safety Word Searches

What is Spirit bringing you this month? @TheDivineEsoterics 2024-01-11

63 Items: joypeacetrustfaithhonorgracesafetywisdomhealingcouragesilenceanswersrespectcomfortfreedomnewideasselflovelaughteropendoorsgratitudetheglowuplisteningabundanceknowledgecreativityprotectionbeingheardboundariescompassionforgivenessdiscernmentwisecounseldevelopmentrestorationmindfulnessrecognitioninspirationbeingpresentconfirmationachievements...

TSA BYCTW 2023-04-18

35 Items: leadDOWNrailxrayalarmCHECKcargoqueuecaninesafetyfirearmmanagerSUPPORTofficertrainingDETECTIONinspectorscreeningcomplianceregulatoryspecialistsupervisorRECOGNITIONinspectionsENFORCEMENTTRACE DETECTORMETAL DETECTORLIQUIDS SCANNEREXPLOSIVE DEVICEDOCUMENT CHECKERSECURITY DIRECTORIMAGING TECHNOLOGYOF HOMELAND SECURITYOPERATING PROCEDURES...

Values 2024-11-12

56 Items: FunLoveHumorOrderPowerTrustBeautyCaringSafetyCourageFitnessFreedomHonestyJusticeRespectRomanceEqualityFairnessHumilityIndustryIntimacyKindnessPatiencePleasureAdventureChallengeCuriosityGratitudeSelf-careAcceptanceCompassionConnectionConformityCreativityExcitementGenerosityCooperationFlexibilityForgivenessMindfulnessPersistenceReciprocity...

8th Grade Technology Word Search 2014-06-17

64 Items: airCADoilmodelandstudroofarchbeamwoodmasstoolswaterspacejoistshearsafetydesignforcesgirderheaderraftercustompathwayprocessbridgestensiontorsionbendingprimaryplasticcuttingformingshapingthermalmachinesquizstarresearchredesignconcretechemicalmaterialsconstructmaterialssecondarycombiningfinishingmarketingfoundationsuspensionassemblingmechanical...

Imaging Week 2022 2022-11-05

64 Items: crlhrobillcarecoilepicyostcuriedailynurseshiftallinalarsonmatsonmaurersafetycardiaceducateimagingmedicalnuclearadvocacycomputerdoyscheremployeemedicinepatienceroentgenstenosisyourselfaffiliateawarenesscelebratecommunitycyclotronequipmentgeneratorlisteningphysicianradiologystandardsvolunteerassistancecommitmentexperiencehydrophonemanagement...

ATS Word Search 2017-10-17

64 Items: IceFogATSAlfaEchoGolfKiloLimaMikePapaXRayZuluRainSnowHailMistHazeBaseBravoDeltaHotelIndiaOscarRomeoTangoWindySunnyApronFinalJulietQuebecSierraVictorYankeeCloudsRunwayUpwindSafetyPilotsCharlieFoxtrotUniformWhiskeyCumulusDrizzleBlowingTaxiwayCalloutWeatherAirportTakeoffLandingMedevacNovemberFreezingWindsockDownwindAircraftObserverThresholdCrosswind...

Clearfield Fiber Puzzle 2024-01-14

65 Items: wdmledfdhfoaftthcoreotdroltsmodefxdsglasslightyourxlaserplantfibervaultsafetymicronribbontensileendfacedustcapinfraredtrainingspectrumsplittercladdingpedestalkilometermacrobendbandwidthmultimodecertifiedwavesmartmegahertzconnectormicrobendclearviewnanometergigahertzseechangeclearpassmodefieldreflectionwavelengthsinglemodetechnicianbendradius...

shelley 2024-01-08

65 Items: ppepjhateamweldblacksalesunioncoffeecranesdonutsemailslaptoponsitepipingsafetytendertravelcultureforemanfriendsjobcostlockoutmanitoupayrollrewardsrobertsservicetoolboxturnkeycontrolsforkliftmanpowermcdonaldotonabeeplumbingshutdownsitedocstrainingcellphonedatacablededicatedstockroomutilitiesmillwrightaccountingapprenticeautomationautomotive...

2018 SPAR GOALS - WHERE ARE YOU? 2018-02-28

66 Items: TXMESSAPCARLGARYJASEJEFFMODSPHAMRYANSHIPCHRISJAMALLAMONSHAWNSPARSSTEVETERRYDAKOTAKAIZENPEOPLEPICKUPROBERTSAFETYTORQUEHECTORPHECTORSJESSICANCDRILLPROCESSQUALITYSEALANTTOOLINGMATERIALPLANNINGTRAININGEQUIPMENTHANDTOOLSINVENTORYBOMBARDIERMANAGEMENTONSCHEDULESCHEDULINGCALIBRATIONENGINEERINGENVIRONMENTMAINTENANCEMEASUREMENTPROGRAMMINGSUPPLYCHAIN...

