new years Word Searches

Green Word Search 2025-03-06

24 Items: Month they metName of their catJason's mom's nameBecca's middle nameState they first metColor of Jason's tieMonth Jason proposedColor of Becca's eyesJason's birthday monthJason's favorite colorName of their officiantCity where Jason grew upCity where Jason proposedBecca's high school mascotFavorite free time activityLocation of their first kiss...

TV Theme Songs – Memorable intros from sitcoms and dramas 2025-05-16

20 Items: Love and marriage...Now this is a story...I don't want to wait...Step by step, day by...Sunday, Monday, happy...When I wake up in the...So no one told you life...Show me that smile again...Well we're movin' on up to...You take the good, you take...Making your way in the world...Here's the story of a lovely...Thank you for being a friend......

Hidden War Word Search 2025-05-22

20 Items: Confederate GeneralPresident of the UnionThe state of the nationFirst battle of the warThe capital of the UnionFrederick _ _ _ _ _ _ _ _Battle closest to RichmondCapital of the ConfederacyConfederate's trade centerPresident of the ConfederacyThe starting point of the warSlave states loyal to the UnionAbout 4 million people are in this...

Alberta Ed 1-125 2026-02-06

123 Items: oftoinisitheonasatbeorbyweandoifupsogonomyammetheandyouwasforarehisonehadbutnotallcanuseshehowoutherhimhastwoseewaywhoitsnowdaydidgetmaynewmanourthatwiththeythishavefromwordwhatwerewhenyoursaideachwillmanythenthemsomemakelikeintotimelookmorethanbeencallfindlongdowncomemadepartovertakeonlyworkknowyearlivebackgivemostnamegoodveryjusttherewhichtheir...

The Clever Hans Effect 2024-03-21

9 Items: introducing new ideas or methodshard to notice or see, not obviousto understand (something) in a specified wayvery good at doing something that is not easyvery unusual; very different from what is normalnot done or made consciously, not done by choicewilling to listen to or accept ideas, suggestions, etc....

Patho Word Search 2025-09-04

20 Items: Present at, and usually before, birthEstimate of likely outcomes of a diseaseEffects an illness has on a person’s lifeThe development or change in evolution of a diseasePertains to the cause of death in a given populationThe study of patterns of disease involving populationsStudy of the physical form and structure of an organism...

Sip & Search 2025-09-18

23 Items: Groom’s middle name?Bride’s Maiden Name?Who is the flower girl?Who is the maid of honor?Who said I love you first?What does the Bride collect?Who made the bridal flowers?Who is the mother of the groom?Who played cupid for the couple?Where did they both work together?What month did they get engaged in?What is the name of their fur baby?...

HR 1526: Medicare Audit Improvement Act of 2015 2025-09-24

5 Items: can be given through Medicare to regulate all DMEPOS suppliers_____ numbers are given to receive payment for DME< orthotics, and prostheticsis a federal health insurance program in the United States for people 65 years or older...

trs225b bt4wk15pt1 2022-07-07

10 Items: n.A gentle wind.adv.How a crab walks.n. e.g. Taiwan, UK, USA, France, Japan.n.A part of a plant that is underground.n.The tall, thin, central part of a plant.n.A colourful part of a plant that attracts bees.n.Something inside fruit that can grow into a new plant.n.The ground. Plants take water and nutrients from this....

Adlerian Therapy 2024-09-17

17 Items: DreamsLifestyleRecollectionsConfrontationSpitting in the client's ______First name of founder of Adlerian TherapyKey concept of feeling connected to othersAdler emphasized this type of therapy approachThe therapeutic movement that Alfred Adler is associated withThis term refers to feelings of inferiority in Adlerian thought...

Adjectives for My favourite sportsperson 2024-07-07

19 Items: Showing controlled behavior.Free from errors or mistakes.Having a strong desire to win.Full of energy and enthusiasm.Relating to detailed planning.Certain about one's abilities.Concentrated on a task or goal.Having great strength or force.Able to move quickly and easily.Skilled in planning and tactics.Able to adjust to new conditions....

Ian & Valeria 2024-10-13

31 Items: Who is older?Groom's first jobBride's first nameMaid of Honor's nameWho is the best man?Groom's favorite bandGroom's favorite foodBride's favorite foodInstrument Groom playsBride's favorite sportInstrument Bride playsBride's favorite seasonWho said I love you firstBride's favorite video gameGroom's favorite board gameWhere did the groom propose?...

