spanish Word Searches

Review 7, En la sala de clases (Spanish I) 2021-05-17

15 Items: milnotasahoratomarfiestallegarleccionejemploapuntesmeriendaestudiargimnasioprepararbusescolarmedianoche

Review 7, En la sala de clases (Spanish I) 2021-05-17

15 Items: milnotasahoratomarfiestallegarleccionejemploapuntesmeriendaestudiargimnasioprepararbusescolarmedianoche

Review 7, En la sala de clases (Spanish I) 2021-05-17

15 Items: milnotasahoratomarfiestallegarleccionejemploapuntesmeriendaestudiargimnasioprepararbusescolarmedianoche

El cine, el museo y el teatro (Spanish II) 2021-11-18

15 Items: cinefilaluegometromuseocuadroteatroasientoartistaestatuapantallapeliculaescultorescenariosubtitulos

El cine, el museo y el teatro (Spanish II) 2021-11-18

15 Items: cinefilaluegometromuseocuadroteatroasientoartistaestatuapantallapeliculaescultorescenariosubtitulos

Review 5, En el aeropuerto, parte 2 (Spanish II) 2021-12-14

15 Items: paissaberaduanapilotoabordovolverconocerabordardespegarfacturaraterrizarpasajerosbienvenidadesembarcartripulacion

Review 9, La computadora y el fax (Spanish II) 2022-02-22

15 Items: faxrotoratondatosbotonsacarapagarpulsartecladoprenderguardarmaquinapantallaimpresorabocaabajo

Review 11, Las tiendas y sus productos (Spanish II) 2022-02-24

15 Items: pancajacinelataorejaanchodeoropuestopastelfrescofrascodocenaSevendebotellapescaderia

Review 11, Los pasatiempos y el zoologico (Spanish II) 2022-04-06

15 Items: botemonomimodamasfichajaulanoriaglobosellospayasoajedreztiovivopiraguafutbolincrucigrama

Spanish Speaking Countries of Central America & Caribbean 2022-09-10

9 Items: cubapanamahondurasguatemalanicaraguacostaricaelsalvadorpuertoricodominicanrepublic

Love My Library Word Search 2025-09-04

100 Items: YAJFERLPGNTBRILLSRPteaWCPLcardclubcallNerfiSpyLegobookspagesspinecrimelabelgamesclerkgenremediacomicnovelebookLibbycoverstampAnimeauthorborrowhorrorpuzzlecraftsstackspatronbrowsereservefictionfantasyromanceclassicshelfiedisplaykeywordprogrammysterybarcodecatalogscannersubjectchapterrequestdigitalEnglishSpanishSamForebookmarkarchivesthrillerLaVernia...

All About School 2025-09-25

100 Items: ArtBusGymLabBandBookDeskGlueIdeaMathPoemQuizSTEMTapeTestAngleBoardBrainChairChartClassEarthEaselEssayLunchModelMusicNurseNotesPaintRulerStudyAnswerBinderCircleCrayonDesignEnergyFolderFrenchLaptopLessonMarkerOfficePencilRecessAlgebraBiologyCookiesEnglishHallwayHistoryJournalLibraryLockersPolygonProblemPrinterScienceSpanishStaplerTeacherBackpack...

Back To School Word Search 2026-07-29

100 Items: ACTArtGPASATAIMSDeanPensPromTestChoirDanceLatinRulerTrackDebateFrenchGermanHomeEcJuniorMascotPaddlePencilSeniorSoccerAlgebraAZMERITBiologyCollegeDiplomaEnglishGeologyHistoryMarkersPhysicsPreCalcReunionSpanishTeacherTheatreBackpackBaseballCalculusCeramicsComputerFootballFreshmanGeometryHomeworkNotebookSoftballYearbookCafeteriaChemistryChessclub...

Welcome To Middle School! 2026-04-30

21 Items: Our Middle School PrincipalWhere you check your gradesWhere you eat lunch each dayWhat recess is called in middle schoolSomething you study and grow in ScienceWhat we do at the end of every Math unitSomething that increases a bit in 6th gradeA test you take multiple times during the yearThe book current 6th graders are reading in LA...

world war 1 word search 2025-01-30

20 Items: a German Reicha nazi dictatorsways and bluesGerman Physicisteconomic declinedomestic programsGerman Philosopheritalian politicianthe 32nd U.S President124th emperor of Japana austrian neurologistassociated with germanyspanish military generalspace and time are relativedramatic stock crash crisisone nation trying to stay out of war...

vocabulary choice sheet 2025-01-29

20 Items: German ReichGerman physicistphysics theoriesdomestic programsGerman philosopherItalian politician32nd U.S. PresidentAustrian neurologistswing and blue notes124th emperor of JapanSpanish military generaaggressive foreign powerNazi Germany world leaderassociated with Nazi Germanysevere global economic downturnEnglish economist and philosopher...

