maker a day Word Searches

El Hombre de Vocabulario/Quizlet 1B 2024-10-08

39 Items: IheboyshebutgoodlazyI amgirlverydaringpatientseriousartisticstudioussociabletalentedI am notimpatienthe/she issometimesintelligenthardworkingAre you...?male friendfunny, sillyaccording toreserved, shyfemale friendnice, friendlyneat, organizedhe/she likes...messy, unorganizedWhat are you like?What is he/she like?What is his/her name?...

El Hombre de Vocabulario/Quizlet 1B 2024-10-08

39 Items: IheboyshebutgoodlazyI amgirlverydaringpatientseriousartisticstudioussociabletalentedI am notimpatienthe/she issometimesintelligenthardworkingAre you...?male friendfunny, sillyaccording toreserved, shyfemale friendnice, friendlyneat, organizedhe/she likes...messy, unorganizedWhat are you like?What is he/she like?What is his/her name?...

2B Vocabulaire 2024-01-08

21 Items: daynextlastweektodayfirstMondayFridaySundayTuesdaymorningeveningto failto findThursdaySaturdayto teachWednesdayafternoonto listen toto take a test

Atlas Word Search 2025-03-24

50 Items: aibyinondoisoradgoitpihameamhemysoanhinotoasofupatidohusbeifokweandcatwassadbaglegwhobutdogbeehaypaydaylogbogcogwma

Rach Fault 2023-09-13

40 Items: A long trip or voyage.An insect with colorful wings.A high landform with steep sides.An exciting and daring experience.Valuable objects hidden or buried.A musical instrument with strings.A highly intelligent marine mammal.A dense forest with heavy rainfall.A pleasing arrangement of elements.A sea creature with eight tentacles....

A Bad Day for Little Dinosaur 2016-10-12

18 Items: dayloggotoffrandownwentcamehelpnosebeachaftercrabsbeetlelookedlittlerunningdinosaur

El Hombre de Vocabulario/Quizlet 1B 2024-10-08

39 Items: IheboyshebutgoodlazyI amgirlverydaringpatientseriousartisticstudioussociabletalentedI am notimpatienthe/she issometimesintelligenthardworkingAre you...?male friendfunny, sillyaccording toreserved, shyfemale friendnice, friendlyneat, organizedhe/she likes...messy, unorganizedWhat are you like?What is he/she like?What is his/her name?...

El Hombre de Vocabulario/Quizlet 1B 2024-10-08

39 Items: IheboyshebutgoodlazyI amgirlverydaringpatientseriousartisticstudioussociabletalentedI am notimpatienthe/she issometimesintelligenthardworkingAre you...?male friendfunny, sillyaccording toreserved, shyfemale friendnice, friendlyneat, organizedhe/she likes...messy, unorganizedWhat are you like?What is he/she like?What is his/her name?...

office 2025-02-26

19 Items: A piece of work to be done or undertaken.Working together to achieve a common goalA plan for carrying out a process or procedure.The process of organizing and storing documents.A machine used to make paper copies of documents.A written message, especially in a business settingA plan or suggestion put forward for consideration....

Masthead Word Search 2023-02-21

28 Items: journalista reportercapital letterstype of letteringtitle of an articlea piece of reportinga thick visible printa popular type of papera news article or bulletinnewspaper published everydayline giving the date of writingnewspaper published once a weekthe main article in a newspaper.information about current eventsnewspaper appearing every 4-weeks...

Waves Unit Vocabulary (RIS) 2024-03-14

22 Items: lowest part of a wavehighest part of a wavehow compressed or rarefiedrapid back and forth motionfrom one compression to the nextwave traveling parallel to the forcedisturbance causing medium to vibratewhat a mechanical wave travels throughfrom crest to crest or trough to troughthe distant parts of a longitudinal wave...