Imaging Week 2022 2022-11-05

64 Items: crlhrobillcarecoilepicyostcuriedailynurseshiftallinalarsonmatsonmaurersafetycardiaceducateimagingmedicalnuclearadvocacycomputerdoyscheremployeemedicinepatienceroentgenstenosisyourselfaffiliateawarenesscelebratecommunitycyclotronequipmentgeneratorlisteningphysicianradiologystandardsvolunteerassistancecommitmentexperiencehydrophonemanagement...

Unionized Nursing Word Search 2024-12-01

10 Items: UnionNursePolicyBenefitsLeadershipNegotiationUltimate goal of unionization is to protect the _____.Avoiding injury requires staff & leadership to focus on _____.Union nurses enhance quality care by acting as a patient's _____.Negotiations between union and leadership result in _____ agreements.

SUPER BOWL 50 2016-02-04

69 Items: MVPNFLFANSFLAGPUNTSACKCOACHOMAHASPIKEDENVERFUMBLEHELMETHUDDLEJERSEYREPLAYSAFETYTACKLEBEYONCEBRONCOSDEFENSEENDZONEKICKOFFLINEMANOFFENSEREDZONEREFEREETIMEOUTCAROLINACOLDPLAYFACEMASKFOOTBALLHAILMARYHALFTIMELADYGAGALOMBARDIOFFSIDESPANTHERSPUMPFAKETIGHTENDTURNOVERCAMNEWTONCHALLENGEFIELDGOALFIRSTDOWNRECEPTIONSIDELINESSUPERBOWLTOUCHBACKTOUCHDOWNCOMPLETION...

Lab Week 2024 2024-04-15

69 Items: cbctshtedcdcpassracefungisafetyfuuuckchuckyictericlipemicclottedantigenserologytesttubeanalyzeranaerobebacteriaantibodyrainbowslostboysevildeadchemistrybloodbankbutterflyhemolysisbringitonnosferatuantiibodylaboratoryphlebotomyhematologycellwasherhematocriturinalysiscentrifugecollectioncoagulationoutpatientstrichomonaswhereswaldogreatgatsby...

CROSS OUT SAFETY FEATURES 2025-01-07

4 Items: BrakesAirbagsStart AssistStop Signal System

Alum Creek Wildlife and Water Safety Word Search 2024-09-29

10 Items: Always swim with a _ _ _ _ _.A flow of water in one direction. _ _ _ _ _ _ __ _ _ _ _ _ _ _ are the most common sunfish in Ohio_ _ _ _ _ _ _ _ _ _ are Ohio's most terrestrial turtle.Large body of water surrounded on all sides by land. _ _ _ _Despite calm waters, you should always wear a _ _ _ _ _ _ _ _ _ _...

Acceptance Word Search 2024-01-14

70 Items: joyzenhopelovezestpeacetrustunitygrowthsafetywisdomwonderthrivesolacebraveryclaritycourageempathyfreedomharmonyhealingrebirthsupporttherapysankofacalmnesskindnessoptimismpatienceserenitystrengthsurvivorvaliancevitalitywellnessmetanoiakintsugianamcarabelongingendurancegratitudeintuitionquerenciaacceptancecompassionconfidencecreativityfriendship...

Fisika Word Search 2024-10-14

70 Items: satujayahelmtugasnalarsolideksaklelahngopirisetteorijuarajoulefisikalapraksantaigamtekpabriksafetykritiskonsepsolverrevisienergiproyekstresscodinglembursenyumsolusinewtonredflaginovasilaporanngitungngulangarsitekbagunanrobotikbegadangkalkulusinsinyurhitungananalisiskomponendeadlineotomotifsimulasiresistorlapangandinamikaproduksimaterialoptimasi...

Sir Word Search 2023-03-23

70 Items: sirfrymoplidfiletopruleexamheatfillitemwickrolefloorthickenterstovecausewhosespacebrandwhileerrorcrashflightsolveduetosafetyputoutrepeatshowertidyupmediumdecidestringracketlaptopmiddletrafficwidelyfabricsmoothdimplebalconymistakebuildupreplacequalityproductrunintoglassesstrengthbuildingdealwithbreakoutstrangerexercisestandoutdownloadunstableappliance...

Nurse Burnout 2023-11-30

4 Items: Treating nurse burnout necessitates what kind of approach?Nurse burnout resulted in what type of safety and quality of care for patients?This collaboration and teamwork is essential in fostering a supportive work environment.Blank and safety initiatives should be implemented to reduce the risk of errors and enhance patient outcomes?

