incl some with Word Searches

Z Fun Word Search: Exploring Words with Z 2025-03-15

10 Items: ZooZeroZoneZoomZebraZebraZipperZigzagZenithZucchini

Parts of a Computer 2024-10-26

17 Items: The hard disk drive.gives the computer powerstores data not being used.also known as the audio card.Also known as volatile memory.port for using USB accessoriescamera attached to the monitor.displays the video, image, and text.often called "the brain" of the computer.cord to connect the computer to ethernet....

Loving Word Search 2023-03-09

56 Items: kindtinysweethappygracepickyproudwittylovingbrightcaringstrongbeautydirecthonestsocialspunkygenuinesincerecheerfulgenerousadorabledecisivegratefulprincessstubbornvaluablebeautifulresilientwelcomingchristiandedicatedvivaciousthoughtfulpersistentdependableempatheticparticularsupportivesweetheartgregariousrespectfulintelligentconsiderategrandmother...

ㅇㅇ 2025-04-16

24 Items: bedtreesofagardengaragewindowkitchento livebasementapartmenttownhousestudy roomtelevisionliving roomto be cleanto be dirtysingle housedining tableto be spaciouswardrobe, closetbookshelf, bookcaseto be narrow, smallroom with heated floortraditional Korean house

Unit 1 Vocabulary 2025-07-17

6 Items: to work togetherto issue an orderwise saying, proverbsudden profit or gaina fortress that overlooks a citylacking politeness, difficult to work with

Far East of Europe 2025-06-14

12 Items: A Manchu pigtailJapanese dwarf treesA people group from Manchuria, ChinaCatholic missionaries that came to JapanThe first shogun of the Tokugawa dynastyThe son of Ieyasu who became the Tokugawa shogunHidetada's son who became shogun and closed JapanMost Japanese people believed in this kind of religion...

Assessments and teaching 2023-12-01

21 Items: any curriculum not included in classroom discussioncurriculum that is formally written and tested in the classroomcurriculum that has been implemented into classrooms but not explicitly taughta set of teaching behaviors that have been validated in research such as direct instruction...

El Capibara con Botas 2024-05-07

15 Items: treeboatbootssharkwebbedhe hasblowpipethey escapehe/she spitscapital of Ecuadorlas montañas en Ecuadorla selva más grande del mundoislands off the coast of EcuadorCarlos necesita plantar las ______.the region of Ecuador with the Pacific to the east

The Secret Garden pgs. 89-95 2023-10-11

15 Items: He was ______ with live.What did Colin stop doing?What did Colin start to do?Whose arms did Colin run into?Where did Archibald go to find Colin?No other people are _______ to go near.What season did the garden change again?Where did Colin sit under with his father?How long has nobody been in the garden for?...

Percy Jackson Vocab Word Search 2025-03-05

15 Items: To move slowly.A search or hunt.A change of form.To go against orders.To not show respect;Rude.In a risky or dangerous way.To break into small parts or bits.Abandoned with little hope of rescue.A person who wanders from place to place.A road mixture with gravel and crushed rock.To become real or actual, especially suddenly....

Percy jackson 2025-03-05

15 Items: To move slowlyA search or huntA change of formTo go against ordersTo become real suddenlyTo not show proper respectIn a risky or dangerous wayTo break away in small piecesAbandoned with little hope of rescueA person who wanders from place to placeA road mixture with gravel and crushed rockA silly belief arising from ignorance or fear...

"PCT Practice Makes Perfect!" 2025-04-24

15 Items: Collecting urine for analysisAssisting a patient to walk safelyCollecting a sample for fecal testingChanging a patient's position every two hoursRemoving protective equipment after patient careThe process of drawing blood for testing or donationPutting on protective equipment before patient contact...

The traits of successful young entrepreneurs 2024-01-02

8 Items: Being able to come up with new and creative ideasUnderstanding how to use and spend resources wiselyContinuing in a certain action in spite of obstaclesHaving the ability to inspire others behind a central visionBeing able to have mutually beneficial interactions with peopleUsing this skill they derive what's true without conscious learning...

Sweet Tooth Treats 2025-05-30

5 Items: A hard, sweet candy on a stick that you lick and enjoy slowly—often round and colorful.A sweet treat made from roasted cocoa beans—can be eaten as bars or used in cakes and drinks.A soft, baked snack that looks like a small cake—can be sweet with fruits or chocolate chips....

