numbers Word Searches

Mathcounts Terms 3 2023-12-09

44 Items: Half of a circle.A positive integer.A polygon with four sides.Having the same shape and size.The sum of the digits of a number.A positive or negative whole number.A number without fractions or decimals.The average value of a random variable.The point where a line crosses the y-axis.A set of equations with the same variables....

MATH VOCAB 2025-10-08

9 Items: algebraic terms that have the exact same variable(s)figures have the same shape but not necessarily the same sizean equation that is true for all values of the variables involveda way to express a fraction or ratio of a part compared to a whole or out of one hundred...

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

100 Days of School 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Geometry Word Search 2025-04-01

32 Items: gleathgeoancedistanglequingleigletiondistacelesmetryaouteodtusactusecongrucalenethe study of shapesa figure with 3 sidesthe science of numberssame size and same shapea figure formed by 2 raysthe space between two pointstriangle with 2 congruent sidestriangle with 3 congruent sidestriangle with no congruent sidestriangle with 3 congruent angles...

100 days of school 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Summer Vibes 2025-07-29

107 Items: SunAirNowMoonFireSoulAuraPastFlowAntiStopChartWaterEarthFixedThetaGuideKarmaLucidBeginRisingCosmicTranceAnchorMemoryHealerMysticSeekerMediumOracleSpiritEnergyDharmaAkashaFutureAstralSacredMirrorChangeAcceptCreateDeepenWisdomWeaverTransitMutableJourneyRelaxedDestinyPurposeDreamerTeacherChannelHealingRebirthAlignedCallingAlteredCounterNumbersCardinal...

Vocabulary Words 2025-09-13

8 Items: cheapexisting in large numberssomeone who is a beekeeperchemicals that kill certain plantsland that has indigenous wild grasses growing on itthe process of raising aquatic animals and plants for fooda type of farm that raises animals on large tracts of landdown the soft, warm under feathers of a goose-used to stuff bedding and jackets or vests

Sources of finance. 2023-09-02

10 Items: repossesstradepayablesretainedprofitexternalfinanceresources used or owned by a business.Long-term finance secured with propertyfinance provided by the owner of a business.generated by the business from its own means.one or a series of regular payments made until all the money owed has been paid off....

er 5 2026-02-13

10 Items: free from germsextremely angryfeeling hopeless and gloomyan unpleasant mix of loud soundsa temporary substitute for somethingin a way that shows devotion to religiona building used to house large numbers of peoplethe return of an illness after a time of recuperationboxes or crates used for hauling fruits and vegetables...

Listen Word Search 2023-12-13

12 Items: You make food to eat.You do this with music.You say the numbers out.You do this with a pencil.You do this with your ears.You do this with your eyes.You do this with your mouth.You say the words on a book.You do this in a swimming pool.Birds do this with their wings.You use a finger to show an object.You make pictures with pencils and color pencils.

Eukaryotic Word Search 2025-10-20

6 Items: it is divided by that number.the two numbers are added togethera part of an atom with no electrical charge.the force or weight of air in the atmosphere.something is to watch it closely and note how it changes.it has complex cells with nucleid and may beeither unicellular or multicellular.

Numbers 90 and 100 2020-06-22

3 Items: oneninetyhundred

Technology vocabulary 2024-07-11

7 Items: Very popular on the internetYour online opinion about somethingA picture of yourself with your smartphoneA piece of equipment to make your voice louderInformation about about yourself on a social media siteTo transfer data or files from a computer to the internetInput gadget to enter letters, numbers, and other symbols into a computer

Word Search 2025-09-23

5 Items: A number that represents part of a whole.A comparison of two numbers using divisionAn equation that shows two ratios are equalHaving the same value, even if they look differentMultiply A method to solve proportions by multiplying diagonally across the equal sign.

Contact-Information Word Search 2025-09-11

12 Items: negative feedbackdetail like phone numbersinformation that isnt truerude action on the internetsoftware that damages a deviceinformation that could be dangerousmalaware that spreads around deviceholding files until victim pays moneypeople saying tey have a good experiencemalaware that watches from another device...