LAB WEEK 2023 2023-04-05

75 Items: dnarnalimsgeneexonqubittraitcodonlocusuracilsafetyglovesalleleintrongenomesomaticadenineguaninethymineprimersqualitymitosismeiosisdiploidhaploidprobandgermlineresearchclinicalilluminacytosinenanoporegeneticsgenotypedominanthereditymutationdeletiontelomerepedigreevariantyxscientistphenotyperecessiveautosomalchimerismhaplotypeinsertioninversion...

Science review 2014-01-13

78 Items: SungasnewdatadarkstarbabydustmarsnasamoonfulltideneapapronEarthrockyvenusplutocometspacemethodglovessafetyhazardplanetnebulaspiralbarredheliumoxygencarbonSaturnUranusKuipermeteortheoryphaseswaxingwaningspringgogglesmercuryJupiterNeptunestationbigbangquartergibbouslowtidechemicalconstantuniversemilkywayemissionhydrogennitrogenasteroidcrescent...

Nursing Shortage 2023-12-01

17 Items: nursesafetyhealthsupplydemandshortageworkloadbedisidestaffingretentionenhancingsatisfactioncommunicationwhat is one way we can help support nurses in regards to staffing ratios?what is one reason new graduate nurses are leaving the workforce so quickly?what is one of the technology advancements that is helping to decrease nursing shortage?...

Cat Word Search 2023-12-01

17 Items: nursesafetyhealthsupplydemandbedsideshortageworkloadstaffingretentionenhancingsatisfactioncommunicationwhat is one way we can help support nurses in regards to staffing ratios?what is one reason new graduate nurses are leaving the workforce so quickly?what is one of the technology advancements that is helping to decrease nursing shortage?...

deannas sheeet 2023-07-16

79 Items: nodogquecarhelpfirebusyboysmaambeertimecalldeafworktakefakephoneperroprintdeltacrazyboredmoneyjamesalarmidiotkarenenterabuseradiopolicemurderamandabestiedeannamarinasafetyheatercheeseblowupreallycallertickettrainergarbagetrafficrichardoctoberjanuaryreadingcalloutmanagersargentcaptianofficergunshotredbirdtroubledispatchshoelaceidentifynegative...

Exploring the Consequences of Nursing Burnout on Nurse Well-Being and Patient Care 2023-12-02

8 Items: What can raise awareness about the signs of burnout, encouraging early intervention and support?Which kind of empowerment for nurses increases the ability of nurses to confidently mitigate the consequences of burnout?_________ effort is required to encourage a more positive workplace environment and decrease the impacts of nursing burnout....

Opioid Abuse Reduction Strategy Word Search 2023-11-29

5 Items: Hospital opioid abuse risks?Nurse roles in opioid abuse?Nurse roles in opioid abuse cont.?What is imperative to address in opioid addiction?Tech for opioid use disorder identification and prevention?

June Safety Word Search 2021-06-07

3 Items: helmetbugspraysunscreen

HSDU 2022-09-22

20 Items: Cover upOur bossThe middleThere are sixClean machineMind your eyesOur departmentFollow carefullyFollow safety rulesThe icing on the cakeWhat keeps us in checkCheck every single onePlace this at the bottomOur most important assetOur most important fluidNeeds to be done preciselyRoll out of the departmentThere are also six of these...

MKT 442 Hard Quiz 2015-09-24

86 Items: idegomoodselftimenormtraitidealroutemedianeedsvaluemodelnoisepowersafetyaffecttheorysourcefamilyvanitychangeschoolagencyschemasocialesteemequityobjectpersonverbalbeliefscultureeffectsanxietymessageecologybargaincentralshapingbalancesecurityemotionssuperegoextendedopinionsobservervisceraloutcomesresearchpossibleresponsesinfluencecomplaintinterests...

Sabah Oxygen - P1TA18 2024-07-08

102 Items: tophoseventtesttripzeroworkareadownlevelicingtopupnightshiftinertentryvalveplantspacesmokephonespeedlimitalarmcraneshoesupdateonlinebypassliquidbottomweightdialogvacuumoxygenhealthsafetyleaderpermitenergyheightsourcemobileglovesofflineisotankstandbymorningpurgingreactorstartupprocessdrivingvehicleprojecttoolboxliftingcoolingglassesleathernitrogen...

semester review 2024-12-12

25 Items: direct currentshield metal arcalternate currentAmerican welding societypin holes or round voidsresult of trapped oxygendevice used to hold materialsprotective covering for handsstate of being free of dangerdirect current electrode negativedirect current electrode positiveAmerican society of mechanical engineers...

Lab Week 2024 Word Search 2024-04-06

100 Items: cvsdnapcrpocrnakenlimspooltestdollpinkbeadsbloodbravoflaskgeneshelixqubittecanbeachdresspartystyleworldbeakerdenovodoctorglovessafetysalivasamplewetlabbarbieblondecareermalibumattelallelesbiologyculturelabcoatmeiosispatientpipetteproteinqualitysciencesomatictrisomyfashionadaptorsclinicaldenaturedirectordominantgeneticsgenotypegenotypeheredity...