7th Grade 2025-10-20

100 Items: AVASunWikArtKIYAAYLAKINGLAWSEMMAJAKEFOOTSafeKindMathShopBANKSNIXONGEHRTDIXONTOMASKLINGGRACELOGANTEVYNGRANTSONESSTARRTWISSRYLEEWaughLunchVICTORCUEVASBRODENZAYLEEGOLDENANIYAHGORDONDECKERGORDONHARRISNATHANHILTONJAETYNKELLERKANNONDECLANKRUGERMARTINNELSONCARTERDARIANZARATENEVAEHZILLERDANIELLeflerWilsonCoomesJordanHealthRecessMACKSONBRAXTONFANCHERCAMBREE...

Alphabet Word Search 2026-04-14

100 Items: BUSYOUArtFunMathBellQuizLateNiceDESKGLOBERULERLEARNMusicChairChalkExamsPAPERAPPLEBOOKSLoyalSweetYouthSkillSMARTSCHOOLWISDOMEthicsFOLDEREraserMarkerGRADESRecessMentorBrightLovingDIPLOMACOLLEGESTUDENTPROJECTSpanishBiologyScienceEnglishHistoryLibraryHelpfulTEACHERMindfulAmazingPatientALPHABETBACKPACKYEARBOOKTEAMWORKCalculusExerciseSCHEDULENOTEBOOK...

Vwo 1: Unit 1 2025-02-19

99 Items: PEDIEPENSONAUNTBALDCALLDESKFLAGLIVELONGONLYSPOTSTEPUGLYWAVYAGREEBRINGDUTCHGREATITALYLEARNNIECEOLDERQUITESHORTSMILESPAINSTORYSTUDYTEACHTHINKTWINSUNCLEUNITEWORLDACCEPTBRACESCHANGECOMMONCOUSINERASERFAMILYFRANCEFRENCHGERMANINVITELESSONMIDDLENATIONNEPHEWOLDESTPERIODPENCILRUBBERBIOLOGYBRITISHCOUNTRYCULTUREDISLIKEENGLANDENGLISHGERMANYHALLWAYHISTORYITALIAN...

Rascacielos Word Search 2025-10-06

30 Items: To doPuzzledCar beecar bombwild catMidfieldMudguardCemeterypacemakerUmbrellasSpiderwebDeaf muteskyscrapersalvavidasCorkscrewsTo imitatechiaroscuroEnvironmentBittersweetUp and downarmored bodyhigh and lowBottle openersblack and whiteSpanish speakerPencil sharpenersperson who carries and brings gossipA condition where a person’s foot has no arch...

Miscellaneous Word Search 2026-02-03

100 Items: ToMuNuCatDogTonCowPinFoxManCapPhiPsiBellMakeSinkMaleBumpKillWordDuckWhatLyreYolkYokeMachRailJackClapBetaZetaBoneChoreTruckBunnyCluckMournOmegaKappaSmashExcelHenceOrderHappyWomanFaintAlphaGammaDeltaSigmaLatinRomanFemurToiletFemaleRabiesFiddleLambdaCourseTongueLayoutRabbidRabbitMonkeyVenulePictureChickenNuclearZymurgyUpsilonEpsilonRussianItalian...

100 Days! 2026-02-26

100 Items: GymArtMassWetuLentMusicNounsVerbsForceChoirSantaireadGamesStreamProperRecessFunrunSaintsVirtueReflexRosaryTagdayAdventReadingWritingGrammarScienceHistorySpanishSpanishWeatherLettersFluencyBuddiesKineticReflectSnowmanMartinaReligionPronounsSpellingPrudencePatienceFrictionBlizzardPilgrimsDivisionAdditionNativityPeprallyAssemblyKindnessReindeer...