Unit 7 Math Vocabulary 2022-11-30

4 Items: equationThe constant value of the ratio of two proprtional quantitiesA collection of pairs of numbers that are in equivalent ratiosA comparison of two quantities that can be expresses as a:b, a to b, or a/b

April vocab #3 2026-04-27

10 Items: To multiply by 2an exact half of a sphereThe distance around a circleOpposite in effect. The reverse ofFinding an answer by using mathematicsTo cross over (have some common point)Any of the numbers that are added together....

Unit 7 Math Vocabulary 2022-11-30

4 Items: equationThe constant value of the ratio of two proprtional quantitiesA collection of pairs of numbers that are in equivalent ratiosA comparison of two quantities that can be expresses as a:b, a to b, or a/b

Unit 7 Math Vocabulary 2022-11-30

4 Items: equationThe constant value of the ratio of two proprtional quantitiesA collection of pairs of numbers that are in equivalent ratiosA comparison of two quantities that can be expresses as a:b, a to b, or a/b

Math vocab 2023-06-09

10 Items: The most frequent numbera value that acts outsideSubtracting larger from smallestOrder the numbers to least to greatestDivide and add many items in the data setrange the difference between two math termsof central tendency the values that result fromdata points The values that represent statistics...

Cycle 1 Vocabulary Week 1 2024-08-27

5 Items: consists of variables, numbers and operationsmaking a statement or situation less confusedthe number of protons in the nucleus of an atoma person not in the armed services or the police forcethe refusal to comply with certain laws as a peaceful form of political protest

maths words 2025-04-28

32 Items: cubeDataOrdernumbernumbernumberspherecurvedAlgebraBracketsGeometryAnalysisAverage.OperationsProbabilityMiddle value.Most frequent value.The space within a shape.Term, factor, coefficient.The distance around a shape.Solve, evaluate, unknown, variable.Coordinate, axis, linear, quadratic.Total, equivalent, balances, the same as....

KAIJUxEIGHT 2nd MISSIOoooOn! 2025-10-06

20 Items: CODE: SV-023ashes to lightMidsized Kaijukapten divisi 1illusory - KB-09fineshyt. BE. G’NMhe weaves his talejulukan kaiju no. 1the most cheerful starthe beauteous black catsenjata keahlian hoshinapengguna Numbers Weapon 6nomor humaoid kafka hibinobringing good vibes and big energyfirst Kaiju to appear in the series...

early childhood 2024-04-19

116 Items: desknursebookschairtablepapermusicnannyschoolweeklytoddlerecessfidgetblocksshapespencilinfantdaycareteacherlearingprogramnurserysupportculturemagnetspuzzlesnumbersmarkerscubbiestissuessciencedancinganimalscookinglibrarystorageprintercrayonsnewbornsandboxhomecaretrainingfeelingsbabblingemotionsfamilieslanguagesanitizesandwichlunchboxbackpackcomputer...

Elements & Compounds 2026-02-20

22 Items: charges.The number of protons in an atom.Describes a pattern that repeats.The smallest particle of a compound.Horizontal rows on the periodic table.Anything that has mass and takes up spaceElements that look dull and break instead of bend.The total number of protons and neutrons in an atom.A particle with no charge found in the nucleus of an atom....

Vocabulary Word Search 2026-03-10

8 Items: A quadratic written as x^2+bx+c.The number in front of a variable.An expression with exactly two terms.An equation with x^2 as the highest power.The U-shaped graph of a quadratic function.The value of x that makes the equation true.The highest power of the variable in an equation.Numbers or expressions multiplied together to make a product.

NCSAM 2025 Word Search 2025-10-08

10 Items: Social _____ attackBusiness ____ and Disaster RecoveryThis week's theme, "Your ____ Identity"4 letters; exposure to danger, harm, or lossintelligence that is not real, like sweetenervirus that encrypts your files & demands paymentAttempt to get info from a victim, or jam band from Vermont...

TA2.2 Day 5 Adjectives 2023-08-18

12 Items: When you feel sure, you are ___When you draw pictures, you are ___When you talk to everybody, you are ___When you study or work a lot, you are___When you do different things, you are ___When you think clear thoughts, you are ___When you want a sucessful future you are___When you are good with numbers, you are ___...