ANTONYMS 2014-12-14

103 Items: buywetlowfarnewrawnonedullidlecoldwesteasydeadcomegoodsoftthinfindshowmissrudesoftrichfalltamechildawakebeginworsecursewhitedirtynightearlyemptyenemyhappyfreshfirstnevergiantfrontdepththerewaterleastoutersobernoisyroughurbanfalselearnsmileabsentrejectactivedepartattackbeforerevealsafetylatterfuturehealthvalleyexhalesorrowseniordivideliquorborrow...

Amateur Radio Emergency 2024-11-19

25 Items: Resource managementSevere weather eventMessage routing systemPersonal status updateHealth status reportingCritical system supportPower supply reliabilityAlternative signal bandsTemporary safety locationInfrastructure assessmentCommunication alternativeNatural disaster scenarioCommunication coordinationEmergency event management...

Office Word Search 2023-10-17

36 Items: desmondO_S _ _ _ _ _ _ORV example _ _ _80+ _ _ _ _ _ _ _H_A _ _ _ _ _ _ _R_PDO _ _ _ _ _ _New driver _ _ _ _ _ _Not sober _ _ _ _ _ _ _ _MM _ _ _ _ _ _ _ _ _ _ _ _ _Annual report by REO _ _ _ _ _VRU example _ _ _ _ _ _ _ _ _ _What we call a road _ _ _ _ _ _ _Form of stunt driving _ _ _ _ _ ________, move over _ _ _ _ _ _ _ _...

Agent Word Search 2023-06-17

99 Items: bfsofasmfarmdbaggechogolfgateinopkilolimalatemikepaparampumnrxrayzuluagentalphaauditacarsbravoclaimdeltagonowguesthowdyhenryindiakianileslyoscarpilotromeotangovadimwendybimalacanadadeniedflightjulietkeahjamonikanicholpickupquebecrunwayrefundsierrasafetyspirittarmacunitedvictoryankeeairportayashnaadrianabaggagecharliecaptaindelayeddropofffoxtrot...

MET 13th Anniversary Word Search 2023-03-29

99 Items: metmeapsrdemfunpopbayrigepopmepabathspogteamfallpaintdécorpricehomermediapatiostoreaislepridelumbersafetysurveywinterspringsummertabletpeoplelabelscompasskitchenworkdayleadersprodeskmetappshdphonevendorsshowroomseasonalflooringhardwareplumbinglightingmillworkoffshelfprojectsteamworkassemblydisplayspackdownlearningplanningcoachingsidecapscomputer...

Functions of COPRA 2024-10-13

5 Items: Educating people about their consumer rightsStopping businesses from misleading consumerswhere you can file complaints about faulty productsEnsuring safety and fairness for consumers in the marketProcess of getting help when a product is faulty or damaged

find and learn these water safety words in the grid 2017-06-09

8 Items: swimguideshallowgogglesfirstaidlifeguardsafetyringlifejacket

NervousPathology-Pugh 2022-08-15

15 Items: parkinsons is onebundles of neuronspathway to the CNSpathway from the CNSan involuntary responsefound at nerve synapsessomething affected by ADHDan actual use of medical detoxF of stroke symptom screening FASTA of stroke symptom screening FASTS of stroke symptom screening FASTT of stroke symptom screening FAST...

gold 2023-08-21

10 Items: the startto be meanto make smallera form of energythe condition of being protectedthe state of something that existsto stay true to something or someonenotice or attention given to someone or something by the media.a high-level educational institution in which students study for degrees...

Kiani Word Search 2023-06-13

105 Items: ofasmftsabsocrooccbfsgatebaggbagcarmfarmdumnrcrewgsarrampfueliropbaseseatlatekianivadimwendyleslyhowdydeltapilotgonowauditacarsguestscaleheavybimalakeahjanicholmonikaspiritrunwayunitedtarmacofficerebookrefundsafetyairbusalaskapickupayashnawilliamsharnetadrianabaggagedelayedairportcaptainjetbluearrivalweatherrevenuelevartistationcheckintaxiway...

FNS Week Challenge 2023 (if two words no spaces) 2023-09-13

105 Items: teamnailshippaknifealarmrenalpureezebraaidetescortrotaterescuementorpantrysafetyhccapsvaluesvisionturkeyslicervisitorconfineanxietyproteinhydratepuddingshuttleparkingdignityqualityrespectmissiondeliverhostesscoworkerdiabeticcomputerdialysishospitalsecuritybeveragekindnessthankyoudurationsanitizeconcernstardinessemergencydresscodepotassiumguacamole...