Gabrielle & Andrew 2025-05-16

30 Items: Best man's nameGroom's hometownBride's last nameBride's alma materGroom's professionWhere the couple metMaid of honor's nameBride's favorite cityGroom's favorite foodGroom's favorite sportThe couple's college mascotCity where the couple livesThe month the groom proposedBride's favorite movie genreName of the couple's male dog...

Astronomy Word Search 2023-12-18

14 Items: meteoroidsa job in spacea constellationa shooting starthe study of the universestars that make up an imagethere is one for all seasonsa smaller version of big dipperits the first day of a new seasona rock that falls from space to earththis is when something gives off lightthis is when light bounces off something...

Spanish Word Search 2026-02-10

14 Items: you ____ notes in classwhen you are sick you _____on Christmas you _____ giftssome people do not like ______In school we ______ new thingsin ela class we _____ for 10 minutesinstead of someone dying they are ______at breakfast, lunch, and dinner you ______in math class you can _____ a math problemto stay hydrated you need to ______ things...

Democracy & Mexico's Government 2023-10-17

12 Items: Mexico is considered a ____________ Republic.type of democracy where all people make the lawcentral, state, and local are government _______.it is composed of a president, congress, and courtits role is to debate, make laws, and renew old onesit is elected by the people and can only last six years...

Meet The Fuegos, a Wedding Story 2023-08-01

30 Items: Who are we?What is Juan?Favorite shot?What is Marilyn?Worth the squeeze?Who is the cutest?Juan's middle name?What is Juan's sign?Who is a first born?Where does Juan live?Where is the wedding?Marilyn's middle name?Where did they grow up?Where did Marilyn live?What is Marilyn's sign?First international trip?Marilyn will love Juan......

December Word Search 2025-09-08

24 Items: Cyrus’s last nameThe Old Line StateThe Lone Star StateThe Volunteer StateThe state for loversCyrus’s go-to cocktailFamous bay in MarylandAbby’s favorite cocktailCity we currently live inThe month we both were bornPrimary language spoken in IranCity where Abby currently worksSusan’s maiden name (Abby’s mom)Farah’s maiden name (Cyrus’s mom)...

Unit 8 2024-04-25

9 Items: Reprocessing of waste into new, useful productsFlow of all wastes produced by the average persontype of waste with mostly household and commercialtype of waste with mostly chemical and constructiontype of waste with manure, crop residue, dead livestocktype of waste with tailings, overburden, broken equipment...

Executive Branch Word Search 2025-03-14

12 Items: Name of the vice presidentwhen someone is removed from officeWho is the leader of the Executive Branch?this is the building of the Executive Branchthis is the amount of times a person can be presidentThis group is made to help the president with other tasksThis is the type of power that is said in the Constitution...

Western Expansion 2025-11-02

8 Items: This was the guide for Lewis and Clark on their expedition?Who was the explorer who help to create the idea of Manifest destiny and explored what is today Kentucky.This city was founded by the French and tripled in size from the time of the Revolution to the year 1800....

Pomona Word Search 2023-03-08

21 Items: slept for 57 yearskeeper of the beesgood and wise centaurgoat with the horn of plentywas poisoned by a jealous Circedolphins carried him back to landthe trident was made in her honorthe six stars that brought the rainmother of the twins Artemis and Apollohis lock of hair protected his kingdomhusband and sons killed in a rebellion...

Jenna & Anthony 2024-10-17

23 Items: The bride’s favorite cocktailThe industry the bride works inThe couple’s favorite dog breedThe industry the groom works inThe groom’s favorite meal to cookThe Couple’s favorite comedy movieThe destination for their honeymoonThe groom’s favorite movie franchiseThe song they’ll exit the ceremony toThe color of the bridesmaids' dresses...

wordsearch ***SUDDENDEATH*** 2025-09-30

111 Items: varjmeslogslugdragsakachiprallyalleylewisserveonanahaydnravellisztverdianusahyssopnutmegneymarmbappemullerthiagoskeptachopinmahlerrameaurubatobrahmswagnerdvorakjubileemordentmanmarkmclarengerrardlampardvandijkstarboyacademystormzydebussypuccinivivaldibehemothseraphimcovenantforehandmidblocktractionraphinhasibeliusleviathanaleatoricelshaddai...