Math Vocabulary 2025-02-11

41 Items: Take awayAny number being addedWhere lines cross overlines that never touchHaving the same amount.the top part of a fractionan ordered list of numberscan be shown as fair shares.angle with exactly 90 degreesThe bottom part of a fraction.the answer to a division problemTo separate into basic elements.split into equal parts or groups...

Unit 6 Statistics Vocabulary 2025-03-04

24 Items: A guess or estimate based on patterns or data trends.A method of collecting data by asking people questions.The entire group being studied in a survey or experiment.– The number(s) that appear most frequently in a data set.A ratio that compares one part of a group to the entire group....

Get to the Root of It - Unit 20 - 15 words 2026-05-06

15 Items: fair and justat equal distanceslocated in the middlepartly awake or awarehappening twice a yearhalf of a circle or rounded spacea round before the final competitionthe middle number in a set of numbersa person who helps resolve a conflicthalf of a sphere (like half the Earth)the line dividing Earth into equal halves...

Hundred Word Search 2025-01-29

10 Items: Adding numbers to reach 100!The person who helps us learn!What we have on the 100th day!What we do in school every day!The people we learn and play with!The number we are celebrating today!To have fun and enjoy a special day!The place where we learn and have fun!After 100 days, we have learned so much!...

Ancient Israel Vocab 2025-04-28

13 Items: Wise sayingA belief in one godAn agreement with GodA Jewish house of worshipWeekly day of worship and restA sacred song or poem used in worshipTeachings that Moses received from GodPrepared according to Jewish dietary lawA forced absence from one's home or countryA rule that God wanted the Israelites to follow...

Unit 3 Vocabulary 2025-10-31

13 Items: The flip of a fractionReduce or make simplerComparion of a part to partA comparison of two quantitiesRatios with equal cross productsMeasurement system used in the USComparison of the section to totalComparison of the total to a sectionA rate that compares a quantity to oneMeasurement system based on multiples of 10...

Math Vocabulary Word Search 2024-04-26

100 Items: rise over runa fixed numbera ratio out of 100a six sided figureeight-sided polygona five sided figureone output (y value)a three sided figurethe answer to a problemequal in value or amountthe perimeter of a circlea polygon with four sidesof, relating to statisticsthe slope of a vertical linethe top number of a fractiondistance a number is from zero...

Building the Frozen Ark 2023-11-17

15 Items: necessary (par. 8)causes harm(par. 5)a replacement (par. 4)related to ecology (par.6)poisonous substances (par.6)state of being aware (par. 8)calculate approximately (par.2)a particular kind of material (par. 3)act of preserving or keeping safe (par.7)having the appropriate qualifications (par.7)relating to or consisting of molecules (par.5)...

Letters and Numbers search:- Find the letter and number combinations hidden in the grid below 2025-01-23

20 Items: Z0G5S4UYBC740G9ND7Q3DAH9DY1P5SB64IBRE7LDG5ZAUJPTQB8F0OO18ZO2H96GX9JA42UF2B0GPM10

die of death + forsaken word search (no 1x, guest 666 or guest 1337 because numbers) 2025-12-18

20 Items: nolinoobtaphtauntartfulharkenchanceelliotbadwarepursuerslasherjohndoetwotimecoolkiddloveshotdussekarkilldroidveeronicabuildermanshedletsky

MAth project 2025-10-09

9 Items: ax+bax+b=0a2 + b2 = c2.A number raised to the power of 2.A number that cannot be written as a fraction.A number that can be written as a fraction or a decimal.A neat and quick way of writing very high or low numbers.A number that is product of an integer multiplied by itself....

Unit 1 Vocab Word Search 2026-03-15

12 Items: the top of a fractiona number less than zerothe bottom of a fractiona number greater than zeroa number that is divisible by 2a number that is not divisible by 2an acronym for the order of operationsa number with factors besides itself and 1a number whose only factors are itself and 1the positive and negative whole numbers and zero...

Coefficients 2025-10-08

12 Items: A term that contains a variable.All whole numbers and their negative counterpartsThe numerical factor multiplied by a variable in a term.Number Any number that can be expressed as a fraction as a decimalRules that allow you to manipulate equations or inequalities while maintaining their truth....