Lab Week 2024 2024-03-14

99 Items: tersvflucapcbccmpbmpsdsecwfaxdrawstatcliatesttubesquestnordxstateswabscobascovidfodenmasksbadgeloginemailstainordersneedleslidessmearsplatessysmexdoctorglovesadd-onlabelsimmunesurveysafetychartsscrubslabcorporchardpantherfreezerultiprogoggleslabtechrotatorreportsbindersmanualssterilestoragesend-outschedulediasorincurrierslab-weeklab-coatyarmouth...

OISD Noida Swacchta Word Search puzzle 2024-06-21

23 Items: Cleansing agentWaste materialsUnwanted materialHygienic and cleanSanitation facilityContainer for wasteState of well-beingWaste disposal pipeReuse waste materialsAction to tidy an areaCleaning cloth or toolUnderstanding of issuesFree from harm or dangerPractices for cleanlinessCleaning machine or personConditions for public health...

Title, Word Search 2024-10-26

2 Items: beef, wallaby, turtle, fish, lamb, chicken, culture, tradition, cattle farms, fauna, native, exotic.aim, goal, purpose, ingredients, steps, tools, measuring, making, cooking, tablespoon, mixing, food safety, wash hands, rules, equipment, instructions, games, sequence, safety,Top Tips, convention, conduction, radiation, heat.

Names from the Class 2024-05-21

12 Items: Snowy's humanStockroom heroMakes RCO₂H from ROHMore substituted alkeneViktor's C-C bond forming name reactionThe other voice in the IR video tutorialAte the edible chemical in a safety demoSilent scientist in the always in the labOne of the voices in the IR video tutorialDraw this projection to visualize E2 anti-beta H...

Blending Word Search 2023-11-03

14 Items: 120mg to 120g5 4 3 2 1 0 00 000Master Formulation RecordMixing two substances togetherNon-Sterile Compounding regulationsReducing particle size in an ointmentUsing a spatula to blend two substancesReducing particle size through various methodsBlending two substances together using a sieveMeasure the bottom of this when using a cylinder...

Alarm Fatigue 2024-12-01

4 Items: What is the term for the phenomenon where healthcare workers become desensitized to alarm sounds, leading to delayed responses?What is the term for the process of adjusting alarm thresholds to meet individual patient needs and reduce unnecessary alarms in a healthcare setting?...

Lord of the Flies 2023-09-27

20 Items: Wild, uncontrolled.Large sea snail shell.Older boys on the island.Boys tasked with hunting.Someone who saves others.Younger boys on the island.Person rejected by society.Place of shelter or safety.Brutal, uncivilized behavior.Group gathering for a purpose.The pig's head; symbol of evil.Dance Ritual dance by the boys.Advanced state of human society....

EVS Week Challenge word search 2023-07-05

118 Items: mopdooroshaupmcaidetalarmbroomcleandirtyhippalinenmenuspagersinkssweeptrashwatercaringclergygloveshuddlekronosmirrorpaydaypuddlerescuesafetytowelsvacuumvaluesvisionwindowblanketconfinecontactdignitydropletdustpanfittestinfonetmanagermissionmyvoicenursingrespectairbornebeeawardbenefitscallbelldisasterdurationelevatorevacuatehighdustmanageuppharmacy...

Games and Gadgets 2024-01-14

35 Items: pushpowergo intofail to winkeep away froma mobile phonebring to safetyovercome or beata small computergather or pick upbe in contact withto finish somethingto gather or collecta metal piece of moneya frightening creaturea stage in a video gamebring to an end, completeclose a computer or phonea smaller laptop, an iPadpull or move across a screen...

Vernonia School District vs. Acton (1995) Name _____________________ 2023-11-04

10 Items: What role was this student?What was this person tested for?How did the school test this student?What law was in question in this case?What state was this situation happening?What level of education was this student?Who is the student-athlete that was tested?Can a public school drug test student-athletes?...

Fundamental Skills and Safety 2024-10-31

2 Items: Gas Biohazard Acute Chronic Safety Label Controlled Products Supplier Label Workplace LabelExperiment Observation Analysis Conclusion Variable Data Control Prediction Results Question Research Symbols Warning Health Hazard

Sixth Year -Week 3 2024-11-05

15 Items: Filth; miseryTo live in or onAn area of land; a regionNot the same; unmistakableA place of safety or shelterHard or impossible to believeA great amount; more than enoughOf or relating to the countrysideVery dry; having little to no rainfallMagnificence; brilliance of appearanceHaving a large amount of moisture in the air...

Epidemiology- Topic 2 2023-01-21

9 Items: E_______ ASSESSMENTE__________ STUDIESDATA A______ TECHNIQUESSOURCE OF DATA: Q__________WHAT DO PUBLIC HEALTH LABORATORIES DO? F____ SAFETY.WHAT DO PUBLIC HEALTH LABORATORIES DO? P______ DEVELOPMENT.S________ SOFTWARE IS USED FOR DATA MANAGEMENT AND ANALYSISWHAT DO PUBLIC HEALTH LABORATORIES DO? T_______ AND EDUCATION....