Bride Word Search 2026-03-04

96 Items: LamMayHanReyFarPoeOneLoveVowsRingGownVeilCakeSandKissFoodHomeYodaLukeLeiaSoloKyloAwayHopeDarkSideLunaFinnBobaFettBrideGroomToastUnionNabooForceVaderPadmeAndorRogueEwoksTuxedoHawaiiAlwaysMathewJosephFamilyDinnerChewieOrganaDroidsGalaxyFalconObiWanKenobiAnakinAhsokaBouquetFlowersWeddingRomanceVanessaKaparicFriendsChurrosMexicanItalianWookieeTijuana...

U2L1 # 2 2026-05-12

22 Items: – en– casi– fácil– tarde– difícil– temprano– el examen– muchos(as)– los exámenesis/are... – hay...have to – tener quemany? – ¿Cuántos(as)?– La clase de mecánica– la banda choir – el coro– el arte English – el inglés– la historia Math – las matemáticas– la soldadura woods – la carpintería– las ciencias PE – la educación física...

David 2026-05-29

100 Items: qtwaxchecatweedbeanbongvapejedisithbluntjointmusicpizzawingsopiumtacostitoslegospadmedroiddabrigframermexicomarvelpurplepuffcowaxpenballetbleoodpeppershieldfridayjarvisspanishplayboydoritospadawandiamondcheetahleopardosamasoninfinitiungroundfakeminkesdeekidproducerfortnitegrownupsstarwarsdoomsdayavengersdrpeppertheforcetatooinebuzzballnettspend...

Enlace 3rd 2025-04-08

27 Items: principalLibrariansecurity duoschool mascotraul wears a?one counselorenlace teacherDoms last nameopposite of #4jaydens nicknamewon world seriessecond counselorsuperbowl champsboys championshipgirls championshippopular chip snackHer name 3 lettersother security duo3rd planet from sunfemale college champs"the soup" in spanishkendric yells word (m)...

11th Grade Wordsearch 2025-04-25

99 Items: joseaxelalexlevianjuryanirischanjuanellanoeljennandycrisjordikailaelderaprilyorchkarenchrisoscarkevinkevinhenrydiegojaredchloeemilyhazelerickashlydavideliasmusickyireekayleejohnelmathewjaydenheileythaniacarlosnahomychyanekelvinnatalyandreadidierjavierximenaarianaalisonjosephdorianamarredaminestaceymiguelmscarrenriqueantoniodamareadestenydaniela...

WELCOME BACK! 2025-07-27

100 Items: GUYARTWOODSIPEGOLFAMORYOGARUSHMATHHERDWOLFHULLBANDMYERSSITESSCOTTPLANKWIDUPBRYANCHEERYOUNGBIBBYGREENSCOTTKINGSTEMMEBRANZDAVISWOOLFMALOYMILEYHURSTCHOIRADAMSDEPOYLUNCHHINESBURCHKARMELWILSONCOOPERPORTERBANGELINGRAMBENNERBARKERTENNISSTOUGHMENTORSPEECHGIBSONHONORSSENIORBIOLOGYSEAGERTAULBACHWENGERDBURROUSBIRNELLPHYSICSCLINTONSPANISHSCHULTZALGEBRASCIENCE...

Alphabet Word Search 2026-04-14

100 Items: BUSYOUArtFunMathBellQuizLateNiceDESKGLOBERULERLEARNMusicChairChalkExamsPAPERAPPLEBOOKSLoyalSweetYouthSkillSMARTSCHOOLWISDOMEthicsFOLDEREraserMarkerGRADESRecessMentorBrightLovingDIPLOMACOLLEGESTUDENTPROJECTSpanishBiologyScienceEnglishHistoryLibraryHelpfulTEACHERMindfulAmazingPatientALPHABETBACKPACKYEARBOOKTEAMWORKCalculusExerciseSCHEDULENOTEBOOK...

Estefani Word Search 2026-05-22

30 Items: KFCStefiTacosMazapanGlitterEstefaniKitty <3SpongebobThriftingKali UchisHello KittyChicken Runtu prometidoSelena GomezMy _________Fleetwood MacOur fav colorMs. Lauryn HillAriana (Grande)Glitter _______Your birth monthWe both did this!Where you're fromYou're going to one soon!Amazing World of _________Estefani _________ Aguilar...