Mumbo Day 2025 Find-a-word 2025-05-11

18 Items: MAPSMUMBOZOOMYCOFFEETRAVELCHEESELEMONSMAXIMUMPENGUINWHISKEYBOOKWORMMUMBONIUMMUMSWUMBADAYTRIPPERFISHANDCHIPSWEIGHTLIFTERGRANDCHICKENSSOCIALBUTTERFLY

HEALTHY AND UNHEALTHY HABITS.- GREEN for healthy habits and RED for unhealthy habits 2024-06-02

16 Items: PRAYVAPINGSMOKE WEEDDRINK WATERNOT SLEEPINGPROCASTINATEOVERTHINKINGWALK YOUR DOGEAT JUNK FOODSLEEP ALL DAYEXERCISE DAILYBRUSH YOUR TEETHWATCH TV ALL DAYWEARING SUNSCREENEAT BALANCED MEALSPLAY VIDEOGAMES ALL DAY

Monday Word Search 2025-11-12

7 Items: the last day of the weekthe first day of the weekthe third day of the weekthe fifth day of the weekthe sixth day of the weekthe second day of the weekthe fourth day of the week

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

09 2025-08-16

15 Items: This term refers to a car.A very long motorcycle journeyA short ride taken in a single dayTraveling long distances by motorcycleLifestyle of riding cruiser motorcyclesThe culture and passion for riding bikesA planned trip covering multiple destinationsTo ride a motorcycle aggressively or intenselyFeeling of liberation while riding a motorcycle...

a 2025-01-07

20 Items: EVESINADAMTREEEDENGOODHIDEEYESLIFEEYESFRUITCURSEDEATHGARDENLEAVESSERPENTDELIGHTFORBIDDENKNOWLEDGETEMPTATION

a 2025-09-15

19 Items: DEPLOYBACKENDBACKLOGBIGDATALOGGINGMONITORQUALITYRELEASESERVERSFIREWALLANALYTICSCONTAINERDATABASESAUTOMATIONENCRYPTIONAUTOSCALINGACCESSCONTROLAUTHORIZATIONAUTHENTICATION

A Day in the Life of a Radiation Worker 2025-11-25

18 Items: TimeALARAAlphaGammaRadonDistanceRoentgenExposureSheildingChernobylDosimeterProtectionStochasticContaminantRadioisotopeRadioactivityDeterministicCataractogenesis

a 2025-11-14

19 Items: RomaCriseTermasRômuloGuerrasOdoacroFrancosAfrescoEscravosBárbarosVândalosVisigodosPoliteísmoMonoteísmoOstrogodosAnfiteatroPergaminhoGladiadoresCristianismo

FNW Final Review 2024-04-26

20 Items: One of FCCLA's colorsFCCLA's official flowerA unit of energy found in foodOne way vegetables are classifiedOne of the parts of a grain kernelThe number of essential amino acidsThe main nutrient of the dairy groupAn example of a cultured dairy productWhen food choices are influenced by sensesThe number of calories in a gram of protein...

Spanish recap 2023-07-20

30 Items: a cara busa beda farma towna citya housea coacha tablethe poola windowI live ina cottagethe beachthe atticby the seathe churchthe cinemato sunbathethe kitchenan aeroplanethe water parkthe theme parkto the left ofthe post officeto the right ofthe living roomthe dining roomto swim in the seathe shopping centre

What do you do in your free time? 2025-12-03

15 Items: do+balletchat+onlinedo+a+puzzledo+exercisewatch+a+playgo+geocachinghave+a+picnicstream+videosdo+magic+tricksgo+to+a+concertpaint+a+picturehave+a+sleepoverwear+fancy+dressplay+a+board+gamesearch+the+Internet

Spanish 2025-11-07

28 Items: manoldtalllonghairwomanshortshortyoungto wantdessertred hairdelicousto orderyoung mangrey hairmain dishbrown hairblack hairblond hairto be warmto be coldrich,tastyyoung womengoodlookingfor dessertto be sleepyas a main dish

Autumn Word Search 2022-10-15

37 Items: / HARVEST ***/ LEAVES COLOR/ *** OR TREAT/ A *** HARVEST/ AUTUMN IN SPANISH/ AUTUMN IN CROATIAN/ ANNUAL PARADE IN NYCALMANAC / KINKS KLASSICRAIN / GUNS N' ROSES SONG/ ANOTHER NAME FOR HALLOWEENCORN / ABOMINATION OF A CANDYPIE / DESSERT ON THANKSGIVING/ IT'S THE GREAT ***, CHARLIE BROWNBOOGIE / VILLIAN IN HALLOWEEN TOWN...