OO 2024-12-03

27 Items: Wedding month?Groom's college?Bride's college?Best Man's name?Groom's fraternity?Bride's birth month?Groom's birth month?Groom's middle name?Bride's middle name?Maid of Honor's name?Month that Taylor proposed?Bride & Groom's zodiac sign?Game the couple loves to play?Couple's favorite sushi restaurant?Taylor proposed by the ______ patch?...

vocab for november 2025-11-12

25 Items: HateAngryDetailedInfamouscheerful; geniala very poor person.Masked ball, disguiseshow or prove somethingharm someone permanentlystrong sense of facinasionA temporary fail in thoughtObstruct someone or somethingCombine one thing with anotherlacking in quantity or qualityconfidence of a person or groupDisfigure or injure beyond repair...

M. Tody Hiroshima Word Search 2025-05-28

13 Items: Gave Mr. Fukai a piggy backMrs. Nakamura's oldest childThe youngest of the 6 survivorsWhere Dr. Sasaki's mother livedWorked at the Red Cross HospitalThe city that was bombed after HiroshimaRan back into the fire out of survivor guiltOwned his own Private, single doctor hospitalThe name of Toshio's hero, who died in the bombing...

POSTIES 0729 COVER 2024-06-26

6 Items: another word for "smartphone"The Yellow Crane Tower is located in _____.a formal talk that someone gives to a group of peopleIBEL helps disadvantaged ethnic minority students learn ______ after school.a building where you can look at important objects connected with art, history, or science...

Love and Relationships 2024-02-10

15 Items: When we two partedThe rain set early in to-nightThe clouds had given their allWe stood by a pond that winter dayThree summers since I chose a maidI run just one ov my daddy's shopsThe fountains mingle with the riverMy father worked with a horse-ploughIt is eighteen years ago, almost to the dayI think of thee!—my thoughts do twine and bud...

Mental Health Crossword 2024-02-21

15 Items: A cause of stress.Causes extreme mood swings.The act of harming ones self.Way to take a break from feelings.The act of causing ones own death.A feeling of fear, uneasiness, or dread.Expression or release of strong emotions.The reactions on what to do when stressed.Emotional, physiological, and social well-being....

Control+F 2025-07-24

15 Items: The brain inside the boxIt holds data in a programFixing mistakes in a programSomeone who breaks into computersA rule that decides what happens nextRepeats a set of actions again and againIt mixes numbers with ABCs, and 16 is the keyClear thinking used to solve problems in codingThe main screen you see when the computer starts...

Abe's 2025 Hyperfixations 2025-12-01

15 Items: Do NOT open!!El Sabor de Puerto Rico.Our go-to home fragrance.Best paired with a glass of milk.You go through 3 boxes of these a week.World's first dynamic and ergonomic chair.Passtime that is both peaceful and dangerous.It's the ultimate all-out warfare experience.Kiki's favorite bonding activity and passtime....

S 2024-04-09

19 Items: (mystery)(peculiar)(watchful)(captivating)(proper manners)(group of stars)(sad and pensive)(theatrical dance)(science of sound)(calm and peaceful)(related to horses)(related to cooking)(sentimental longing)(art of good cooking)(lively and energetic)(complex musical piece)(ability to bounce back)(study of celestial bodies)...

Potassium and Chloride 2025-01-11

10 Items: musclesheartbeatelectrolyteFood with 926mg of K_______ acid in the stomach.The state of being chloride deficient.The state of being potassium deficient.The anion that maintains fluid balance.The cation that maintains fluid balance.The organ that controls blood potassium.

Week 3 Greek Roots 2025-09-09

10 Items: join or withoverly criticaloverly dramaticnothing is therenot crazy or energetichigh blood sugar levelsto plan together in secretoverheating body temperaturehaving two different colored eyestwo or more words sounding the same

Theme Park Fun! 2023-02-07

10 Items: - a sweet treat made of spun sugar- a Disney cartoon character with black ears- circular ride where you can get great views- a theme park attraction where you might get wet- feature at EPCOT centre using a single train track- a cabinet with staff who allow you to pay your entry fee- this theme park is known as 'The Happiest Place on Earth'...

Personality Disorders 2024-08-06

10 Items: arrogance, the need for consistent admirationinstability of affect, identity, and relationshipsemotional detachment, disinterest in close relationshipsdistrust and suspiciousness toward others based on unfounded beliefsdisregard for others, lack of empathy, fails to accept responsibility...