Spanish Speaking Countries of Central America & Caribbean 2022-09-10

9 Items: cubapanamahondurasguatemalanicaraguacostaricaelsalvadorpuertoricodominicanrepublic

Spanish Cognates - Business & Finance Verbs (Verbos de Negocios y Finanzas) 2025-03-15

17 Items: ExportImportInvestOperateContractOrganizeRegulateAuthorizeNegotiateAccumulateCapitalizeCoordinatePrioritizeCollaborateParticipateAdministrateCommercialize

Days of the week in spanish 2021-04-15

7 Items: lunesmartesjuevessabadoviernesdomingomiercoles

Days of the week in Spanish 2025-02-21

7 Items: LunesMartesJuevesSabadoViernesDomingoMiercoles

Summer of the Mariposas Chapters 1-7 2025-10-15

15 Items: Mother to InesNumber of sistersLeader and narratorOdilia's magical itemThe baby of the familyThe dead man's first nameSpanish for "butterflies"State where the girls liveMama's job is a __________Country the sisters travel toMythical creature guiding the girlsAnimal that symbolizes transformationFavorite game played by the Garza family...

Word Search! 2024-03-28

15 Items: You drive thisOpens and closesYou sleep on thisWe use them to seeIt's white and coldIt's bright and hotAn animal that flysYou can eat this thingThe teacher of the classYou put them on your feetThe first day of the weekdayAn animal that's black and white70% of our bodies are made up of thisYou carry this to school on your back...

Languages of the World. 2024-09-25

15 Items: Main language in IndiaLanguage spoken in JapanMain language in GermanyLanguage spoken in TurkeyOfficial language of ItalyOfficial language of BrazilCommon language in East AfricaOfficial language of BangladeshWidely spoken across Latin AmericaWidely spoken in Africa and EuropeWidely spoken across the Middle EastThe most spoken language in the world...

A Fun Word Search 🤩🤩🤩 2026-06-13

11 Items: English or Spanish?A province in ThailandTryta gettin’ strongerA country, not far from here(v.) to study a lot (KVIS slang)The most wonderful dish ever createdThe highest area of the mountain rangeA good source of protein, unique to KVISAnother favorite subject of พี่รหัสน้องคิดดีOne of the favorite subjects of พี่รหัสน้องคลัง...

Age of Discovery 2026-01-12

18 Items: The Spanish word for conquerorTo sail all the way around the world.An instrument for measuring time at sea.A movement to spread Catholicism in SpainA strip of land that connects two larger landsPeople who trade, buy, and sell to earn a living.A small, fast Spanish or Portuguese sailing ship.A tool that measures the positions of the stars or sun....

13 Colonies word search 2025-10-08

13 Items: Safe place for CatholicsRoyal colony in New EnglandFirst settled by the SwedishGiven to English proprietorsFirst permanent English colonySmall farms and tobacco plantationsFounded by William Penn for QuakersLarge plantations, rice and indigo farmingOriginally Dutch colony called New AmsterdamFounded by Roger Williams for religious freedom...

Spanish Cognates - Science & Technology Verbs (Verbos de Ciencia y Tecnología) 2025-03-15

16 Items: TestReactDesignModifyObserveOperateClassifyInnovateRegisterSimulateCalculateConstructFormulateExperimentDemonstrateInvestigate

SACS 1-888-999-5545 (English)/1-888-568-8332 (Spanish) 2023-08-30

22 Items: sacscareuconnhuskymajorcampuscollegehotlinesupportconsentrespecthartfordadvocategraduatesemesterprofessorbystandercounselingboundariespreventioninterventionaccompaniments

Spanish vocab - U1-L5-A2 2013-09-02

5 Items: nadarpintardibujarpatinardescansar

L'Ecole Word Search 2024-11-20

46 Items: PEartlawgymmatheasyhardclassgradeschoolfrenchI loveI hateofficeusefulsciencebiologyphysicshistoryspanishenglishlibrarydiplomauselesshomeworkeducationchemistryeconomicsgeographycafeteriaphilosophypsychologyhumanitiesarchitcturescholarshipI don't likeI really likefashion designsocial studieshigher educationComputer sciencepolitical science...

How Well Does My Partner Know Me? 2026-07-26

20 Items: My babyMy babiesIt hates meMy favorite timeMy sister's nameIt wants me deadMy favorite colorMy favorite numberMy favorite tv showA craft with a hookWhat I can't regulateA craft with a needleWhat I don't do enoughOne of our inside jokesWhat my favorite shirt saysSomething that I'm learningMy favorite morning cuddlesWhen I knew you were the one...