ENGLISH 4--A DAY 1ST PERIOD 2023-08-12

18 Items: avilessherlynortegadanaleerodriguezdiegohinojosajuaquinespinozacarolinemaleyaydinizaihamartinezbryanleegarciabrianaelyserosalesanikahmaiasolisnyleneemereybrownjordannahsophiatolentoemilyangelinajimenezfridaalejandramartinezbradlysolomonmoralesjasonalexandertrevinoxitllaliximenazimnygarciatiffanymariegomezgonzalezosvaldoeleazar

Terminology Search 2022-05-28

23 Items: High register wordsNon-literal meaningAn all-knowing narratorA non-literal comparisonA past tense auxiliary verbAnother term for a main clauseLexis like she, her, it, they, meA sentence function which commandsA sentence function which asks a questionThe term for words which all mean the sameA type of verb where the action can be seen...

Terminology Search 2022-05-28

23 Items: High register wordsNon-literal meaningAn all-knowing narratorA non-literal comparisonA past tense auxiliary verbAnother term for a main clauseLexis like she, her, it, they, meA sentence function which commandsA sentence function which asks a questionThe term for words which all mean the sameA type of verb where the action can be seen...

Mathcounts Terms 3 2023-12-09

44 Items: Half of a circle.A positive integer.A polygon with four sides.Having the same shape and size.The sum of the digits of a number.A positive or negative whole number.A number without fractions or decimals.The average value of a random variable.The point where a line crosses the y-axis.A set of equations with the same variables....

3B word search week 13~15 2022-06-02

25 Items: to get pleasure from somethingthe process of doing somethingto produce leaves to begin to grownot containing any things or peopleone of the four periods of the yearsomeone who dances either as a job or for pleasuresomething bad that happens that is not expected or intendeda man of noble birth, who served his king or lord in battle...

brainrots 2025-09-21

46 Items: deada orcaa sharksistersbrothersa barrelan orangea plushiedead sharkdead mateoa mutationa mutationa mutationa footballthe creatorbaby la vacaa cow planeta red elephanta cactus hippodead ballerinaan old mutationa walking kettledead combinationbaby boy brainrotthe current eventanother old eventa walking cupboardbaby girl brainrotthe creators rival...

Le Sserafim - Flawless 2025-04-14

26 Items: 12:00 at nightStylish outfitVery loud musicA trip in a carMoving to musicNot being aloneNot moving fastTo not worry or careThe opposite of wrongThe opposite of rightThe way someone feelsA close female friendStrength or livelinessA power used by wizardsA phone call or messageThe beginning of the dayExtremely good or perfectTo sing loudly in the car...

Storey Word Search 2023-02-20

25 Items: the vertical surface of the staira room or a space directly unfder the roofthe lower square slab at the base of a columna continuous vertical brick or stone structurethe lower surface of a room on which one may walkthe provision of fresh air to a room, building, etc.a window that projects vertically from a sloping roof...

All Summer in a Day 2025-05-09

13 Items: tidaledgedmidstoctopiseizedtremorimmensefeverishsavagelyresilientconsequencetumultuouslyrepercussions

Spanish 2024-11-04

28 Items: manoldtalllonghairwomanyoungdessertyoung mangray hairto be hotdeliciousmain dishblack hairred-hairedto be coldrich,tastyyoung womanblonde hairfor dessertgood-lookingto be sleepyshort (height)short (length)as a main dishto want, to desirebrown (chestnut) hair--> i) to order, to ask for

A2+ Unit 1 Vocabulary 2024-09-06

20 Items: very scary filmsa show that discusses sportsa show or film that is animateda show that makes you laugh a lotshow or movie about people in lovemovie with a lot of action and eventsa game where people play as charactersa program about food and how to make ita game with a lot of interesting thingsa program on a stage with lots of music...