Variation 2023-05-18

20 Items: A random change in DNAThe variable you changeThe variable you measureThe organelle that contains DNAThe variables you keep the sameA different form of the same geneThe technique used to photograph DNAA result that does not fit the patternCharacteristics we get when we are bornThe change in species over millions of years...

Grace & Emmanuel 2024-06-10

28 Items: Groom's middle nameBride's birthday monthGroom's birthday monthThe bride's middle nameMonth the groom proposedLocation of their honeymoonBride & groom's go-to drinkLocation the groom proposedLocation of their first dateGroom's favorite kind of foodThe couple's favorite TV showBride's favorite wedding movieChildhood nickname of the bride...

Kelly and Jason 2025-11-26

25 Items: The father of the brideThe father of the groomThe mother of the groomThe mother of the brideThe grooms favorite beerThe sport the groom playsThe couples favorite foodThe profession of the brideThe first cat the couple gotThe birth month of the groomThe birth month of the brideThe middle name of the brideThe middle name of the groom...

Dress Word Search 2025-09-11

16 Items: The bride to beThe groom to beWalk down the ___The trip after the weddingPhrase said at the altar I ___Ring usually worn by the groomA bride traditionally wears thisDecorative arrangement of flowersThe official who performs the ceremonyA wedding cake often has many of theseA promise exchanged during the ceremony...

2023: Some Naughty; Mostly Nice 2023-12-04

13 Items: Mary's new sport craze 🏓Came to stay over Easter 🐣Eamon's morning beverage 🫖Made Ted's face puffy--twice 🦷Makes Eamon mad when too short💈Raised twice for no good reason 💸Animals that are ruining the lawn 🐩What Eamon will become before 2024 🤔Took lessons in Virginia with cousins 🌊Had a blast playing with old classmates 🏀...

Vocab - R Words 2025-02-26

13 Items: To make friendly againTo do away with by lawTo make up for; recoverNot willing to do somethingTo regain health or strengthTo remember the good old timesTo restore or make like new againHaving a likeness or similarity toA motion or exercise that is done over againRenewed attention to or interest in something...

Pasatiempos 2025-10-03

13 Items: Airpods help you do whatPicasso loved to do what?Cheesecake Factory, Outback,Students are here to do what?fútbol, baloncesto, beisbol etc.Entertainment on a screen at homeA chef can be trusted to do what?An author is a professional at whatA weekend is a good time to do what?Talented people love to do this on tiktok...

unit 8 2024-05-01

13 Items: uses microbes to absorb or digest toxinschemicals are magnified through the food webincrease in death rate occurs over a large areaincrease in death rate occurs over a local areaflow of all wastes produced by the average persontype of waste that is from chemicals and constructionturning organic wastes into a sustainable fuel source...

Generalist Word Search 2024-10-05

15 Items: the ability to produce offspringa drop in population after an overshootamount of time to double the populationprovide no care for their many offspringa species that require a specific habitatprovide parental care for their few offspringsurvivorship curve: large % of pop. dies earlya species that live in a variety of environments...

ch 15 vocab 2025-03-18

15 Items: substance with atoms that are all alike.change of one substance into a new substance.heterogeneous mixture whose particles never settle.substance in which its different components are easily distinguished.tendency for a beam of light to scatter as it passes through a colloid....

Jamestown Word Search 2024-12-13

15 Items: founded in 1607Colony for English Catholicscolony for pilgrims and puritansClimate of the New England coloniessocial contract signed by the PilgrimsLarge southern farms that grew Cash Crops1st Anti-Slavery Group in the 13 ColoniesNorthern slaves worked in these occupationsBritish controlled trade, angered colonists...

Dillon Singleton Ch.15 Vocab 2025-03-18

15 Items: substance with atoms that are all alikechange of one substance into a new substanceheterogeneous mixture whose particles never settlesubstance in which its different components are easily distinguishedtendency for a beam of light to scatter as it passes through a colloid...