Digital Citizenship 2025-11-13

10 Items: A picture of your faceYour month and day of birthA secret word you use to log inA long word meaning “kept to yourself”What adults use to send electronic mailYour special name that tells who you areA number that belongs only to your phoneThe numbers and street that tell where you liveWhat you should always ask a grown-up before sharing online...

Search The Power 2026-05-06

11 Items: 2 squared =Negative powers are ___ ?What is the Square of 7 ?2 to the power x=16, then x is __ ?M to the power N.What is "N" called ?Negative Bases with ___ comes positive.A given number can be expressed in the formNegative Bases with ___ comes negative only.What comes when a base is having the power 0 ?...

Unit 3/4 Vocab Word Search 2026-03-15

9 Items: to make a value largerto make a value smallera ratio that compares a number to 100a type of rate where the denominator is 1a visual model used to solve percent problemsa type of relationship with a constant unit ratea measurement of the "steepness" of a line on a grapha comparison between two numbers, can be written as a fraction...

WORD SEARCH MATH 2025-10-07

17 Items: oppositeunite/mergekeyword for addopposite operationfigure out a problemkeyword for subtractionhas 2 legs and hypotenusekeyword for multipilicationa number multiplied by itselfterms that have the same variablelongest side of the right tringalea symbol in math that has a certain valuea math problem with words instead of numbers...

Math 8th Grade Word Search (By Abdul Wassay) 2025-10-07

15 Items: the higher and bigger numberthe smallest and lowest numberdescribes the steepness and direction of a line on graphdescribes the steepness and direction of a line on a grapha comparison between two values or expressions that are not equala value that, when multiplied by itself, produces the original number...

The Number System 2026-03-15

12 Items: the top of a fractiona number less than zerothe bottom of a fractiona number greater than zeroa number that is divisible by 2a number that is not divisible by 2an acronym for the order of operationsa number with factors besides itself and 1a number whose only factors are itself and 1the positive and negative whole numbers and zero...

English for Engineering Review 2025-12-09

28 Items: not easily bentSI unit for massmoney that is lenta five-sided polygonthe bottom of a wavethe shape of a columna unit for measuring anglesthe simple machine that is a rampa tool for turning screws by handto decrease the speed of somethingdetailed list of all the items in stockrelating to numbers; expressed in numbers...

Motion Word Search 2026-02-17

30 Items: liquid to gasliquid to solidsolid to liquidWater at 100 degrees C.The name of our galaxy.Measures kinetic energy.Distance divided by time.Atoms move independently.The ability to perform work.A change in position over time.Described the force of gravity.How much matter an object possess.The force you use to move your body....

Hundred Word Search 2025-11-03

10 Items: – What students do every day at school.– To have fun and enjoy the special day.– To say numbers in order, like 1 to 100.– A simple way to count by marks or lines.– A big paper that shows 100 items or drawings.– A group of 100 things students bring to show.– What students become after 100 days of learning....

Unit 1 Vocab Review 2025-08-21

14 Items: Trade over oceans or seasThe study of stars or spaceA writing system for numbersFrench followers of John CalvinTo disagree with official opinionThe belief in the good of humanityCharging extremely high interest ratesA movement to change the Catholic ChurchA period of cultural rebirth started in ItalyPeople should be able to make their own choices....

Verbs 2023-12-16

16 Items: You make food to eat.You do this with music.You say the numbers out.You do this to your hair.You do this with a pencil.You do this with your ears.You do this with your eyes.You do this with your mouth.You say the words in a book.You do this with a toothbrush.You do this in a swimming pool.Birds do this with their wings....

DO IT NOW- DIN - Review greetings, numbers, day of the week (1) 2024-12-20

11 Items: tenhelloeightMondaySundayelevengoodbyethank youGood morningGood eveningGood afternoon

SOF final project 2024-06-05

15 Items: Putting values where the letters area polynomial, which has only one termvery different from the usual or traditionalalgebraic expressions that consist of variables and coefficientsa straight line that is used to define a curve or a conic sectiona quantity that may be changed according to the mathematical problem...

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

education 2025-10-27

19 Items: Synonym of test.The study of numbers.To study for an exam.A mark on an exam or course.School after primary school.The opposite of public school.The days and times of classes.The opposite of pass (a test).After an exam, you get the _____.University graduates have a _____.A period of time in a school year.The study of novels, plays, poetry....