Reflect Word Search 2025-04-24

14 Items: Food you eat.It holds water.Lots of colors.You dance to this.When the sun goes up.A light you can carry.When the sun goes down.A special day we celebrate.Bright, colorful lights in the sky.When you think back about something.The season of the year that has flowers.Folded paper you put money or a letter in.Something you do each year for celebration....

Holidays around the world Word Search 2025-02-26

8 Items: EiddayEasterRamadanHanukkahChristmasHalloweenof the Dead

5B 2024-10-25

28 Items: manoldtalllonghairwomanyoungsugarto wantdessertto orderyoung mangray hairto be hotdeliciousmain dishbrown hairblack hairred hairedto be coldrich,tastyyoung womanblonde hairfor dessertgood-lookingto be sleepyshort(height)short(length)

Jannah 2022-11-03

15 Items: SoilMilkWineMuskWaterHoneyTreesFruitRoomsRubiesgoldensilverPalacesHappinessJudgement Day

Vocab list 1b 2023-03-16

39 Items: IheIamboyshebutgoodlazygirlverydaringareyouIamnotpacientseriousartisticstudioussociabletalentedhe/sheisimpacientsometimesmalefriendfunny/sillyintelligenthardworkinghe/shelikesaccordingtoreserved/shyfemalefriendnice/friendlyorganized/neatmessy/unoranizedwhatishe/shelikehe/shedoesnotlikewhat is his/hernameeres? whatareyoulikeathletic/sportsminded...

Camping 2025-08-20

23 Items: A person who goes campingA portable shelter made of fabricA path used for hiking or walkingA device used to determine directionAustralian version of a sleeping bagThe open air and natural environmentCatching fish, often in lakes or riversA tool for cutting and various other tasksA portable stove used for cooking outdoors...

Vocab 9 2024-01-10

12 Items: The two different stories were _______.after I got an A on my test is I was _______.It was a _______ event when War world 1 happened.After I got an a on my project tried to ______ them.I couldn't get past question one it was a real _____.He was ______ to a lower math class when he failed his EOC....

1B 2023-10-16

20 Items: Iheshebuti amverygoodmessydaringpatientstudiousi am notartisticimpatienthe/she isaccordingfunny,sillyintelligentmale friendsports- minded

Basic concepts related to functions 2024-12-23

16 Items: Graph of a linear functionA value that does not changeGraph of a quadratic functionA symbol that represents a numberA function whose graph is a parabolaA visual representation of a functionAll positive and negative whole numbersThe point where a graph crosses an axisAll possible output values of a functionA function that reverses another function...

Spanish 2024-12-10

31 Items: redlampwallbluegraypinkclockshelfvideowhitebrownblackgreenmirrorcolorsyelloworangepurpledresserbedroomcama bedpaintingbonito,aDvd playernight tableafrombra rugsound systemtelevision setcloset,wardrobecompact disc(CD)cortinas curtains

English Words to Know 2025-01-16

43 Items: a pet animala place to sitthings you eata thing to readgood or pleasanta part of a housenot nice to look atthe liquid you drinkfeeling upset or madbeing nice to otherssomething to write ona place to buy thingsa place to buy thingsfeeling good, not sadfeeling bad or unhappynot big, little in sizenot small, large in sizea place where people live...

MEDICAL 2025-11-30

15 Items: I check if you have a fever.wrap me around a cut or scrape.the person who checks your health.a place you go when you feel sick.something you take to feel better.a tool used to hear your heartbeat.a visit to make sure you're healthy.a quick poke that helps protect you.I cover your face to keep germs away.I beat inside your chest all day long....

Filler Week 4 2023-02-03

10 Items: Baby Raccoons [Raccoons]A baby shark [Hammerhead Sharks]Fiction[What Happens Next, Katie?]Raccoons eat anything: they are _____ [Raccoons]A tool used to twist a nut [Screws, Nuts, and Bolts]A box or pot for saving money [What Happens Next, Katie?]Modern day relative of the ancient armadillo [Ancient Armadillo]...

WordsearchrocksfromAmelie 2024-06-24

22 Items: Super smartA pleasant smellyour mothers sisterA month in the yeara feeling you are havingsomeone who is well knownThe words to a song or poema large building with multiple roomsA small cafe usually meant for drinksa small snack that can be in differenta musical instrument you tend to struma strange puzzle or object or occasion...