Good Laboratory Practices 2024-05-14

17 Items: The G in GLPThe L in GLPThe P in GLPThe L in ALCOAThe C in ALCOAThe O in ALCOAYear GLPs writtenYear GLPs approvedThe first A in ALCOAThe second A in ALCOAYear GLPs written into LawDescribes how a task is done on a studyCurrent Summary of training and experienceDirector Single point of contact for a study...

Tanner's Amazing Robbery Word Search! 2024-09-09

12 Items: Location for our safety zone?How many role cards are there?Dont _____ with the panic alarms!#1 thing you should do during a robbery?Who should you notify after the robbery?How much does the Hold-up Function dispense?________ members when they walk in. ALWAYS!!What do we use to block off the robbed area?...

The Effects of Unionized Nursing on Patient Outcomes 2024-12-02

10 Items: SafetyBenefitsAdvocacyRetentionWhich act defines scope of practice and governs nursing unionization?Unionization provides reduced burnout and improved job satisfaction for this population.Unionization provides safer environments and consistent care standards for this population....

Quiz MPMAX Edisi Maret 2023 2023-03-28

15 Items: Active Ownership merupakanLingkungan kerja yang negativeSingkatan dari Operating CompaniesIstilah penjualan pakaian bekas importDimanakah pelaksanaan Honda DBL 2022-2023?Lokasi Depo Pertamina yang terbakar berlokasi diPembelian Honda pada kegiatan Honda Virtual ExpoBudaya membagikan bingkisan makanan kepada anggota...

Leadership Values 2022-11-22

117 Items: funjoybackhomehopelovetimefaithgracehumororderpeacepowerpridetrusttruthbeautycareercaringethicsfamilygrowthhealthlegacynaturesafetythrifttravelvisionwealthwisdombalancecouragedignityfreedomharmonyhonestyjusticeleisureloyaltyrespect-takingservicesuccessaltruismambitionthe bestequalityfairnesshumilitysecuritykindnesslearningopennessoptimismpatience...

Merit Badges 2024-09-02

134 Items: ArtLawGolfPetsChessMusicRadioStudyHikingEnergyNatureRowingSafetySportsCookingCampingCyclingArcheryBuglingDogCareFishingGeologyPotteryReadingSkatingTextileTheaterWeatherWeldingFirstAidSwimmingAviationBasketryCanoeingClimbingDraftingForestryKayakingMedicinePaintingPlumbingRoboticsWoodworkAstronomyAthleticsBirdStudyChemistryDentistryGardeningGenealogy...

Ham Radio Parts 2024-11-19

25 Items: Suppresses radio noiseTwo-sided antenna designJoining metal componentsMeasurement of frequencyRange of radio frequenciesSpecialized transmission tubeBoosts weak electrical signalsMeasures electrical power outputMeasure of electrical resistanceDevice that picks up radio signalsCable type for signal transmissionAlters radio signal characteristics...

Drop-off box for Summer of Safety 2023 - Word Search Completed 2023-06-01

6 Items: catlionzebrahippoelephantMan's best friend

On Screen 3 unit 2 b pp 30, 31, wb pp 14, 15, Vocabulary bank 2 2022-12-08

47 Items: põudpurseorkaanlaviinvapruspäästmapaduvihmpõgenemapurskumakurnatudvarustusmaavärinhiidlaineüleujutusplahvatustuul ulublaevahukknäljahädaränk kahjutugev vihmplahvatamavarjualunetulekindelkohalik aegvabatahtliktuli lõõmabkibedalt külmmetsatulekahjukokku varisemakergendustunneabi (not help)pardale minematihe, tihke udeloodusõnnetusedhäving, hävitamine...

Fireflies Word Search 2024-09-02

10 Items: Signs are often made from this elementA type of fungus that glows in the darkGlow-in-the-dark material used in watchesInsects known for their natural light showOcean creatures often found in the deep seaA natural light source found in some mushroomsA popular night-time attraction at amusement parks...

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

First 35 Names of Allah 2023-09-15

35 Items: The KingThe CreatorThe EvolverThe ReducerThe ExalterThe MercifulThe MajesticThe ProviderThe ExtenderThe HonourerThe CompellerThe FashionerThe All-AwareThe BeneficentThe All MightyThe WithholderThe All-SeeingThe Subtle OneThe Most SacredThe All-KnowingThe DishonourerThe All-HearingThe MagnificentThe Utterly JustThe Supreme SolverThe Great Forgiver...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

PLASMA CENTER 2024-03-14

150 Items: spedpmfuntikigregrudebowlcartsopsbayscoldpumpkioskbriankenyadeelapaigekellymykialatexbloodwaterpulsegauzecleanvomitbadgeadminboothgroupsalinebottledonorsscalesteresaselmonjoshuanellieevettesummerjordanparkeriodinebreaksattireglovessafetyfamilymatrixcottonjacketbpcuffpalletlancettubingsmellypointspeopletrinitymelissabriannahelpfulconsentcitrate...

