of one or more cells.The process by which a cell divides.Division of the cytoplasm of a cell.To repeat or copy (something) exactly.The process in reproduction and growth cells....

Gabby's Wave Word Search 2022-11-28

10 Items: - The lowest part of a wave- Area of maximum displacment- The highest part of the wave- Area of maximum displacement- Measurement of maximum displacement- distance of one complete wave cycle- Moves parallel to the wave of motion- Waves or vibrations produced per second- Moves perpendicular to the wave of motion...

DNA Word Search - Talin Smith 2025-02-21

20 Items: - The twisted-ladder shape of DNA.Characteristic of pyrimidines (t & c)- Structures in cells that contain DNA.- The sugar component of a DNA nucleotide.- Weak bonds that hold DNA bases together.- DNA consists of two complementary strands.Characteristic of purines (adenine & guanine).A nitrogen base in DNA that pairs with thymine....

ATOMS  2020-09-24

35 Items: BOHRWAVEATOMSCLOUDGASESMODELREPELENERGYMATTERPROTONQUARKSATTRACTCOMBINEELEMENTISOTOPELIQUIDSMOSELEYNEUTRALNEUTRONNUCLEUSADHESIONELECTRONMOLECULENEGATIVEPOSITIVEFLAMETESTSUBATOMICATOMICMASSDEMOCRITUSJOHNDALTONRUTHERFORDATOMICNUMBERATOMICWEIGHTSCHROEDINGERQUANTUMTHEORY

Ham Radio 2024-07-12

20 Items: High power operation, typically more than 100 watts.A device used to transmit and receive radio signals.Extremely low power operation, typically less than 1 watt.A contact or conversation between two amateur radio operators.A combined transmitter and receiver unit used for two-way communication....

Cognitive Word Search 2019-10-16

35 Items: axonlobegreypinkbrainfoldsshortsmelltastetouchmattermemoryvisionthoughtemotionfrontalbarrierhearingtemporallongtermdopamineamygdalabreathingdendritesoccipitalbrainstempituitaryserotoninprocessingCerebellumneurologistelectricityhemispheresneuroscienceneurotrasmitters

Word Search 1 2024-01-16

35 Items: billfelttestmoonmindloverainbluewishreadydancecellspaintcausetrainmattersquarecenterenergyregionreturnpickedsimplefarmersdividedgeneralsubjectbelievememberssuddenlyanythingexercisesyllablesdirectiondeveloped

Trust Word Search 2025-05-28

20 Items: joyjoynowflowsouldeepheartpeacegoingaliveabovefullyjoyfulmatterpeacefullight inyourselfserenitybeautifulresilience

Ecology 2025-01-24

26 Items: that has or once had all the characteristics of lifefactor-Any living factor in an organism’s environmentNumber of different species living in a specific areadiversity-The variety of genes within a given speciescommunity and all the nonliving factors that affect itdiversity-The variety of ecosystems within a given region...

Science 9 Matter and Chemical Change 2025-01-21

44 Items: AtomIonicProtonEnzymeAlkaliCausticColloidDensityDuctileElementnucleusNeutronProductEmulsionDiatomicToxicityInvertedElectronReactantCatalystPoloniumcompoundInorganicPollutantGermaniumViscosityCompoundsCorrosionGalvanizePrecautionSolubilityExothermicExothermicInhibitorsHomogeneousQualitativeEndothermicEndothermicQuantitativeMalleabilityConductivity...

Matter & Energy in Ecosystems Word Search 2025-04-16

25 Items: SunApexPreyFungiEnergyPrimaryTrophicFoodWebHabitatPyramidTertiaryPredatorOmnivoreOrganismProducersConsumersSecondaryNutrientsHerbivoreCarnivoreFoodChainEcosystemQuaternaryPopulationDecomposers

Genetics Word Search 2025-02-18

25 Items: The study of heredityDifferent versions of a genePassing of traits from parents to offspringAn organism's physical appearance, or visible traitsAn organism's genetic makeup, or allele combinationsAn organism that has two identical alleles for a traitAn organism that has two different alleles for a trait...

Random Thoughts 2015-01-28

39 Items: cardogyouredhugsnowfallrainsaltBestyoloThatintodataHippohellonightlighttodaygamesafterwomenthinkbrightjacketfriendwantedstatesrandompopcorntappingtomorrowsandwichSaturdayspellingtogetherthoughtsdifferenthappening

Current Events 4-22-25 2025-04-22

41 Items: FedPopehelddiedtombpicknextPopeSaintPeterheartworldFiredTrumpChairagainSquarestrokepraiselegacydeniesburiedsimpleseniorchurchUnitedStatesstockstumblebashesFrancisfuneralfailureleadersadviserleakingleadersSaturdayPentagonconclaveinformation

U6 Vocab 2023-11-09

36 Items: A seasonal wind.the coldest climateThe climate of a small area3rd layer of the atmosphereWinds that blow from west to eastThe lowest layer of Earth's atmosphereA thin layer of gases surrounding Earthwhen a cold front overtakes a warm frontThe outermost layer of Earth's atmosphere.A person who studies the different climates....

Biology Chapter 11 Vocabulary Word Search 2024-03-19

25 Items: formation of a new speciesthe variety of alleles in a populationthe changes in a population's genetic structurethe effect of chance on a population's gene poola speciation that occurs via a geographic separationa speciation that occurs in the same geographic spacean evolution that results in similar forms on different species...