Marketing Mix 2023-11-23

7 Items: The 4P's of MarketingHow it will be advertised or sold 'P'?What will be charged for a product 'P'?This is where you will buy the product 'P'?What you are selling and it's features 'P'?The people who are most likely to buy or use a new product or service are called this...

franciscos wordsearch 2025-05-14

9 Items: v. - to bring back to lifeadj. - extremely clear or brightv.-to endure, exist, or stay aliveadj.- necessary, or essential to lifen. - a food substance that aids healthn. - act of cutting open live animals for scienceadj. - attractively animated; lively (related to a person)...

eldn rings word search 2025-05-16

9 Items: teh mad man who manipulated Vykethe tarnished who could be the lordThe new power to burn down the erdtreethe flame used by the giants of the snowfieldsGodlike beings that commune with the greater willGodlike beings that commune with the frenzied flamea maiden assigned to a tarnished by the roundtable hold...

Describing experiences 2025-07-21

9 Items: F.Work you do to earn moneyH.A positive result or accomplishmentG.A series of steps taken to achieve somethingI.A situation that makes it possible to do somethingC.A new or different situation or way of doing somethingD.Something you have done successfully after working hardE.A difficult situation that tests your ability or strength...

AP Computer Programming 2025-11-21

13 Items: what a function takesattribute of an objectwhat a function gives backstarting index for an arrayint, double, boolean, StringA unique instance of a classorder of indices in a 2D arraycreates a new instance of a classa named location in memory that stores a valueblueprint or template from which objects are created...

Color Wheel 2025-10-09

9 Items: The color between red and yellowThe opposite of "dull" when describing colorThis color is at the top of most color wheelsA bunch of different colors that form a diagramThe group that consists of red, blue, and yellowThere are this many main colors on the color wheelWhen colors mix evenly, they make a _________ color...

21 2025-08-17

15 Items: Main public roadRoad Highway freedom.66 Historic U.S. highwayOldest motorcycle rally in U.S.Identification label or license plateFamous motorcycle rally in South Dakota.Formal process of becoming a full club memberSmall notepad or cushion, depending on contextLarge emblem worn on the back of a biker's vest...

21 2025-08-17

15 Items: Highway freedom.Main public roadHistoric U.S. highwayOldest motorcycle rally in U.S.Identification label or license plateFamous motorcycle rally in South Dakota.Formal process of becoming a full club memberSmall notepad or cushion, depending on contextLarge emblem worn on the back of a biker's vestEvent where new members receive their club patch...

Far Word Search 2025-08-13

1 Item: first number light went same years farm sentence long then than got draw

Basic Level Shaatibiyyah Intro and Bios Wordsearch 2 2025-03-02

7 Items: Al Shaatibi was a greatImaam Al Shaatibi was also known asWhich sahabah compiled the Quran in one harf?When you recite the Qur'an you are respected andThe Qur’aan helps those who read it. It gives blessings andHow many different styles of ahruf (dialects) are there for the Qur’aan?...

The Handmaid's Tale 2025-12-10

7 Items: Offredthe ability to conceive children or young.The state of being subject to unjust treatment or controlthe system or group of people governing an organized communityFundamental entitlements or freedoms defining what people can do or are owedrelating to or denoting an imagined state or society where there is great suffering or injustice...

Bible Affirmations 2025-04-28

25 Items: – "I am healed."– "I am set free."– "I seek wisdom."– "I am empowered."– "I am delivered."– "I walk in grace."– "I am loved by God."– "I am an overcomer."– "I am a new creation."– "I trust in God’s plan."– "I am walking in faith."– "I follow Christ’s path."I am more than a conqueror.– "I am complete in Christ."– "I am rebuilding my life."...

October Word Search 2025-05-25

20 Items: Emma's new surnameOur go-to takeawayWho is the tidiest?Month Louis proposedThe month that we metThe town Emma is fromThe city Louis is fromWho is the better cook?Our minimoon destinationThe name of city we met inThe name of our cat friendOur first sports game togetherThe football team Louis supportsThe name of the village we live in...

Word search 2025-11-23

10 Items: Type of conflict rizal wrote aboutBonifacio Hero who led the katipunanLUNA Artist who painted “The Blood Compact”BONIFACIO Hero who wrote “Aling pag-ibig pa?”game rizal played to conquer loneliness in dapitanCountry where a new Jose rizal monument was unveiled?rizal He wrote the el filibusterismo and noli mi tangeri....

The Great Depression 2024-10-14

15 Items: known as the CCCknown as the SSAsevere dust stormswhen you are not employedA horrific time in historywhere investors buy and sale stocksknown as the Wall Street Crash of 1929chats created by Franklin D. Roosevelta time of low rainfall and dry weatherthe president who created the New Dealknown as the Mississippi River Flood of 1927...