Things in a Peranakan Home. 2025-02-02

10 Items: A traditional oil lamp with colourful ceramic designs.A brooch set typically used to fasten traditional attire.An elaborately carved dining table often used for feasts.A decorative cover made from woven rattan to shield food.A porcelain water container typically found near doorways.A beautifully carved wooden divider, often placed in entrances....

Chapter 47 2025-11-29

10 Items: EarwaxDizzinessThe absence of sightDecreased hearing ability due to agingA ringing, roaring, hissing, or buzzing sound in the ears or headThe total or partial loss of the ability to use or understand languageloss Not being able to hear the range of sounds associated with normal hearing...

Debt Treatments 2025-04-29

15 Items: What must be included in the budget calculation when reporting to the credit bureau?Medical and utility collections are examples of what type of records to be reviewed?A review of this document is necessary to ensure the NDI analysis includes all debts.If the customer is a renter, what amount must be entered into the monthly rent field?...

CHAPTER 5 2025-05-07

212 Items: TĨNHĐỘNGBỔ-TỐVỊ-NGỮCỐ-HỮU“TALL”TỪ-NỐITÍNH-TỪHẬU-NGỮSTATIVEDYNAMICADVERBSINHERENTGRADABLE“ATOMIC”TRẠNG-TỪADJUNCTSSOME-HAVETHUỘC-NGỮNHẤN-MẠNHTĨNH/ĐỘNG“CAREFUL”CANNOT-BEADVERBIALTRẠNG-NGỮDISJUNCTSCONJUNCTSMODIFIERSINTENSIFYADJECTIVESAMPLIFIERSKHUẾCH-ĐẠIOF-ADVERBSPROPERTIESLIKE-“-OUS”ATTRIBUTIVEPREDICATIVECỤM-TÍNH-TỪNONINHERENTEMPHASIZERSVERY-“TALL”...

Electronic Vocab Puzzle 2022-10-05

64 Items: vision.people.disease.emotions.medicines.wellbeing.clarification.and adversity.or opposite thing.excreted through urine.and personal fulfillment.functions such as hair growth.and becomes insulin resistant.Values: Ideas one regards highly.Criteria: A defining characteristic.This can cause a heart attack or stroke....

Ch.4-6 Vocab 2024-11-19

10 Items: A great sizeExtremely steepstrong and healthyDeprived or lackingLoosely made; ShakyTurned aside; DetouredMysterious;extraordinaryTo explode with a loud noiseWent at a slow pace; strolledA figure or speech meaning something that's contradictory

Module 4 Week 1 2025-10-15

10 Items: - Continuing to try even when things are hard.- To work together with others to reach a goal.- A large, flat area of grassland with few trees.- The order in which things happen or are arranged.- Clues or details that help prove something is true.- To separate grain from the plant, usually by beating....

A Changing American Culture 2025-05-19

9 Items: To carryRequired as by lawThe speech and habits of a particular regionA new kind of music with a lively rhythmic soundA residential area on or near the outskirts of a cityA group of writers who tried to show the harsh side of life as it wasA tall building with many floors supported by a lightweight steel frame...

National Bison Month Word Search 2025-07-14

10 Items: A baby bisonU.S. park where bison roamThe natural habitat for bisonThe national mammal of the U.S.Group of bison traveling togetherConservation status in some regionsDescribes bison's origin in North AmericaThis month celebrates the bison as a national symbolYou need this legal term to enter a protected bison habitat...

Morrin Centre Word Search 2025-10-17

10 Items: Taxidermied bird in the cabinetThe cabinet contains a _________ setSmall animals collected in the cabinetYou'll find some in our rock collectionOur collection contains blocks of _______What the room in the far corner was used forThe _______ and historical society of QuebecScientific tool used to observe very small objects...

A Dude Who Plays Roblox, Minecraft, and Among Us with his friends 2025-04-26

25 Items: ZudModsYellFansHackPatPMemeFunnyRobuxTrollHenwyLoafXSussySigilsSSundeeLookumzRussellDiscordNicovaldImposterAllianceSabotageSkyFactoryLuckyBlockBiffleWiffle

Christmas 🎅 🌲 season of Your with off love and friends family 2025-11-30

20 Items: SoupSantaUnclePartyfriendFamilyAuntieSausageNewyaerTogethericecreamCokeZeroChristmasVegetablePepsimaxiCheesecakeGinandtroneMinioffnightChristmastreeSessionoffyaer

Memory Game 2024-11-13

15 Items: store specializes in visual and spatial informationmemory stores auditory information coming from the earswhich memories become fixed and stable in long-term memorythe repetition of information that has entered short-term memoryThe initial, momentary storage of information, lasting only an instant...