Doapresentation Word Search 2025-09-28

26 Items: termbreaktime,say sorry,take notes,feel lonelyget on wellfail a test,miss school,pass a test,take a test,school year,get to know,state school,make friends,get a low markwrite an essaykeep a secret,tell the truthwear a uniform,private school,get a good mark,do a presentationcheer someone up,have an argument,revise for a test,have (a lot) in common,

a 2025-02-27

18 Items: égalpluschangerayonslumièrediffuseminuteslumineuxrebondirréflexionrégulièreabsorbentdangereuxréfractionAbsorptionpropagationgrossissentfocalisation

a 2025-07-31

18 Items: reizeusherapóliságoraatenasgréciavotaçãoacrópoleamálgamapériclestroianosigualdadeposseidondemocraciaassembleiapalasatenaantiguidade

History Vocabulary 2025-04-22

20 Items: A man who rules a country.A woman who rules a country.A big fight between two armies.Making something new, like a machine.A big fight between countries or groups.A big change in a country, often with fighting.An agreement between countries to stop fighting.A country or area controlled by another country....

6th grade study 2024-05-15

15 Items: A spacehurricainA very hot planetits a giant ice agea giant cloud of gasits a planet we live onA planet that is now gonedot a black hole in spacedot a red dot in the galaxyA planet with a lot of ringsA lake of water with mineralscycle A cycle of water rotationITs a big glowingthing in the skyhole a black hole that will destroy anything in its path...

May 2025-07-25

31 Items: MayDayJoyBeesdaysLushBloomGreenFreshSpringWarmthGrowthGentleTaurusGeminiBreezyFlowersPicnicsVibrantVerdantSunshinePlantingOutdoorsDay (US)GardeningAwakeningBlossomingButterfliesCelebrationsLightheartedHoliday (UK, in some regions)

Los días de la semana y el tiempo buscapalabras 2022-10-26

26 Items: MondayFridaySundayTuesdayThe dayThursdayThe weekthe dateSaturdayToday isWednesdayIt is hotIt is coldthe weatherit is sunnyTomorrow isIt is windyit is snowingit is rainingYesterday wasWhat is the date?what day is today?The days of the weekWhat day is tomorrow?What day was yesterday?What is the weather like?

Pathophysiology Word Search 2024-09-09

20 Items: The study of the tissues of organismsThe study of diseases and how they spreadThe likely outcome or course of a diseaseA subjective experience reported by a patientThe study of the causes or origins of diseasesA group of individuals who share a common traitRefers to a condition or trait that is present at birth...

Spanish 2024-12-11

31 Items: redlampwallbluegraypinkclockshelfvideowhitebrownblackgreenmirrorcolorsyelloworangepurpledresserbedroomcama bedpaintingbonito,aDvd playernight tableafrombra rugsound systemtelevision setcloset,wardrobecompact disc(CD)cortinas curtains

Political vocab 2024-12-10

22 Items: States that consist of multiple nationsA group of people with a common identityExtending a country’s influence by forceA State that mostly consists of one nationNation that is spread out among multiple statesA nation that does not have a state for themselveschanging voting districts to favor one party over another....

a 2025-10-07

18 Items: SulEUANorteFrançaTabacoAçúcarGuianaEuropaTerrasBrasilColôniaAlgodãoAméricaReligiãoInglaterraPovoamentoNovaIorqueColonização

Unit One Vocabulary 2025-08-26

14 Items: polygontake apartput togetherput in a different ordera 3D figure with one basea 3D figure with two basesa flat surface on a 3D figurea point where two edges meet in a polygona 2 dimensional representation of a polygona line segment in a polygon; also called a sidethe length of a side of a triangle or parallelogram...

Topic 6 DEVELOPMENT OF HARDWARE, SOFTWARE & TELECOMMUNICATIONS SYSTEMS 2024-05-02

21 Items: The brain of a computerSemiconductor materialsThe delivery of computing servicesMaterials that have a conductivityA set of recognizable and verifiable dataThe capacity of a device to hold and retain dataPhysical components of a computer that you can touch and see.Set of instructions and programs that tell a computer what to do...