Bourgeoisie Word Search 2024-01-17

21 Items: Travels to sell goodsMaking an area more urbanMeans of supporting oneselfPublic land for community useState of being stable, steadyGroup sharing common interestsAt edge or margin; not centralAllow animals to graze on landCustom passed down generationsConditions on which land is heldAverage period a person may liveRoom for manual or industrial work...

2024 October General Conference 2024-10-04

34 Items: FSYHymnsHoly GhostJesus ChristChild of GodWorld ReportPatrick KearonIf You BelieveDallin H. OaksGerrit W. GongUlisses SoaresHeavenly FatherThink CelestialDavid A. BednarHenry B. EyringQuentin L. CookDale G. RenlundNeil L. AndersenThe New TestamentRonald A. RasbandGary E. StevensonThe Old TestamentGeneral ConferenceThe Book of Mormon...

Sip & solve 2026-01-29

24 Items: Town they live inHow did they meet?Ring bearer’s nameFlower girl’s nameBride's middle nameGroom's middle nameWhere is Troy from?Bride's maiden nameWhere is Emily from?Maid of honor’s nameGroom's favorite colorBride's favorite colorCouple’s new last nameWhere did Troy propose?What month did they meet?What is their dog's name?...

World Capitals 2024-03-14

30 Items: Capital of Japan.Capital of China.Capital of Italy.Capital of Egypt.Capital of Spain.Capital of Kenya.Capital of France.Capital of Russia.Capital of Brazil.Capital of Canada.Capital of Turkey.Capital of Sweden.Capital of Greece.Capital of Norway.Capital of Germany.Capital of Austria.Capital of Ireland.Capital of Thailand.Capital of Portugal....

2024 October General Conference 2024-10-04

34 Items: FSYHymnsHoly GhostJesus ChristChild of GodWorld ReportPatrick KearonIf You BelieveDallin H. OaksGerrit W. GongUlisses SoaresHeavenly FatherThink CelestialDavid A. BednarHenry B. EyringQuentin L. CookDale G. RenlundNeil L. AndersenThe New TestamentRonald A. RasbandGary E. StevensonThe Old TestamentGeneral ConferenceThe Book of Mormon...

THEY DID IT! 2025-05-29

101 Items: BOBBOOJEBOMADEADANNANERDFOODMISSOF OPROMSOULPREZHAUSSWIFTDUCKSJAMESMAZDAFLUTEMUSICHUMORCOVIDTWINSRALPHHALSEYDEMONSGARCIAGUITARMOVIESSNOOPYCOFFEEEUGENECAMERADIVINGSHIRTSSLOTHSSISTERFAMILYDEPAULDREAMSMARVELWALTERANDREWCRUMBLTATTOOFRIENDSCOLLEGECHICAGODANCINGRECORDSPOSTERSBROTHERCORNISHDIPLOMAIS HARDMERCURYOF MINEOF MINERECORDSCONCERTSLAUGHTERUNICORNS...

Science Study 2025-12-02

20 Items: Alfred ___.A push or pull.Mid _____ Ridge.Super Continent.Wind, Water, Ice.Plate ____ Theory.When two plates move together.Part or traces of an organism.Creation of new oceanic crust.Made from cooled magma or lava.Example of mechanical weatheringThe movement of heat through space.Liquid metal. Surrounds inner core....

Onboarding Word Search 2024-11-13

3 Items: The process of integrating new hires into an organization and its culture.The total monetary and non-monetary rewards given to employees for their work.Non-wage perks provided to employees, like health insurance, retirement plans, and leave.

ALB 2026-01-12

9 Items: White, paleHaving white flowersTo make whiter, to whitenThe nutritive white interior of an egg or seedAn early name for England (due to its white cliffs)The softer, lighter new wood under the bark layer of a treeThe extent to which a celestial body reflects light, its brightness...

Project Financing 2022-08-22

11 Items: Hello,DirectorSincerely,AyrapetyanInternational E.C.Box 10236 Shop No. 3053 Manama Centre, Bahraintigran.ayrapetyan@devcorpinternationalec.comsubmit your business plan, pitch deck or executive summary for us to review and to understand much better about your business and to further discuss a possible partnership....