C.hristmas W.ordsearch 2022-12-16

7 Items: Makes your toysPresents go under itGoes under your treePulls Santa's SleighYou make it with snowA Christmas song writerSomeone who brings gifts on Christmas Night

Cowboy Word Search 2025-02-11

10 Items: A man who herds cattle and rides horsesA bar or tavern, often in a western townA criminal, often a fugitive from the lawA law enforcement officer in a western townA battle involving firearms, common in western storiesA large farm where cattle or other livestock are raisedThe Native American tribes that lived in the Western United States...

Storytelling Vocabulary 2025-04-14

10 Items: IMAGINE : To form a picture or idea in your mind.MAGICAL : Related to magic, having special powers.VILLAIN : A character who opposes the hero in a story.EXPLORE : To travel or search for something new or unknown.ADVENTURE : A journey with exciting or dangerous experiences.MYSTERY : Something that is difficult to understand or solve....

The Source Word Search 2024-11-06

15 Items: The number of counter checks per sheetThe last name of our Financial AdvisorThis DDA type has no minimum balance requirementsThis DDA type comes with a free Platinum Visa Debit CardThe number of months a savings account can be dormant before getting feesThis DDA type requires a $500 monthly electronic deposit to avoid service charges...

LD New Claim 2025-06-24

17 Items: Loss Date goes in the ___ ___ note.Regular mail could take 8-10 ___ days.Check the ___ ___ page to determine if the loan type.In step #6, after linking to IIM we click Creat & __ __ __.If the caller does not have a loan #, what system can you use to find it?Where in the Module do you go to begin the process of opening a new claim?...

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

Chapter 11 2023-11-21

9 Items: Any group with which an individual does not identifyThe group with which an individual identifies as a memberAny act performed with the goal of benefiting another personThe desire to help another person even if it involves a cost to the helperThe idea that behaviors that help a genetic relative are favored by natural selection...

CV Aging Cl 5 2024-12-09

15 Items: Reestablishes blood flowOcculsion of LAD leading to MIRoto router of coronary vesselsAbbre for Coronary Artery Bypass GraftTroponin levels establish myocyte injuryDamage to all levels of the heart muscleCombines PCI and CABG to improve outcomesLack of adequate oxygen for cell metabolismSupply a list of these if you come to the ED...

Percy Jackson Chapter 13 Vocab. Word Search 2025-03-06

15 Items: To move slowlyA search or huntA change of formTo go against ordersIn a risky or dangerous wayTo not show proper respect; rudeTo break into small parts or bitsAbandoned with little hope of rescueA person who wanders from place to placeA road mixture with gravel and crushed rockA silly belief arising from ignorance or fear...

Technical words - 4 2025-06-20

15 Items: mode UI theme with a dark backgroundgrid Layout based on columns and rowsThe main or landing page of a websiteModern web architecture (JS, APIs, Markup)3.0 Decentralized and blockchain-based webCloud-based functions with no visible serversContinuous Integration / Continuous DeploymentPractices combining development and operations...

Chapter 6 2024-10-19

10 Items: concept maptext variationLooking up dataTesting someonechoose any stylesave as a range of filestells a device what to dospelling or grammar checkbuilding an image with layersElements or structure of something

Rain Word Search 2025-07-31

5 Items: Not in dangerVery powerfulWater falling from the skyWhat happens when something breaksA loud weather event with wind and thunder

Unit 1 Week 1&2 2025-08-18

8 Items: Move to one sideScamper or runs quicklyBeg or argue to get what you wantThe way we speak, read, write or signTreat someone in a just and honest wayAsk someone to go some where or do somethingSharing the same way of life at the same timeGive part of something you have to someone else

Matt and Grace's Love Story 2025-02-04

17 Items: Matt's specialty homemade dishThe couple's beloved furry companionMatt's new title for outdoor cookingSchool where Grace is pursuing her MBAWhere their story began on a muddy dayEssential morning ritual for the coupleProfession shared by both Grace and MattWhere Grace and Matt moved to live togetherFavorite game to play with Dakota at the park...