Solution Center Training Week 1 2024-07-02

17 Items: BA stands for ____.What we call a 3HSS or 5HSS adThis is what we call a potential clientTerm used to describe a service as a softwareThis "Center" helps a client grow their businessWhat we call products that can no longer be sold as newThe last day to retire a product before late work startsWhere we can view copies of the print directories online...

Spelling Word search 2025-12-01

15 Items: not awakesomething amazinga sound to get upa delimited Spacea piece of creativitysomeone who makes arta plant with pale Greena room you use to sleepa book filled with Photosa Word to Connect sentencesa person who goes in Spacea place where plains arriveto put a a question on someoneA small black and yellow insect...

A 2025-08-22

18 Items: REMIWIREANNIECATHYDREYSMOTORSTORMTOMMYENERGYOXYGENBATTERYSTORAGEFLYWHEELHYDROGENRECHARGEREGINALDSPINNINGNIGHTLIGHT

"a" 2025-02-22

18 Items: PastaAvoidPandaCommaBananaHarassHexagonAnagramHusbandPrivateMagazineEntranceEmbarrassParagraphGuaranteeAbominableExclamationAnnouncement

a 2025-11-10

18 Items: aittallparkalleeopmankubjaskärnersulanetalgudhäärberraharenttalveaedsepikodakõrtsmikrehepapprehepeksviinakööktallipoiss

Olympic wordsearch 2024-07-27

22 Items: Sport of racing bicyclesSport of racing in waterEvent of throwing a spearSport of fighting with fistsSport of fighting with swordsMartial art and Olympic sportSport of lifting heavy weightsEvent of throwing a heavy ballSport of racing boats with oarsSport involving horseback ridingSport of racing boats with sailsSport of hitting a ball over a net...

Unit 2: Spelling Test 2 2022-09-27

25 Items: scenicembarrassedin a loud mannerin a curious mannerparticular; definitea two-wheeled vehicleto get rid of; removea large, ornate houseone who replaces anotherto consist of; be composed ofexcessive; unrestrained; imprudentto clarify the meaning of; to translatein a manner indicating great weightinessconsistently; with little or no variance...

Rylan's Word Search 2025-04-08

20 Items: who is pumpkin?who is your sister?Who is the president?another name for mimi?who is your boyfriend?who is Chris to Linda?what month is christmas in?who is your boyfriends mama?how many days are in a week?how many moths are in a year?how many sons does Joye have?how many minutes is in an hour?what is Linda's daughter's name?...

Summer Olympics 2024-07-17

26 Items: swimming, diving, water polothe activity of lifting barbells or other heavy objectsA sport where teams or individuals propel a boat using oarsA sport that involves shooting arrows at a target using a bowtrack and field events, including running, jumping, and throwingSports involving horseback riding, including dressage, show jumping, and eventing...

One Word Search 2024-03-15

18 Items: What is her favourite food to eat?What is Stacey’s favourite colour?What is her favourite sport to watch?What is her favourite alcoholic drink?How many car accidents has she been in?On what day of the week was Stacey born?What is Stacey’s favourite sport to play?What beverage will she not willingly drink?...

5B 2024-10-01

29 Items: manoldtalllonghaireyeswomanyoungdessertyoung mangray hairblue eyesto be hotdeliciousblack hairred-hairedbrown eyesgreen eyesto be coldyoung womanblonde hairfor dessertrich, tastygood-lookingto be sleepyshort (height)short (length)to want, to desirebrown (chestnut) hair

vocab:((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((( 2025-11-07

28 Items: manoldtalllonghairwomanyoungto wantto comedessertto orderto bringyoung mangray hairdeliciousbrown hairblack hairblond hairred-hairedto be warmto be coldrish/tastyyoung womanfor dessertgood-lookingto be sleepyshort(length)short(stature)

British slang words 2023-10-09

18 Items: FoodCrazyA manToiletA foolA womanBeverageBeing brokeA cup of teaDisagreementA younger manA British poundBeing disappointedMeaning 'isn't it'Suspicious, sketchyBeing slightly drunkTo be annoyed or unhappyDoing something in a second

Chemistry Terms 2023-05-18

20 Items: 0 kelvinUnit for massUnit for weightNo size or shapeSorts the elementsUsed in tv remotesUnit for frequencyMakes up everythingUnit for temperatureAll color you can seeThe ability to do workA fluid of a substanceAmount of matter in objectsUsually a shiny, silver rockAll the "stuff" in the universeWhen a substance changes to a gas...