Baptism 2023-11-13

8 Items: a new convertimpossible to eraseWashing away all the dirty stuff - sins.getting dunked under water to remove original sinrite has to take place in order for the sacrament to counta consecrated ointment consisting of a mixture of oil and balsam....

Family diversity wordsearch 2024-06-19

8 Items: Who coins the neo-conventional family?Which new family type does Stacey identify?Who identifies five types of family diversity.What is the dominant family type under modernism?What is the dominant family type under postmodernism?Which research method did Stacey use in her study of postmodern families?...

2024 October General Conference 2024-10-04

34 Items: FSYHymnsHoly GhostJesus ChristChild of GodWorld ReportPatrick KearonIf You BelieveDallin H. OaksGerrit W. GongUlisses SoaresHeavenly FatherThink CelestialDavid A. BednarHenry B. EyringQuentin L. CookDale G. RenlundNeil L. AndersenThe New TestamentRonald A. RasbandGary E. StevensonThe Old TestamentGeneral ConferenceThe Book of Mormon...

Med Term Final REview 2026-01-13

26 Items: dry skinliver tumordifficult labornasal dischargedrooping kidneydisease of nervesexcessive sweatingringing in the eardifficulty speakingnarrowing of the tracheaoriginating in the hearttumor of the parathyroidinflammation of the braininflammation of the tendonexcision of a uterine tubedisease of the heart muscleinflammation of the bladder...

The Little Mermaid Pgs. 17-21 2023-08-10

12 Items: I will love it ________.What do the flowers on land have?What can the fish in the trees do?How old is the little mermaid now?Where did the oldest sister lay on?Who is going to be fifteen next year?What did the second sister see people doing?When can the little mermaid go to see the land?But the little mermaid wanted to see _________....

Elements 2024-01-07

12 Items: The lightest element.Strong bones like this element.The element that fills balloons.The element that makes diamonds hard.King Midas turned everything he touched into this.Most creatures on Earth need this element to breathe.An element with a radioactive isotope found in bananas.Enables computer technology and has a valley named after it....

Germany Recap 2025-08-31

12 Items: Failed Nazi coup attempt of 1923Treaty signed in 1919 that Germany hatedGerman leader forced to abdicate in 1918Early name of the Nazi Party before 1920Hitler’s autobiography written in prisonNew currency introduced by Stresemann in 1923March 1933 law giving Hitler dictatorial powersNazi paramilitary group nicknamed the Brownshirts...

Genres 2026-01-12

12 Items: A love storyStories written for young adultsFiction about investigating crimesImagined futures with new technologiesA children's story, usually involving magicThe story of someone's life, written by themFiction that makes you feel shock, fear, or dreadThe story of someone's life, written by someone else...

DNA & Cell Cycle 2025-10-23

12 Items: Unzips DNA helixDNA is in the shape of aGuanine always pairs withIn DNA, Adenine always pairs withCondensed DNA, humans have 46 of themAdds nucleotides to the new DNA strandThe process of cells growing and dividingA section of DNA, controls cell differentiationSugar found in DNA, makes up the sides of the ladder....

Reading plus word Search 2025-01-15

117 Items: upgumwadoutlegscoaldyedgrinloadtaletipswoolcargoderbyforcegillshandsknobsledgelodgelungslightroughsteeltoughwreckattendbostonchurchexceptfamousfigurefiestaglidedheaterislandlandedlensesmessedmuseumperiodrescuesignalslopesslopesstaredstormysturdytangleunloadupwardbalancebreathecontrolfreedomhistoryimmensejournalmessageenglandpackageploppedsailors...

Unit 9 2024-04-25

8 Items: most widely used energy source globallysmall bubbles of nitrogen gas trapped in iceThe process of breaking the bonds in an atomprotect us from uncontrolled fission or radiation leakscolorless, odorless gas and is cleanest burning fossil fuelterm used to determine when oil supplies will start to dwindle...

The Space Race & Technological Advancements 2025-05-08

8 Items: Animal sent to space by the Soviet UnionSpeech given by Eisenhower to the United NationsTechnological Advancement following the Cold WarSpace administration created by the United StatesCountry that the United States was in competition withCartoon used in the 1950’s to teach kids to duck and cover...

Fun with Ian 2025-01-22

10 Items: A big smileA color like snow or cloudsA small river where water flowsTalking very softly, like a secretA big area full of trees and animalsTo go look around and find new things.A word we use to ask about something, like, “What is this?”A word we use to ask for a reason, like, “Why is the sky blue?”...