Celebrate Word Search 2025-11-06

10 Items: – A promise you make for the new year.– Something you remember from the past year.– A fun gathering with friends, food, and music.– What we say when we leave the old year behind.– To enjoy a special time with happiness and fun.– A feeling that good things will happen next year.– Counting numbers backward to welcome the New Year....

WORD SEARCH UNITS 1 & 2 2026-02-10

24 Items: happyworriedin good shapenot decoratedwilling to helpbroken or harmedtelling the truthnew completely newnot ordinary or usualhelping you do thingsrelaxed and not worriedexisting in large numberscaring only about yourselfold and not useful anymorequiet and doesn't laugh a lotable to be trusted or believednot helpful; doesn't work well...

ACP Final 2025-05-28

20 Items: - An algebraic expression of three terms.- The number in front of the variable or term.- An expression of two or more algebraic terms.- The set of all possible inputs for a function.- A function that serves to “undo” another function.- A equation that can be rearranged in standard form.- Any mathematical expression which uses a root symbol....

Vocabulary #9 2025-11-07

9 Items: gets larger in sizethe sum or whole amountalso known as partioninga method used to find an answeran answer based on good number sensegets smaller in size, number, or quantitytwo intersecting lines that have four right angles formed at the intersection pointsform of a fraction in which the numerator and denominator have no factor in common except 1...

Science and Homeostasis 2024-10-01

14 Items: Internal balanceWhat you compare results toVariable that is on the Y axisVariable that is on the X axisThe body system that releases hormonesWhat the skin does when you get too hotTerm for the body getting rid of wastesA type of loop that counters the stimulusBlood vessels do this when you get too hotA measure of how fast your heart is beating...

WHI.2 Vocabulary Practice 2025-01-15

12 Items: Old Stone Age ____________________New Stone Age ____________________more than necessary; excess ________________skilled craftspeople; specialized labor ______________second of the three principle ages (Stone, ______________, Iron)transition from nomadic life to settled farming _____________________...

Palabras al Azar 2023-03-07

20 Items: a sneaky animalan extoic fruitMan's best friendthe color of an applemoisture for the skina device you play withword describing an injurya color on the Honduras flagwhat people drive on an dailytrips people take to get awayword describing having to waittype of support to help you seeword describing a tiring feelinga subject dealing with chemistry...

anything 2023-10-17

130 Items: foxelfbobgrut5grumlegarmsunsindayredpitcatdogabsicealexlinkwolfferbryanolafelsaannasmg4smg3smg2smg1smg0taribookbootkidscakerakezurgxmasreadgearkingnosejakenerdricelambfaceveryvasepinkbluejokelakelakeirisbearmariopeachstevewariozeldaganoncappysamussnakemidassloneluigikirbykevensantaplutogoofypeteymeggyjonesdumboblazeninjatablesnackapplewoodymelon...

Vocabulary 7 2026-03-31

20 Items: FarewellDangerousVery importantFalse, counterfeitThe highest point; tipThoughtful; melancholyAn idle wanderer, trampNoisy; unruly, disorderlyAngry and bad-tempered; rudeUnreasonably high; excessiveTo speak evil of; slander, evilLively, full of life; spicy, flavorfulAn arrival; a coming into place or viewA large city; the chief city in an area...

Lost 2025-11-13

129 Items: jinsunekovanconrumconjackwaltkaterosealexjohnyemifatetarpraftswanhugogolfboargunsbookfilmjeepwinesayidjameslockeboonerogerpennyjacobaaronlibbycagessharkhorsehatchflamepearlstaffhydrapurgeknifekeamymilesnaomibonesfaithplanecabinwaterheartjulietsawyerclaireeloisehurleyharperpylonsbuttonstatuetempleorchidcoffinhoraceotherspriestmichaelvincentgoodwin...

New Testament Books in Order (minus the ones with numbers and Revelation). 2020-06-26

10 Items: MarkLukeJohnActsJudeTitusJamesRomansMatthewPhilemon

AMS Word Search 2025-06-24

16 Items: The city of AMSThe mascot of AMSThe state we live inThe school district of AMSThe subject where you use numbersA class where people learn to actA class where people learn to singThe colors of AMS are red and _____?The subject where you do experimentsA place where you can check out booksThere are two of these in a school year...