L'Ecole Word Search 2024-11-22

46 Items: PEartlawgymmatheasyhardclassgradeschoolfrenchI loveI hateofficeusefulsciencebiologyphysicshistoryspanishenglishlibrarydiplomauselesshomeworkeducationchemistryeconomicsgeographycafeteriaphilosophypsychologyhumanitiesarchitcturescholarshipI don't likeI really likefashion designsocial studieshigher educationComputer sciencepolitical science...

Hard Word Search 2026-04-15

105 Items: BusArtGymTapeMathDeskBellPensTestQuizDrawReadExamLunchSmartBooksNotesChairMusicRulerTeachClassWriteGradeClockChalkCoachGlobeCubbySchoolApplesPencilSnacksFolderSportsLockerBinderEraserLessonCrayonsScienceEnglishWritingMarkersSpanishHistoryAlgebraBiologyGeologyProjectLibraryHallwayStaplerTissuesJanitorScissorsNotebookLearningComputerTeachersStudents...

The Spanish Alphabet A-E 2026-05-16

5 Items: aguacasadineroelefantebicicleta

francais 2024-11-22

46 Items: PELawGymEasyHardClassGradeSchoolFrenchI loveI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessL’artArtHomeworkEducationChemistryEconomicsGeographyCafeteriaPhilosophyPsychologyHumanitiesScholarshipArchitectureI don’t likeI really likeFashion designComputer science(les maths) MathPolitical scienceEspecially/above all...

French Word Search 2024-11-22

45 Items: artlawgymeasyhardclassgradeschoolfrenchi lovei hateofficeusefulsciencebiologyphysicshistoryspanishlibrarydiplomauselesshomeworkeducationchemistryeconomicsgeographycafeteriaphilosophypsychologymathematicsscholarshiparchitecturei don't likei really likefashion designsocial studieshigher educationcomputer sciencepolitical scienceforeign languages...

French Vocab 2024-12-02

46 Items: ArtLawGymMathEasyHardClassGradeSchoolFrenchI loveI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessHomeworkEducationChemistryEconomicsGeographyCafeteriaPhilosophyPsychologyHumanitiesphysique PEScholarshipArchitectureFashion designSocial studiesHigher educationComputer sciencepas I don’t likePolitical science...

Anna & Kim's friendship puzzle 2026-05-23

20 Items: Patatas _____Where Kim lived____ de ValenciaReally long parkWhere Anna livesTorres de ______City where we metIk hou van _______Valencia's festivalCopa de _____ _____Classic Spanish meatWhere we travelled toAnna and Kim's fav drinkEveryday at 2pm in MarchThe bike that will kill usWhere Kim goes to get tattoosEx: Cabanyal, Malvarossa, Saler......

French Word Search 2024-11-22

46 Items: ArtLawGymEasyHardIloveClassGradeSchoolFrenchI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessHomeworkEducationChemistryEconomicsGeographyCafeteriaAbove allPhilosophyPsychologyHumanitiesphysique PEScholarshipArchitectureI really likeFashion designHigher educationComputer sciencepas I don’t likeForeign languages...

French School Word Search 2024-11-22

46 Items: PEartlawgymmatheasyhardclassgradeschoolfrenchI loveI hateofficeusefulsciencebiologyphysicshistoryspanishenglishlibrarydiplomauselesshomeworkeducationchemistryeconomicsgeographycafeteriaphilosophypsychologyhumanitiesarchitcturescholarshipI don't likeI really likefashion designsocial studieshigher educationComputer sciencepolitical science...

French Vocab 2024-12-02

46 Items: PEArtLawGymMathEasyHardClassGradeSchoolFrenchI loveI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessHomeworkEducationChemistryEconomicsGeographyCafeteriaPhilisophyPsychologyHumanitiesScholarshipArchitectureI don't likeI really likeFashion DesignSocial StudiesHigher EducationComputer SciencePolitical Science...

Spanish Cognates - Education & Learning Verbs (Verbos de Educación y Aprendizaje) 2025-03-15

15 Items: DefineAnalyzeCompareEducateExplainObserveClassifyConcludeEvaluateMemorizeQuestionCalculateRecognizeComprehendIllustrate

Summer Reading Project - Invisible 2023-09-06

11 Items: IllustratorThe antagonist.The author of Invisible.The place Dayara Gomez is from.The month the book starts during.The character accused of stealing juice.The first main character introduced to us.One of the main characters who has 3 sisters.The spanish teacher, also the first person to speak.The young girl whom lives in the van with her mother....