9321 The Sower 2024-03-06

10 Items: A person who plants seeds.Ground or soil that has a lot of rocks.Sharp, pointed parts of certain plants.Rised every morning and warms the earth.Rich, healthy soil that helps plants grow.The result of a plant growing and producing.A way or track laid down for walking continual repeatedly.A simple story used to explain a moral or spiritual lesson....

Quarter 3 Vocab Review Part 2 2025-03-13

10 Items: extremely tiring and demandingto move or act slowly; to delayconfused and slightly worried; puzzleda large or excessive amount of somethingto match or surpass; typically by imitationto gather information or material bit by bitto give new energy to or restore back to a former conditionto move toward the same point and come closer together or meet...

Chuaanlac Word Search 2026-02-03

10 Items: The place we first met.The best picnic location!!Best donuts at Rise'n Roll.The month we started dating.Our go-to for dim sum in Chicago's Chinatown.Where we went for our first date (after dinner!).The festival we went to in New York (hint: gecko).My personalized drink you took credit for at Crumble Cafe!!...

Christmas Movies 2025-12-02

10 Items: A young kid's pranks outwit two rather clumsy bandits.One overly confident father attempts the perfect holiday but everything goes wrong.A three heart sizes too small thief learns that presents never are what makes the holidays special.A young boy gains a train ticket to the North Pole turning this book adaption into a heart-warming musical....

Esthetic Modalities 2024-08-19

16 Items: Normal Dry Skin, Increases MoistureRestore PH Balance, Soothes IrritationCell Turnover, Resurfacing, Less InvasiveDetoxifies and Purifies, Rebuilds TextureMilk Derived, Brightens Dull Skin, Most GentleAntiaging, Improves Elasticity, Stimulates CollagenGood for Sensitive Skin, Cool, Soothing & Hydrating...

Past simple 1 vety 2025-03-25

16 Items: I ________ a competition.Where _____________ you on Monday?___________ he at school yesterday?They _____________ a book last week.He ___________ a letter to his friend.He _________ his phone when he dropped it.After the long walk, I __________ very tired.He ___________ his bike to school this morning.I’m sorry, I __________ your birthday last week....

10.The 1950s were a time of rapid technological advancement, with many new inventions and innovations transforming everyday life. 2023-03-04

20 Items: stereosrocketsjukeboxeslprecordsairplanestelevisiontelephoneshifisystemsautomobilesvinylrecords45rpmrecordstaperecordersrefrigeratorsmicrowaveovenscolortelevisionpolaroidcameraselectricguitarswashingmachinesairconditioningtransistorradios

WHI.2 Vocabulary Practice 2025-01-15

12 Items: Old Stone Age ____________________New Stone Age ____________________more than necessary; excess ________________skilled craftspeople; specialized labor ______________second of the three principle ages (Stone, ______________, Iron)transition from nomadic life to settled farming _____________________...

Vocabulary 2025-07-07

16 Items: Not safeNot dangerousNot interesting; dullUnusual: not familiarThe opposite of indoorsKind and nice to othersLand surrounded by waterANother word for a vacationTo spend time learning about a subject.Being able to talk and communicate with people wellA place where people live that is bigger than a town...

African American Studies Word Search 2026-02-17

8 Items: Which colony passed the first slave codes?The Christian group that were mostly against slaveryWhich continent did most enslaved people get sent to?The movement that Phyllis Wheatley became an important part ofThe people who have any origins in the dark-pigmented populations of Africa...

Polynesian Panthers 2024-10-14

10 Items: Who was the leaderWhat group influenced the polynesian panthersWhat country inspired the Polynesian PanthersWhat social issue did the Polynesian Panthers fight againstsocial movement in the U.S. inspired the Polynesian PanthersWhat police operation targeted Pacific Islanders in the 1970sWhat city was the Polynesian Panthers' headquarters located in...

Puzzle Friday 2025-10-24

10 Items: the A in DEA stands for ___the name of Nathans new sonreturn items go through a ___ processchime calls are being replaced by ___to change the delivery point, contact this teamwhat team to engage when FBA Fraud is suspectedwhat broke on monday and caused chaos to the world (lol)when a shipment goes to the wrong building it is called a ___...