Listening Word Search 2025-03-05

10 Items: This quality makes sure you don't give up.This skill means you are good with numbers.This skill means that you can direct others.This skill allows you to keep thing in order.This skill means you have good written skills.This Skill makes sure you get the right answer.this might be a word used for a problem solver....

Provider Data Management 2024-12-18

15 Items: Line of BusinessNational Provider IdentifierGroups that do not need an NPIDepartment that signs up new groupsSystem used for Roster management toolMissing and/or incorrect required fieldsThird party vendor for dental/vision benefits10 digit code that includes numbers and lettersThird party vendor used to house data/pay claims...

ancient math 2025-10-10

1 Item: geometry numbers greece

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

Melanie Martimez 2024-04-09

138 Items: runvoidevilwombcakesoapracezzzzak47mazejinxplutogluedalonesmoketwinspowdertestmerecesstheoneschizoseesaweraserabsorbcorpsegardensirensleechescrybabynumberscopycathauntedballpitcootiesheartediscreampatientringpophistoryemeraldmagnetscarouselsippycupplaydatenotebookdeadtomecurlycuepapercutmilkywaydrowningjumpropemistakesyouloveieraseherfunction...

Atomic Structure & Periodic Properties 2024-11-25

20 Items: The energy required to remove an electron from an atom.The distribution of electrons among the orbitals of an atom.The energy change that occurs when an atom gains an electron.The outermost electrons of an atom, involved in chemical bonding.Energy levels surrounding the nucleus where electrons are located....

Spalling Word Search 2025-07-18

2 Items: Customers residing in older flats regularly face this issue: ________ concrete(Abbreviation) Use this to generate queue numbers for customers who come to the branch

Listening Word Search 2022-07-05

10 Items: This quality makes sure you don't give up.This skill means you are good with numbers.This skill means that you can direct others.This skill allows you to keep thing in order.This skill means you have good written skills.This Skill makes sure you get the right answer.this might be a word used for a problem solver....

Entrepreneur Vocabulary 2025-08-19

14 Items: the companies buildingwhat you owe and must pay backSelling straight to the peopleMoney used to start a businessTracking cash coming in and outWendy's and Taco Bell make a dealYour share left once debts are goneThe face and name that make you knownHow much you earn from what you spendA number that shows you how you're doing...

Math 6 Vocabulary 2023-04-18

15 Items: Part of a wholePer one hundredA comparison of two ratiosA comparison of two quantitiesThe measurement of the space aPositive or Negative Whole NumberA statement of an order relationshipA math statement that shows equalityThe measure around the outside of a circleThe measurement of the outside of a polygonMath phrase with numbers and operation sign...

Economy Chapter 2 Definitions 2025-09-12

19 Items: The sacrifice of one resource or production choice for another.Goods, such as tools or machinery, used to produce consumer goods.Those goods or services that an economy produces to satisfy human needs.As used in graphs, the point at which the vertical and horizontal axes meet....

Melanie Martimez 2024-02-22

138 Items: runvoidevilwombcakesoapracezzzzak47mazejinxplutogluedalonesmoketwinspowdertestmerecesstheoneschizoseesaweraserabsorbcorpsegardensirensleechescrybabynumberscopycathauntedballpitcootiesiscreampatientringpophistoryemeraldmagnetscarouselsippycupplaydatenotebookdeadtomecurlycuepapercutmilkywaydrowningjumpropemistakesyouloveieraseherfunctionstitches...

Posties 0101 Cover 2023-12-08

6 Items: a type of pumpkin soup that Haitians eatbeing successful and having a lot of moneyused to describe something that is very bad and harmfulPeople in America watch a _____ drop to celebrate the new year.a sequence of numbers said in reverse order, marking the time remaining until a specific event...

Melanie Martimez 2024-04-09

138 Items: runvoidevilwombcakesoapracezzzzak47mazejinxplutogluedalonesmoketwinspowdertestmerecesstheoneschizoseesaweraserabsorbcorpsegardensirensleechescrybabynumberscopycathauntedballpitcootiesheartediscreampatientringpophistoryemeraldmagnetscarouselsippycupplaydatenotebookdeadtomecurlycuepapercutmilkywaydrowningjumpropemistakesyouloveieraseherfunction...