PLASMA 2024-03-13

150 Items: spedpmfuntikigregrudebowlcartsopsbayscoldpumpkioskbriankenyadeelapaigemykialatexbloodwaterpulsegauzecleanvomitbadgeadminboothgroupsalinebottledonorsscalesteresaselmonjoshuanellieevettesummerjordanparkerkelleyiodinebreaksattireglovessafetyfamilymatrixcottonjacketbpcuffpalletlancettubingsmellypointspeopletrinitymelissabriannahelpfulconsentcitrate...

LFB PLASMA ANNISTON 2024-03-13

150 Items: spedpmfuntikigregrudebowlcartsopsbayscoldpumpkioskbriankenyadeelapaigekellymykialatexbloodwaterpulsegauzecleanvomitbadgeadminboothgroupsalinebottledonorsscalesteresaselmonjoshuanellieevettesummerjordanparkeriodinebreaksattireglovessafetyfamilymatrixcottonjacketbpcuffpalletlancettubingsmellypointspeopletrinitymelissabriannahelpfulconsentcitrate...

Surah An-Nas 114 Word Search Puzzle 2024-11-06

1 Item: Refuge, Whisper, Evil, Lord, Guide, Safety, Devil, Soul, Temptation

Acronym Accuracy Word Search 2023-03-31

38 Items: surfaceremote PICstatute milevisual routenautical mileradio frequencyvisual observerpilot in commandvisual flight rulesvery high frequencyrunway visible rangevisual line of sightnext generation radarremote identificationnotice to air missionsnational security areasmall unmanned aircraftnational Airspace Systemnational Weather Service...

KEEGAN's CTE WORD SEARCH PUZZLE 2023-01-27

16 Items: the act of having a job.the person you work for.the person you work with.what people do for a living.the money you make at your job.an input device used for typing.information a computer takes in.a computer code that uses 1s and 0s.where computers put the information.focuses on human comfort and safety.an output device used for listening to audio....

Child Rights Word Search 2024-11-15

15 Items: A safe place to live and grow.Being free from danger and fear.Children must be kept safe from harm.Every child should feel valued and respected.Every child deserves to go to school and learn.A loving group to care for and support children.Treating every child with kindness and fairness.The right to be cared for and live a healthy life....

How to Survive a Tornado 2024-10-08

13 Items: The shape of a tornadoAnother word for a tornadoWhat can a tornado sound likeWhere should you go to survive a tornado?what type of air can be a sign of a tornadoWhat is the name of the tornado we talked aboutif stuck outside, where is the safest place to hideThe most important thing to focus on during a tornado...

Viaflex 2024-04-15

24 Items: Row mulchThe work of CLIOil field in TexasAssigned to internsRuns the machine linesWearing protective gearA method of making filmOne of the Viaflex Valuesone of the Viaflex visionsProtecting cables undergroundIt tests products for qualityResponsible for bringing in revenueTemporary employees during the summerKey ingredient in the Viaflex products...

seatbelts 2024-08-02

1 Item: car crash speed transport accelerate break safety injury airbag

Sustainability, Word Search 2023-09-29

1 Item: Integrity, innovation, Partnership, PeopleFirst, Safety, Information Protection, Professionalism, patience

How Well Do You Know Your Model A #2 2023-12-29

20 Items: toplesssound of the hornextra packing spaceroadster side windowsgauge steel of the bodyabsent parts in the Model Abetween a coupe and a sedanair to water heat exchangerroadster and coupe back seatnumber on left side of blocktire related tour interruptionbasic shape of a 1931 speedometersmall light on the side of the car...

Good Laboratory Practice 2024-05-20

20 Items: The G in GLPThe L in GLPThe P in GLPThe L in ALCOAThe C in ALCOAThe O in ALCOAYear GLPs proposedYear GLPs finalizedThe first A in ALCOAThe second A in ALCOAYear GLPs written into lawSingle point of control for a studyDescribes how a task is done on a studyCurrent Summary of training and experienceFormed because safety of animals used was at risk...

March Stall Wall Word Search 2023-03-14

1 Item: acclimate, safety, security, limited areas, escort, prohibited, controlled articles, safety expo, compliance, rules, regulations, guidelines, requirements, protected areas, behavior based, brake on speeding, heart walk, heat, stress, LSIT, BBS observation

Donation Word Search 2024-10-16

161 Items: EXAMNDDRCDCSDAERFLOWWRAPKITSGEARDONORBLOODEVENTTRENDVIRALCODESLABELWASTECYCLESETUPSERUMAUDITLUNGSCHESTHEARTRANGERATIOUNITSALERTRISKSCENTERCHECKSDEVICEWEIGHTFROZENERRORSORPHANETHICSMANUALSALINESHARPSRETURNFLUIDSBOTTLECHARTSGRAPHSVITALSPORTALDOCTORLITERSSAFETYADDRESSREVIEWSNEXLYNKPROGRAMQUALITYTESTINGSAMPLESADVERSERESULTSPROTEINRESTICKRBCLOSSMACHINE...