The basics + numbers 0-31 + calendar 2026-01-30

17 Items: 87-72=...The ninth monthThis word means "years"the first day of the weekThe first month of the yearThe amount of hours in a dayThe first day of the weekendthis season comes before "otoño"We use this word to say thousand in SpanishA way to greet someone after 12pm but before dinner timeAfter this number, all numbers up to 99 have three words...

Our Community 2023-10-10

10 Items: People who are above 60 years old.National Philosophy of Brunei Darussalam.Rights and freedom that all of us are entitled to since birth.The money that the government provides for senior citizens every month.A Duty towards community to promote a safe, secure and moral environment....

Mr Jensen 2025-12-01

16 Items: He sees Clint’s talentHe has a gift for drummingHe cares about his studentsHe doesn’t always talk to othersHe can make music from his tappingHe is worried about being punishedHe makes students feel comfortableHe notices things other teachers missHe thinks carefully about how to helpHe gives positive feedback and support...

Causes and Effects of Imperialism 2025-02-06

10 Items: Survival of the fittestGeorge Washington initially wanted the US to stay ___The US's desire to tap in to new African and Asian ____The US acquired the ____ for a place in the Asian marketThe US acquired ___ after an uprising of Queen LiliuokalaniAmericans Missionaries sent to China in hopes to spread ____...

Pesticides, Pollinators, and People 2024-03-27

13 Items: Name of the bee epifamily____________ collapse disorderNumber of described insect speciesBonus: Critically endangered bee in MNPeople who first used sulfur pesticides 4000 years agoAbout 60% of this leafy green was found to have neonicsTerm referring to rapid decline of insect species across the world...

Pinchas 2024-07-20

18 Items: Moses successorThe seventh day.Phinehas’ father.Daughter of Asher.Jeremiah’s hometown.Zimri was from this tribeSimon was know as a _______.Phinehas’ reward for his zeal.The 14th day of the first month.his Hebrew name means “3 Israelites”The new moon or the first of the month.Cozbi was the daughter of this Midianite prince....

Review Unit 1 and Unit 2 2025-10-04

2 Items: gym, reading, science, math, English, art, computers,homework, grade, flowers, rice, fruit, bike, camera, markers, building, bricks, guitar, robot, skateboard, tablet, cool, old, new, borrow

Week 9 Vocabulary 2026-01-26

7 Items: A group of birds that fly or feed together.A type of flowering plant native to Australia.Large, long-legged wading birds with long, curved beaks.Small wading birds that live along shorelines and have slender bills.Large wading birds with long bills, known for their long migratory flights....

Old Word Search 2025-09-10

1 Item: young new handsome beautiful

1930s/Great Depression 2022-12-06

13 Items: another cause of the depressioncreated to help unemployed people get jobsFDR's weekly radio addresses to the nationelected president in 1932/ created new dealrose drastically as the stock market crashedcaused by drought and poor farming techniquesshanty/homeless towns named after a presidentamendment that limits a president to two terms...

Marketing Concepts 2026-02-16

13 Items: increase in costbabies born between 1965-1977babies born between 1977-1997completely new products people do not know aboutmoney left after taxes are taken out of paychecksapplies to a fairly homogeneous group of consumersapplies to a more heterogeneous group of consumersobtaining the money necessary for business operations...

Bamidbar 5.0 2025-05-25

23 Items: “Mishkan”Hebrew, “Bamidbar”The Rosh of a man?Aaron’s firstborn.The son of Shedeur.Eleazar and IthamarThe chief prince of the Levites.The Levites belong to _________???This tribe numbered 41,500in the census.This tribe numbered 59,300 in the census.This tribe numbered 45,650 In the census.This tribe numbered 57,400 in the census....

Plate tectonics, volcanoes, and earthquakes 2026-03-03

20 Items: Molten rock beneath Earth's surface.A plate boundary where plates collideA plate boundary where plates pull apartEnergy waves released during an earthquake.Instrument used to record earthquake waves.Massive, moving pieces of Earth's lithosphere.Heat transfer in the mantle that moves plates.A fracture in the crust where movement occurs....

The traits of successful young entrepreneurs 2024-01-02

8 Items: Being able to come up with new and creative ideasUnderstanding how to use and spend resources wiselyContinuing in a certain action in spite of obstaclesHaving the ability to inspire others behind a central visionBeing able to have mutually beneficial interactions with peopleUsing this skill they derive what's true without conscious learning...