English 1 Terms 2024-12-02

17 Items: __________ is the central idea___________ is a writer's attitude.The exact meaning of a word is _________.A sequence of events that make up a story.To illustrate is to show an ______________.______ is a transition for adding information.Something that stands for something is _________.Words that join other words are ________________....

Astronaut Word Search 2025-08-13

50 Items: Space where data is saved.A place to organize files.Connected to the internet.Creating software using code.The display area of a device.Not connected to the internet.A copy of data kept for safety.A portable touchscreen computer.The physical parts of a computer.Software used to access websites.Online storage for files and data....

Unit 4 word search - The Home, Jobs, Education, University 2025-12-01

49 Items: having a lot of spacesmall and comfortableto fail an exam or classa person who rents a homesmall jobs you do at homehaving no home to live ina first university degreeto travel to work and backcleaning and tasks at homea strong desire to succeedknowledge from doing a jobto join a course or schoola university qualificationthe work to improve a house...

The Gospel of Mark 2024-11-06

10 Items: Jesus' occupationA type of miracleThe Gospel of Mark is ___.Someone who is inspired by GodJesus healed a boy with _____.A weekly day of rest and worshipSomeone who Mark and Barnabas followedPlace Jesus asked his disciples to keep watchSomeone that was told to keep watch in a parableReason why the disciples would not heal the boy with demons

Culture & Capitalism 2025-11-30

10 Items: A circle of evergreenThe holiday we just celebratedAfrican American winter holidayA holiday celebrating Jesus' birthThe world's largest online retailerThe biggest shopping day of the yearThe biggest online shopping day of the yearJewish holiday known as the Festival of LightsYou might have one of these in your house (real or artificial)...

English Term 2 Exam Word Search 2025-12-15

16 Items: Loves HermiaTrouble makermarried to LindoFather of HermiaHead is a donkeyQueen of fairiesDaughter of Lindomarried to Suyuanmarried to An meiDaughter of SuyuanDaughter of An meiMarried to Ying Yingdaughter of Ying yingIn love with Lysandervery insecure and needs validationLove potioned to be in love with Helena

Geography Terms 2022-11-16

28 Items: A small streamWet spongy groundNatural elevationA small wooded hollowNarrow gorge with streamrounded hill or mountainA high steep face of rockA ring shaped coral islandA waterway dug across landA slowly moving mass of iceA steep rugged rock or cliffsmall low lying coral islandA small sheltered bay or inletA ridge of sand created by wind...

The Sun Crossword 2025-05-29

15 Items: The Sun is in the ___We need the Sun for ___The Sun is a big, hot ____The Sun gives us light and ____The Sun is made of hydrogen and ____Without the Sun, Earth would be ____.The Sun gives us light during the ____The center of the Sun is called the ____A dark spot on the Sun is called a ____.The ____ is the center of our Solar System...

A 2023-08-11

18 Items: ઓહ્મબોહરથોમસનએડિસનફર્મીડાલ્ટનચેડવિકન્યુટનફેરાડેબેકરેલક્યુરીહર્ટ્ઝકુલોમ્બપ્લાન્કરધરફોર્ડરોન્ટજેનરધરફોર્ડઆઈન્સ્ટાઈન

a 2025-10-01

17 Items: ROMAREMOTERMASRÔMULOTEATROCOLISEUPOMPEIAETRUSCOSAFRESCOSMOSAICOSREPÚBLICAMONARQUIAAQUEDUTOSPOLITEÍSTAGLADIADORESIMPERADORESESPETÁCULOS

a 2025-10-01

17 Items: ROMAREMOTERMASRÔMULOTEATROCOLISEUPOMPEIAETRUSCOSAFRESCOSMOSAICOSREPÚBLICAMONARQUIAAQUEDUTOSPOLITEÍSTAGLADIADORESIMPERADORESESPETÁCULOS