CLASSIC RACING MOTORCYCLES 2023-02-25

10 Items: THEY MADE THE 7RFAMOUS JAPANESE SIX MADE BY THEM500 TWIN RACER DESIGNED BY LINO TONTIDEREK MINTER RODE THEIR TELSTAR RACERJOHN HARTLE RACED THESE ITALIAN RACERSFAMOUS JAPANESE SUPER SIX MADE BY THEMTHREE CROSSED TUNING FORKS ARE THEIR BADGE.SPANISH RACING SINGLE CYLINDER 250 TWO STROKEAGOSTINI HAILWOOD SURTEES AND HARTLE RODE THEM...

SACS 1-888-999-5545 (English)/1-888-568-8332 (Spanish) 2023-08-24

18 Items: freeclientcontrolculturerespectautonomyservicesselfcarealliancediversitybreathingvolunteereducationboundariespreventioncounselingempowermentconfidential

U6 Vocabulary (translate the words from English to Spanish) 2022-11-26

12 Items: LEGEARBODYHEADEYESNOSEHANDHAIRKNEEFEETMOUTHFINGERS

Puzzle Protocol 2026-03-21

12 Items: the ally to call for helpa celebration, spanish styletiny grains covering beachesmixed drink for celebrationssomeone you trust and laugh withland surrounded entirely by watermountain that can erupt lava and ashyou enjoy doing this, climb up and upsand meets water, perfect for a strolltropical tree that sways in the breeze...

LOVE AND ROMANCE DAY 2 SPANISH 2024-12-26

6 Items: catlionzebrahippoelephantMan's best friend

LOVE AND ROMANCE DAY 6 SPANISH 2024-12-26

6 Items: catlionzebrahippoelephantMan's best friend

Spanish Cognates - Emotion & Relationship Verbs (Verbos de Emoción y Relaciones) 2025-03-15

14 Items: UniteAdmireDependComfortInspireRespectSupportDedicateMotivateCelebrateCooperateAppreciateCompensateParticipate

Wines and Traditional Beverages of the World 2024-10-03

15 Items: Sparkling wine from France.Fortified wine from Portugal.Traditional Japanese rice wine.Mexican spirit made from agave.Aromatic wine used in cocktails.Peruvian or Chilean grape brandy.Clear distilled liquor from Russia.Strong Chinese spirit made from grain.Spanish punch made with wine and fruit.Traditional Andean fermented corn drink....

The Everything Word Search 2026-02-03

15 Items: Hi in SpanishThe forth seasonThe man that's superAn animal that barksAn animal that meowsThe major soccer gameThe popular video gameOur school mascot's nameA holiday when you dress upThe major american football gameThe largest planet in our solar systemThe person who runs the newspaper clubOne of the best soccer players (It starts with M)...

World Cuisines 2024-09-16

15 Items: Spicy soup from MexicoSpicy Thai noodle dishJapanese dish with raw fishFrench soup made with onionsArab dish made with chickpeasJapanese rice dish with chickenTraditional cookie from the U.S.Indian food with rice and spicesTraditional flatbread from IndiaGreek dish with eggplant and meatChinese dish made with fried rice...

Days of the week Word Search (Spanish) 2024-05-20

7 Items: lunesmartesjuevessábadoviernesdomingomiércoles

Months of the Year, Seasons, Sun, Moon, Stars, (Find in Spanish) #3 2025-09-27

25 Items: MaySunDayJuneJulyWeekFallMoonStarMarchAprilMonthNightAugustSeasonSpringSummerWinterPlanetJanuaryOctoberFebruaryNovemberDecemberSeptember

Word search 1. Find the words and search their meaning in Spanish 2023-04-28

24 Items: sunskybedlegfearjailnightrealmflooryoungscreenpotatocoffeeseldompictureprofilepyramidcomputeralphabettelephonesnowflakesometimeschocolatecigarretes

Spanish Speaking Countries (Find all 42 for extra marks in your exam!!) 2026-05-28

42 Items: CubaLimaPeruSpainLaPazChileQuitoMexicoMadridPanamaHavanaBogotaMalaboSanJoseManaguaSanJuanBoliviaEcuadorUruguayCaracasHondurasSantiagoColombiaAsuncionParaguayCostaRicaGuatemalaNicaraguaArgentinaVenezuelaMexicoCityElSalvadorPanamaCityPuertoRicoMontevideoSanSalvadorTegucigalpaBuenosAiresSantoDomingoGuatemalaCityEquatorialGuineaDominicanRepublic

The word guesser 110 2024-11-20

110 Items: catsadmadmapcapzaphatfargumartbeebinlionfirezerohoopboathardeasytallstargoodevilgluebearhairfairzebrahippochessangryjapansushiwaterhappystylekarmasigmachinahelthvideogamesitalypizzachilitrainsantaflutemangomusicmoneytigerclocklunchchalkboardspicytablegrassbooksgooglefamilyschooljelousdoctorpencilcrayonhotdogpeppereasterpoodleviolinbrainsmovies...