You Word Search 2025-05-28

20 Items: realmindmorecarefullsoulflowsrootsheartmattergoldenhopefulmindfulforwardgot thislight inserenitycheerfulthoughtshappiness

Vietnam War Era 2025-06-02

40 Items: HueSanhLaosPTSDRatsCongDraftHanoiHawksOrangeTheoryNapalmPapersSaigonAccordsWarfareWarfareCambodiaBien PhuChi MinhDoctrineMovementCommunismof Saigonof TonkinOffensiveEscalationPowers ActContainmentand Destroy(Viet Cong)Lai MassacreWestmorelandPeace AccordsChi Minh TrailVietnamization(Prisoner of War)(Lyndon B. Johnson)Thunder (Operation)...

Unit 3: Electrons in Atoms 2023-09-26

20 Items: 3.00 x 10^8 m/sHeight of a waveparticles of lightthe arrangement of electrons in an atomElectrons on the outermost energy level of an atomthe clockwise or counterclockwise motion of an electronthe possible energies that electrons in an atom can havenumber of complete wavelengths that pass a point in a given time...

Force and Motion 2025-05-15

27 Items: speed in a directionan object changes its positiona push or pull acting on an objecta force that pulls objects toward each other\a measure of the amount of matter in a samplethe process of energy changing from one form to anothera force that acts in the opposite direction to movementfor every action, there is an equal and opposite reaction...

History & Wildlife Conservation 2024-01-17

27 Items: value to earn moneyfirst national parkfather of soil conservationpublished a book about birdssystem of safe wildlife areaspart of USDA to manage forestsvalue to enjoy wildlife's beautyfather of the conservation movementpopulation is close to becoming extinctthe use of natural resources for profitpopulation is close to being endangered...

Natural Resources 2024-03-10

25 Items: resources that occur naturallymixture of gases surrounding earth3 types of inexhaustible resourcesremains of decomposed plants & animals3 types of renewable natural resourcesnatural resources used to provide energycycle where water is continuously renewednatural inorganic substances on or in earth2 types of of nonrenewable natural resources...

Global II Review 2025-05-22

24 Items: "Gold, God, and Glory"Heroes in a half-shellLouis XIV's fancy house.Earth-centric solar systemSeafaring Scandinavian warriorsA region of religious significanceThe capital of the Byzantine Empire.The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever....

Chapter 3 2025-02-10

15 Items: fallforceforcefieldforceweightgravityinertiafrictionvelocityresistance1st law of motion2nd law of motion3rd law of motionof conservation of momentum

Variation 2023-05-18

20 Items: A random change in DNAThe variable you changeThe variable you measureThe organelle that contains DNAThe variables you keep the sameA different form of the same geneThe technique used to photograph DNAA result that does not fit the patternCharacteristics we get when we are bornThe change in species over millions of years...

Green Tree Frog 2024-10-20

43 Items: ToeTreeFrogHylaHuesSkinPadsGreenGreenMoistFliesMothsTreesWaterPondsDenseUnitedStatesBrightYellowGoldenSmoothBushesSwampsSeasonStickyCinereaInsectsSourcesMarshesFoliageArborealBreedingTadpolesClimbingAmphibianNocturnalPredatorsVegetationMosquitoesCamouflageVegetationSoutheastern

Current Events 4-28-25 2025-04-28

41 Items: oneonecarnewdaysCzarvotetalkwithTrumpfortyfirstWhiteHouseplowscrowdPrimeChinathreeratingborderspeakselevenperishdeniesclaimsUnitedStatespercenthundredtariffsmothersapprovalFestivalMinisterunderwaychildrendeportedVancouverCanadiansParliament

Aiden 7th grade 2024-05-16

15 Items: the driest of all the biomesthe biological variation that occurs within speciesa ridge of rock in the sea formed by the growth and deposit of coral.the variety of different habitats, communities and ecological processesthe variety of life in the world or in a particular habitat or ecosystem....

VOCAB 2023-05-15

11 Items: the moisture in the air.a weather instrument that measures air pressure.the weight of the molecules in a large mass of air.forms when colder air mass moves a warmer air mass.rapitly,whriling,funnel shaped could that reaches down from storm.steady winds that flow from west to east between latitudes 30N and 60N...

Interactive Cafe Chapter 12 Word Search 2025-02-28

12 Items: a party that forms to oppose immigrantsa part that is exactly like another parta native-born American who wanted to eliminate Foreign Influencecompleted in 1825, this waterway connected New York City and Buffalo, New Yorka plan introduced in 1815 to make the United States economically self-sufficient...

All things quality 2022-12-13

18 Items: a name of a QC xxxquality is a "xxxxx" not an actpeople representative for qualityquality can improve this "12 letters"a brand of chocolates "quality xxxxxx"one of Bede's values (POD - 6 letters)best place to work (company name "xxxx")a brand / manufacturer of quality cars (Swedish)quality can improve this with customers / clients...

Beshelach 5.0 2025-02-02

16 Items: “Yam Suf”“mitzvot”The Seventh DayWho saved Israel?“Bread from heaven”The meaning of “Beshelach”The place of extreme hunger.The place of the bitter waters.The seabed for the children of Israel.at this stop there was no water supplyThis stop was at the edge of the wilderness.The place of the 12 springs and 70 palm trees...