De paseo por mi ciudad I 2023-12-05

9 Items: next weekdance in the clubto visit monumentsI am going to dancego out with friendsI am going to danceI am going to visitI am going to go outYou go to travel by train

Chapters 5-6 Vocabulary 2025-01-29

13 Items: sulky or gloomywith little or no delaya wicked or cruel personhaving or showing persistenceshowing annoyance at unfair treatmentabsolutely necessary, important, or essentialLorelai _____ over when she saw Cody Johnson.The answer _____ Will when the teacher called on him in class.Mason _____ asked Chevi to go to the movies with him Friday night....

LD New Claim 2024-08-01

17 Items: Loss Date goes in the ___ ___ note.Regular mail could take 8-10 ___ days.Check the ___ ___ page to determine if the loan type.In step #6, after linking to IIM we click Creat & __ __ __.If the caller does not have a loan #, what system can you use to find it?Where in the Module do you go to begin the process of opening a new claim?...

Leadership and Teamwork 2025-04-14

10 Items: Delegation : Assigning responsibility or authority to another person.Collaboration : Working together with others to achieve a shared goal.Empathy : The ability to understand and share the feelings of another.Negotiation : A discussion aimed at reaching an agreement or compromise....

Prefixes "dys" & "eu" & Suffixes "ia" and "archy" 2025-09-09

10 Items: an ideal or perfect societyimpaired or abnormal functioninga speech praising someone who has diedthe absence or non-recognition of authority.A form of government with a monarch at the head.taking a life as an act of mercy in a painless wayA feeling or state of intense excitement and happiness....

With each mindful breath, you embrace the fullness of your being. 2024-01-09

15 Items: renewinhaleexhalebreathebalancepresentessencefullnessabundantradianceflourishconsciousgratitudewellbeingwholehearted

I treat myself with the same kindness I offer to others 2024-01-15

15 Items: caringlovingempathysincerealtruismpatiencesympathyaffectionnurturinggenerosityrespectfulsupportivethoughtfulconsiderationtenderhearted

I treat myself with the same kindness I offer to others 2023-09-05

15 Items: showcareequalextendequallyexhibitkindnesspracticenurturingcompassionconsistentdemonstratebenevolenceunderstandingconsideration

Practice Task 2024-10-12

5 Items: The wife of a king or a female monarch.Food made of flour, water, and yeast mixed together and baked.The faculty by which the mind stores, retains, and recalls information.A cold-blooded vertebrate animal that lives in water and has gills and fins.A small, wooden, stringed musical instrument with four strings, played with a bow or by plucking.

Mental Illnesses 2024-07-18

7 Items: Develops after experiencing or witnessing a traumatic event.Intense worry or fear that interferes with daily activities and life.A mood disorder characterized by persistent sadness and loss of interest.A severe mental disorder that distorts thinking, perception, and emotions....

Spelling List: An Hour with Abuelo and Barrio Boy 2016-03-10

10 Items: Donsuiteabuelobarrioorderlyparchmentwitheringammunitionformidableembroidered

Search for the word associated with the word telephone 2023-01-30

10 Items: calldialsoundsignalringingspeakerreceiveroperatorconversationcommunication

unit 16 2024-04-24

12 Items: roughnot bendingto get alongextinct animalto stuff tightlycapable of growingto take upon oneselfsomething that protectsan action that is wrongto supply with furniturea person of the same ageto expose to injury or harm

Medical Marijuana Use 2024-04-03

16 Items: who we're trying to convinceclass 1 federally illegal substancea negative social view on somethingdefining aspect of the nurse leader rolevital to achieve optimal patient outcomes37 states and 4 territories have done thisworking between teams towards a common goalsomething HCP and patients need about this topic...

Unit 2 Review 2023-12-19

10 Items: Push or Pullyour mass plus GravityUnit to measure force(N)How much "stuff" you are made ofsomething you can build with snowForce that pulls things down to eartha tendency to remain unchanged and has a direct relationship with massFor every action (force) in nature there is an equal and opposite reaction....

Glossary 2024-11-11

15 Items: Lower than the  adjoining land.Raised, flat ground, higher than plains.A natural feature of the earth's surface.Heigh above a given level, especially sea level.Natural elevation, make mountain ranges when aligned.The tidal mouth of a large river, where the tide meets the streamBroad, flat, low-lying areas, no higher than 200 m above sea level....

emotions word search 2025-06-11

18 Items: most people are ...what people say when there cryingmarried people feel this for each othera feeling of worry, unease, or nervousnessmost people feel thins when they see a spidermost people feel this when a good thing happensmost siblings feel this when they get into an argumentpeople feel this when they see or hear something grows...