Ava Klett e-i o-ue Spanish 1 pd 1 wordsearch 2025-04-02

16 Items: Tu form poderYo form dormirYo form servirYo form costarEl form dormirEl form probarTu form repetirEllos form pedirTu form almorzarEllos form servirEllos form costarNosotros form pedirEllos form competirEllos form recordarNosotros form costarNosotros form probar

Word Search 2023-03-06

20 Items: Not a dogNot a catcolor of rosesspanish teacherColor and fruitWhere birds livecolor of patrickThe color of grassThe color of the sunWhere kids go to learnWhat you cut paper withAnimal born with a shellDevice we all use everydayBig cat king of the jungleAnother girl color not pinkdevice given to us by schoolBird with long legs that is pink...

French Vocab 2024-12-02

46 Items: ArtLawGymEasyHardClassGradeSchoolFrenchI loveI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessHomeworkEducationChemistryEconomicsGeographyCafeteriaPhilosophyPsychologyphysique PEScholarshipArchitectureFashion designSocial studiesHigher educationComputer science(les maths) Mathpas I don’t likePolitical science...

acaia 2024-02-10

70 Items: arumdockaspenbasilCreteacaciaboragebryonycactusdahliadodderfennelbramblebuglossburdockacanthusamaranthangelicabarberrydaffodilfoxglovebroomrapebuck-beanclianthuscolumbinecoltsfootcorianderdandeliondate-plumfieldrushgoats-ruegoosefootanthericumbellflowerblackthornbluebottlecinquefoilclove-pinkdaisy-wildaster-chinaeverlastingamerican-ashdaisy-double...

Nombres 2025-04-08

14 Items: Always on his ChromebookVery quiet sometimes lateWears glasses and is quietThe Library Spanish TeacherI love make up and StarbucksAlways sad when BFF is absentI travel during Fin de SemanaKnows everything about dirt bikesHe is just there...not doing muchGodzilla,Aliens,Video Games,GremlinsAlways has her hair up and is athletic...

Ecuador 2026-04-13

14 Items: Slang for babySlang for brokeA tuna and onion soupThe capital of EcuadorMain language of EcuadorNational music of EcuadorBiggest company in EcuadorEcuador is considered a ____ society.The most widely spoken indigenous languageTelevision outlet mainly watched in EcuadorEcuadors economy is mainly dependent on __ exports...

Latin America Word Search 2023-11-06

20 Items: RiverSpread of cultureMost popular sportLongest Mountain RangeMost practiced religionLanguage found in BrazilDriest desert in the worldBiggest environmental issueChange environment to fit needsLanguage found in most countriesBiggest Caribbean country/islandBiggest country in CENTRAL AmericaChange yourself to fit environment...

Review 13, El doctor y las enfermedades, parte 1 (Spanish I) 2022-04-13

15 Items: tosojosbocacamasaludgripedolorabrirdosisfiebrecabezamedicarecetavendertriste

Review 14, El doctor y las enfermedades, parte 2 (Spanish I) 2022-04-14

15 Items: peronadadebilgravesacarahoracreerfuertesangreayudarvenderrepisacorazonquimicopresion

POSTIES 0722 BIG READ 2024-06-18

6 Items: a person who studies languagesa system of sounds and words to communicatea wild animal similar to a dog, that lives in North AmericaFrench, Spanish, Italian and Portuguese all come from _____.Some people in Papua New Guinea speak a language called _____.In the story 'Tower of _____', humans originally spoke a one language.