Incivility Word Search 2024-12-01

5 Items: What can decline as a result of workplace incivility?What is Protected Health Information (PHI) protected under?A serious problem in the form of disrespectful, ill-mannered, or impudent action that negatively affects a nurse...

Voices of Strength 2024-07-20

20 Items: legal entitlements.relating to the home or family.the right to express an opinion.action taken to improve a situation.the quality or state of being strong.public support for a cause or policy.a safe place for those escaping abuse.knowledge or perception of a situation.a condition of being safe or sheltered.the state of being free within society....

LOCATIONS AND POST 2022-08-20

1 Item: PUBLIC SAFETY EARLY CHILDHOOD CENTER LIBRARY STAFF CAFE THEATER ONE THEATER TWO FIVE SIX TWO THREE THREE ALPHA EIGHT EIGHT ALPHA TWELVE MAIN ENTRANCE RAMP GYM PUBLIC SAFETY OFFICE PANTHER STATION STUDENG GOVERMENT HELP DESK CENTRAL ONE ALPHA HU

Mulsanne Word Search 2024-12-08

17 Items: – The manufacturer with the most wins in Le Mans history, boasting a record 19 victories.– A French racing legend who competed in Le Mans 33 times, yet never won the coveted race.– A Belgian driver who achieved multiple victories in the 24 Hours of Le Mans during the 1960s....

Find Mehhh!!! 2023-08-23

1 Item: aid near miss accident incident fatigue lockout danger woods hazard injury policy safety unsafe Antonio

Medical Imaging Word Search 2024-05-15

82 Items: GelCPRCFCRKCRPLPPLCEOTAGDAPExamXrayMaskCoilCNSCPSLSTubeNurseHDECPProbeRSQCCBedpanMobileOxygenReportMagnetSyringeFridaysHelicalSuctionStudentManagerClericalMeditechPortableCassetteLab CoatDowntimeContrastDirectorRadiologyTech AideCode BluePhysicistBone LossUltrasoundLead ApronTransducerScout ViewConsultantMammographyRadiologistIntravenousLunch Break...

DC Word Search 2024-06-21

1 Item: Chain, Forklift, Safety, Shipment, Package, Warehouse, Pallets, Conveyor Belt, Trucks, Packer, Receiver, Replenish, Freight, Shrink Wrap, Distribution

Engineered Product 2025-01-07

1 Item: materials processes qualitycontrol performance form function aesthetics maintenance production cost safety standards manufacture aesthetics components regulations lifespan user

Engineers A to Z 2023-01-24

26 Items: Investigate force and motion by working in teams to complete design challenges and build ramps and pathways!Introduction. Genetic engineers alter, splice, eliminate, and rearrange genes in order to modify an organism or groups of organisms....

Engineers Word Search 2023-01-17

26 Items: maintains and repairs x-ray equipmentengineering involved in all aspects of healthcareDevelop and design nuclear products and processesCoaster designs, builds and maintains amusement park rides.processes and analyzes LiDAR point clouds for anomalies and artifacts.improving the manufacturing process to increase the yield of products....

RIDERS EQUIPMENT AND TERMS TO KNOW 2024-01-18

11 Items: Essential safety gear to protect the head.The practice of horse riding and horsemanship.Tight fitting trousers worn primarily for horse riding.A common unit of measurement for horses. One hand equals four inches.A person who trims and shoes a horse’s hooves. Also known as a Blacksmith....

ER Wait Times 2023-11-25

10 Items: Nursing __________ leads to lesser ED wait times.What is the most important aspect of interdisciplinary care?What is the system used for determining urgency of condition?What is the review process hospitals undergo through The Joint Commission?What is the abbreviated term for patients who leave the ED before being treated?...

y 2024-02-01

20 Items: Harriet Led slaves to freedom Underground RailroadFrederick Escaped slavery Spoke out against injusticeMae First Black woman astronaut Reached for the starsShirley First Black woman in Congress Paved way for othersBenjamin Self-taught scientist Helped design Washington D.C.Louis Jazz musician with trumpet Broke down cultural barriers...

CQ Word Search 2023-05-04

14 Items: The rate of energy consumption.Short for modulator/demodulator.A conversation between two radio amateurs.The metric prefix for 106, or times 1,000,000.A connection made to the earth for electrical safetyThe metric prefix for 10--6, or divide by 1,000,000.A machine that can convert keystrokes into electrical impulses...