Word Search Puzzle - Newsletter Vol 27 2022-12-06

7 Items: Algorithm that power machine learningMicrosoft partnered with NVIDIA to build a ______Laboratory in Switzerland known for particle-physics researchTo build a cloud based supercomputer Microsoft partnered with ______ in 2019Structure in the shape of a triangular lattice made of individually programmable beams...

President Jefferson 2025-02-11

15 Items: Jefferson's home.Jefferson's Secretary of StateJefferson served for _____terms.Jefferson was the primary author.Jefferson's first Vice President.A midnight judge appointee of Adams.Territory Doubled the size of the U.S.Powers NOT written in the Constitution.He voted for Jefferson instead of Burr.Jefferson ______the Alien & Sedition Acts....

Vocab List 2 - Palyn Sansom 2025-10-31

19 Items: to runto skito singto drawto swimto workto danceto skateto write musicto skate boardto play sportsto play sportsto go to schoolto write storiesto read magazinesto ride a bicycleto play video gamesto talk on the phoneto spend time with friends

Cooking verbs 2024-02-08

11 Items: These _____ super well.Make sure to not ____ the toasts.My mom ______ a apple pie for me.Those _____vegetables were amazing.Make sure you _____ the soup regulary.Let the water _____ until it evaporates.You need to _____ the chicken for 20 minutes.The beef must ______ for no less than an hour.Put the leftovers in the freezer so they _______....

Posties 0101 Cover 2023-12-08

6 Items: a type of pumpkin soup that Haitians eatbeing successful and having a lot of moneyused to describe something that is very bad and harmfulPeople in America watch a _____ drop to celebrate the new year.a sequence of numbers said in reverse order, marking the time remaining until a specific event...

Verbs - phần 1 2025-05-22

16 Items: Begin to do something.Move your body to music.Reach the place you are going to.Look at and understand written words.Pay attention to sounds with your ears.Relax or do nothing to get energy back.Show happiness on your face without sound.Move your body to stay healthy and strong.Make a happy sound when something is funny....

Sample 2025-04-02

3 Items: time with benefitand distract yourselfan extra boost of positive energy

Electronic Vocab Puzzle 2022-10-05

35 Items: and personal fulfillment.Ideas one regards highly.A defining characteristic.Waiting until the last minute to do something.Person sending the message in verbal communication.Person receiving the message in verbal communication.The body’s natural response to any demand or pressure.Convictions individuals hold, without proof or evidence....

FFA CREED PARAGRAPH ONE 2025-12-05

9 Items: Ioffaithin thewith ain thewe now enjoy have comeof better days through better ways, even as the betternot of words but of deeds- achievements won by the present and past generations of

School 2020-11-30

72 Items: catdognotteatenrunfunbigsunfoxcowjimlionpenstimewithsaidmilknoonmoonwolfgolfkiwidocsnotszebrahippomathsbookspaperbikesbreakfruithorsetrackafterclassdriveanimalinsideplayedchromeminutepeoplehitingsitingpersonaroundgooglewritingreadingmoaningteacherarguingplayingoutsidepencilsmorningfriendscartonsrunningchickenstudentelephantlearningfightinglistening...

Filmamos en el Mercado 2023-03-05

25 Items: woodgoldmetalstonesilverceramicleathergo aheadhandmadethe goodsa bargainexcuse memay I seeforgive methe paintingthe portraitthe sculpturewith pleasureto be made ofyou're welcomedon't mention itfine (masculine)unigue (masculine)excuse me; I'm sorryinexpensive (feminine)

3A Vocab 2024-03-04

28 Items: teamilkwithnevercoffeeto eatalwaysI loveI likeRight?withoutlemonadeiced teato drinkto shareeverydayyou loveyou likeof coursesoft drinkfood, mealHow awful!apple juiceorange juiceWhich? What?more or lessto understanddrink/beverage

T.L.E word search 2025-02-03

25 Items: OVENSlICERGRILLSSPATULASCISSORSCHILLERSDELIKNIFECANOPENERCHEFKNIVESPARINGKNIFEBUTTERKNIFEMIXINGSPOONUTILITYTRAYBREADTOASTERCUTTINGBOARDLETTUCEKNIFESANDWICHKNIFESERRATEDKNIFECOOKIECUTTERSMEASURINGSPOONSANDWICHSPATULAused to separate liquid from solidbowls that are large enough to hold ingredients while they are being mixed...