Slot P&P #5 - Paying Jackpot Winners 2024-12-09

20 Items: An alternative to cash.Handheld device used by Slots.This must be dropped in an audit box.A winners check is issued by a _______.Jackpot funds can be obtained from a _____.ID's that cannot be photocopied or scanned.Any jackpot over $1200 is considered _______.Change from a jackpot is printed on a ______....

xckm 2025-11-19

29 Items: manoldcuptalllonghaireyesmenuwomanyoungglassyoung mangray hairto be hotdeliciousto desireblack hairred-hairedgreen eyesto be coldyoung womanblonde hairgood-lookingto be sleepyshort (height)short (length)cafés brown eyesazules blue eyesbrown (chestnut) hair

great people 2024-12-23

17 Items: A person who designs.A person who writes music.Having a natural aptitude or skill.A person who weaves fabric or clothes.A person who studies or has studied philosophy.A person who works on a ship as part of the crew.A sea-going vessel that uses sails mounted on masts.A person professionally engaged in a field of engineering....

festival 2025-07-04

11 Items: DayDayNightNew YearFestivalHalloweenChristmasReveal PartyThanksgivingBoat FestivalInternational Day

Solids 2025-03-25

16 Items: a flattened 3D object.a 2D object with 6 sides.a 2D object with 8 sides.a 2D object with 3 sides.a 2D object with 5 sides.a 2D object with 10 sides.a completely round 3D objectwhere two faces meet (line).a 3D solid that has no curves.where three edges meet (point).the flat surfaces on a 3D solid._________'s Theorem uses F+V-E=2....

Roaster Word Search 2023-02-20

25 Items: a wall to distribute windflooring composed of woodenthe capacity of being prolongedmake we cand see outside or insidea place to put glass / window on ita structure like lego to build a wallhandle used to open and close a door.the lower square slab at the base of a column.the lower surface of a room, on which one may walk....

Water safety 2023-11-23

16 Items: important sea safety hintnice sea view by the seasideuse it to dry up your wet bodyprotects your head from the sunan activity we all enjoy at seais the main component of the seaa virtue you must have by the seasidethe name of a garment you wear to swimwhen ever in doubt about where to swimdangerous objects buried under the sand...

Alcohol Vocabulary 2024-12-18

20 Items: E-cigarettesWhen you stop smokingEnlarged stuffy lungsA toxic oily substanceAn electronic cigaretteA smoldering end of a productA type of e-cigarette companyRaises nervous levels severelyCauses cancer in living tissueTobacco that hasn't been burnedWhite patches on a mucous membraneWhen people exhale smoke out of it...

Sports 2025-09-09

20 Items: – Racing on bicycles– Riding waves on a board– A long-distance running race– Rough sport with an oval ball– Kicking a ball into a goal net– Hitting a ball over a high net– Fighting with gloves in a ring– Sport done in a pool or the sea– Played with rackets across a net– Hitting a small ball into a hole– Sliding down snow-covered slopes...

ways to pay 2025-12-04

8 Items: allows payments to be delayeda written order to make a specific paymentnotes and coins in a wide range of denominationsdirect payment5 from one bank account to anotherpayments being deducted directly from a current accountan agreement with the bank allowing transfers of a set amount to a 3rd party on a regular basis...

Pathophysiology Word Search 2025-01-21

20 Items: The physiology of abnormal states.A subjective indication of a disease.The study of the tissues of organisms.The science of causes, esp. of disease.The production and development of disease.a sudden worsening or flare-up of a chronic disease.The study of how disease spreads and can be controlled....

ACP Final 2025-05-28

20 Items: - An algebraic expression of three terms.- The number in front of the variable or term.- An expression of two or more algebraic terms.- The set of all possible inputs for a function.- A function that serves to “undo” another function.- A equation that can be rearranged in standard form.- Any mathematical expression which uses a root symbol....