Review 13, El doctor y las enfermedades, parte 1 (Spanish I) 2022-04-13

15 Items: tosojosbocacamasaludgripedolorabrirdosisfiebrecabezamedicarecetavendertriste

Review 13, El doctor y las enfermedades, parte 1 (Spanish I) 2022-04-13

15 Items: tosojosbocacamasaludgripedolorabrirdosisfiebrecabezamedicarecetavendertriste

Do it Now (DIN) Find the numbers in Spanish 2024-12-20

10 Items: ElevenTwelveTwentyFifteenSixteenThirteenFourteenEighteenNineteenSeventeen

Review 14, El doctor y las enfermedades, parte 2 (Spanish I) 2022-04-14

15 Items: peronadadebilgravesacarahoracreerfuertesangreayudarvenderrepisacorazonquimicopresion

Chapter 18 Vocab Word Search 2026-03-11

19 Items: A person living outside their native country.Spanish-speaking cattle herders; early cowboys.The forced removal of people from a country or region.A situation where neither side can make progress or win.A Spanish term for peasants or small-scale rural farmers.A movement rejecting the norms and values of mainstream society....

Review 14, El doctor y las enfermedades, parte 2 (Spanish I) 2022-04-14

15 Items: peronadadebilgravesacarahoracreerfuertesangreayudarvenderrepisacorazonquimicopresion

Pyramids Word Search 2026-04-14

13 Items: Traveling regularlyThese traders acted as spiesMassive, terraced, stone templesThe original natives of a regionThe capital city of the Aztec EmpireA natural lake in the valley of mexicoSpanish explorers led by Hernan Cortes​The watering of land by artificial meansCreated by the Aztec Empire and creates music...

Español 2A 2024-02-01

50 Items: IheforsheeasyWho?lunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthi needboringI havespanishenglishseventhamusingto teachto studyto speakyou needfavoritelets seeyou haveart classdifficultmore…thantechnology(feminine)mathematicsyou(formal)the class ofthe schedulethe homeworkyou (formal)science classin the…..houryou(familiar)...

Spanish 4 Sopa de Letras para Avancemos 3 Unidad 7-1 Joseph Lozada 2025-05-29

20 Items: corodejarsueldonineroempleoanuariodirigirdecidirreunionrecuerdoempleadocomienzoredactargraduarseestresadoanticiparceremoniaimpuestosgraduacionreflexionar

Random word search for Mr. Scully 2026-01-27

123 Items: anbycatanticesunbadlionsockdarkrockmilemealdutytestrentloseruinheadAIDSwearparkhangbombrareballdrawrockrearzebrahippoplantkittyfalsechainpettysmellradiolayerheartweighenemyscalemuggyswellshoutcoachpanictrailschoollitterdegustmosquechargerevealgarliccandlelistenmethodsmoothwonderrevivetrenchrejecthunterunlikemakeupsciencespanishgirafeeglaciermusical...

Meses y dias de la semana. by Mrs. Arroyo Spanish 3rd &5th grade 2017-11-28

19 Items: mayoEneromarzoabriljuniojuliolunesagostomartesjuevessabadofebrerooctubreviernesdomingonoviembrediciembremiercolesseptiembre

Landon's words 2023-03-08

20 Items: Man's best friendthe color of papervery popular phonea really fat animala type a shoe/sandalthe color of the skythe color of the sunvery popular shoe brandyou wear it on your feetThey love to chase mousesthe greatest soccer playera animal that you can rideonbe of the biggest animalsa animal with tripes on themthe thing on top of your head...

Premonition Word Search 2024-04-26

12 Items: Frame of latA kind of fauscetTo create art in the bodymy granddaughter in spanishA heads up warning in advanceOutward behavior that isn't the bestA short jacket with no sleeves for girlsAnger by small things that by something unjustA large or a unknown size that isnt very reccongizableA sweet syrupy texture type of alcohol used as a solvent...

3 Worlds Meet 2025-09-08

10 Items: a large farm zonea series of religious warsa monotheistic religion of the muslimsWhen you travel from one place to anothera mixed woodland grassland biome and ecosystemthe line of descendants of a particular ancestora period marked in time of Classical learning and wisdoman ethnolinguistic group of indigenous people of mesoamerica...

los numeros from 1 to in Spanish 2025-10-02

6 Items: catlionzebrahippoelephantMan's best friend

BB Cap 9 - find the SPANISH translation for each Vocab Phrase 2026-05-29

13 Items: they madearrest ushe's onlytraumatizedhe was alonepolice stationit was not goodyou abandoned mes/he exterminateddoes not toleratedon't talk anymorepolice investigationit was all ____'s idea

Spanish Vocabulary Word Search 2024-03-05

4 Items: vasparquesolo(a)hospital