1A Spanish Vocab 2025-10-29

19 Items: to runto skito singto drawto swimto workto danceto skateto skateboardto skateboardto play sportsto go to schoolto write storiesto read magazinesto listen to musicto play the guitarto play video gamesto talk on the phoneto spend time with friends

Basic Level Tuhfatul Atfaal Wordsearch 2025-02-28

11 Items: a noon without a vowel is called noon__The author calls the letters ع and ح with no dots_______without ghunnah, only happens with the letters ل and رthe______of idgham in the mushaf is a noon without any marks or a staggered tanween.means to be clear. It means to say every letter clearly without an extra nasal sound....

Word Search 2025-05-06

16 Items: Cheer or consoleAssociated as a memberAgreement or conformityTo live in peace with each otherCharacterized by friendly goodwillA settlement of differences by consentUnaware or uninformed self-satisfactionIs a conversational exchange or dialogueTo recognize the rights, status or authorityA state of freedom from emotional disturbance...

C3 Revision 2025-10-01

16 Items: Test for hydrogen gasTest for carbon dioxideThe rows in the periodic tableSpeeds up the rate of a reactionThe columns in the periodic tableMade by reacting metal and oxygenSubstance made of only one type of atomGas produced when a metal reacts with acidsalt produced when hydrochloric acid is usedThe side of the period table containing metals...

Holidays Around the USA 2023-12-08

15 Items: A cookie made with molasses and ginger.A festive song or hymn sung at Christmas.A Spanish phrase meaning “Happy Christmas.”A grouchy spoilsport who doesn’t enjoy Christmas.A nine-branched candelabrum used during Hanukkah.A small, decorative sphere hung from a Christmas tree.A candle holder for the seven candles lit during Kwanzaa....

Spelling List C-26: Words with /ie/ /ei/ /ai/ /ia/ 2024-05-21

12 Items: saidweightdeceivebelievefailureceilingachievehygienepatiencemarriagefriendshipneighborhood

Criminal Thinking Errors 2025-07-01

15 Items: A criminal thinking error that shows a failure to follow through with commitments and intentions.A behavior of criminality that displays a lack of accountability for one's actions or obligations.A positive attitude of being thankful or having a readiness to show appreciation for and to return kindness....

3B 0725 2022-07-23

39 Items: unsafea rocka truckon all sidesthink of againcovered with snowcautious in one’s actionsto get pleasure from somethingthe process of doing somethinga bird that loves stealing thingsto produce leaves to begin to grownot containing any things or peopleone of the four periods of the yearto take something without permission of the owner...

Tyree- Honors Engglish 9/10 2025-04-10

30 Items: nothingstrong,healthysharp- painful- points of timearoused; excitedsuffer ill health- steadily lessening- hints; suggestionsmotionless; inactivedisposed to seek revengediscredited or disgracedfrom moral impurity; puretimorous uncertain agitationgroup; secret faction; cliquedeny;ignore; pretend not to seeaffected by witchcraft; in a spell...

NATP Chapter 14 2025-04-09

22 Items: Heart relaxesSlow breathingRapid breathingHeart is at workNormal breathingDifficulty breathingInhaling air into lungsThe absence of breathingExhaling air out of lungsUsed to measure temperatureWarm soak of the perineal areaUsed to measure blood pressureConsistently low blood pressureConsistently high blood pressure...

LOGANS ANIMAL SEARCH 2025-07-27

25 Items: Has a trunkStriped horseLargest sharkMom is allergicMan's Best friendMeans water horseKing of the junglePo from Kung Fu PandaThe biggest type of bearType of x man named Loganshark Fastest type of sharkBowser is this kind of animalReptile that can change colorsThe only mammal that lays eggsShark with strongest bite force...

Ahola Word Search 2025-10-23

34 Items: Remy's MomEnjoys animeFormer bikerMrs. MuffinsWorked at IBMFormer teacherLoves year end!Really likes catsHas an orange catOwns a food truckObsessed with golfDie hard Disney fanHer son attends JCUEnjoys highland cowsLoves to go to playsFather-Daughter teamUsed to be a stylistOwns a yellow MustangAhola's resident bakerRuns 5ks with his wife...