MAth projetf 2025-10-09

16 Items: Perax+bax+b=0a2 + b2 = c2.Going up the graphGoing down the graphThe total or what is equal tooA number greater than the othersA number raised to the power of 2.A number that cannot be written as a fraction.Split the number into tens or one etc. in the equationA number that can be written as a fraction or a decimal....

polynomial class x 2025-04-21

15 Items: most A polynomial of degree 'n' can have at most 'n' zeroespolynomial A linear polynomial is a polynomial having a degree of 1.The degree of a polynomial is the highest power of the variable in it.If 'α' is a zero of a polynomial p(x), then (x - α) is a factor of p(x).The zeroes of a polynomial p(x) are the values of x for which p(x) equals 0....

Engineering Words 2024-09-27

20 Items: Body of an aircraftknowledge of any kindanother word for ramphow the universe worksforceful or rough forcespeeding up of an objectsudden stoppage of motioncan hold or lift an objectforce of any object with massa study that focuses on numberssome thing that uses air to ratatepushing pulling or moving somethinga group of simple engineered sytems...

Greek Roots 2025-09-09

10 Items: unusually or abnormally activeOveractivity of the thyroid glandNot judgmental; avoiding moral judgmentsA fundamental similarity based on common descentTo come together; assemble, especially in large numbersA word pronounced the same as another but differing in meaningHaving its source or origin outside the organism; having a foreign origin...

Math Vocabulary 2025-10-08

1 Item: combine 2 or more numbers

Balak 2024-07-13

18 Items: Son of Beor.Balak’s fatherThe Prophet of the HaftarahThe last station of the ExodusHe was once a priest of MidianA son of Abraham’s wife Keturahthe art of black magic; witcheryThese were the descendants of LotHis name means “Devastator” or “Waster”Balaam was a role model for spiritual _____.commonly used to describe the trumpet blast....

UPS Label Requests 2023-09-25

19 Items: A UPS label requires _________ _________ to be created.On the confirmation page, what should you copy for later use?UPS labels should be created in possible __________ situations.Box 3 - What are you shipping? - What is the correct Packaging Type?Box 1 - Where is this shipment going/coming from? - What should you click?...

Numbers 2020-05-22

1 Item: forty

Numbers 2023-04-23

1 Item: zero

Numbers 2023-05-30

1 Item: two

numbers 2026-01-20

1 Item: a two one three

Balak 2024-07-13

18 Items: Son of Beor.Balak’s fatherThe Prophet of the HaftarahThe last station of the ExodusHe was once a priest of MidianA son of Abraham’s wife Keturahthe art of black magic; witcheryThese were the descendants of LotHis name means “Devastator” or “Waster”Balaam was a role model for spiritual _____.commonly used to describe the trumpet blast....

numbers 2026-01-29

1 Item: ABCDEFGHIJKLMNOPQRSTUVWXYZ

numbers 2026-05-20

1 Item: two , three, four, five, six, seven, eight ,nine, ten, eleven, twelve, thirteen fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty

Fraction Word Search 2025-10-09

17 Items: 1, 2, 3, 4, and so on-3, -2, -1, 0, 1, 2, 3using symbols like \(>\)Represents a part of a wholecombining two or more numbersA value that does not change.expressions that are the same.The result of an addition problemtaking one number away from anotherA number that contains a decimal pointrefer to the operation of multiplication...

Board Mania 2025-08-29

11 Items: Buy and trade properties to bankrupt opponentsMake words on a board using letter tiles for pointsGuess coordinates to sink all your opponent’s shipsMatch colors or numbers to play all your cards firstJump over opponent pieces to remove them from the boardPlace hands and feet on colored circles without falling...

Control+F 2025-07-24

15 Items: The brain inside the boxIt holds data in a programFixing mistakes in a programSomeone who breaks into computersA rule that decides what happens nextRepeats a set of actions again and againIt mixes numbers with ABCs, and 16 is the keyClear thinking used to solve problems in codingThe main screen you see when the computer starts...