incl some with Word Searches

what,s the matter with ben 2 2023-02-14

10 Items: amazedsensinglaughedtouchecmessagebalancepractisemovementblinkingbreathing

WORDS WITH 'e-e' AND 'i-e' 2020-01-24

10 Items: Eveliketimeminefivethesethemeshineeveningcomplete

Words with o-e and u-e 2020-02-07

10 Items: usehomecubehugecutetunequeuestolethronebarbecue

Spelling Long i with /ey/ or /y/ 2025-03-07

10 Items: keynearbumpypuppyfunnypennysandyfoundwouldwrite

1G words 2022-10-21

60 Items: iaittobemyatisofdoinupmegoamonnoanweshewhyseebighadforyesandyoutheallwhoarethewasonehascangetlikedownlookwantlovethatwithcomesaidlotsthistheywantherelivewentwillhavetherecan'twherelittle

1G words 2022-10-21

60 Items: iaittobemyatisofdoinupmegoamonnoanweshewhyseebighadforyesandyoutheallwhoarethewasonehascangetlikedownlookwantlovethatwithcomesaidlotsthistheywantherelivewentwillhavetherecan'twherelittle

3A 2024-11-21

27 Items: teamilkwithtoeatneveriloveilikealwaysRight?icedteatodrinktoshareyouloveyoulikewithoutlemonadeeverydayofcoursesoftdrinkfood,meathowawful!applejuicemoreorlessorangejuiceWhich?What?tounderstanddrink/beverage

Wortsuchsel 9.2 2025-03-23

24 Items: hamfishbaconapplefruitbananacarrotpotatocherryorangetomatograpessausagecabbageblueberryvegetableraspberrystrawberrychicken meatbutcher shopsalad, lettucepear, lightbulbTurkey (cold cut)pita with shaved meat and veggies

HFW 2025-09-23

56 Items: aIamathetowemyupdoofhadseethewasandforoneshearebuytooyououreatwhohowoutputdayflygoodmadelikethisfindjustmanythensaidwilllivewhatwithyourmakelooktheyhavefirstwritewantsabouttakeseverylittle

CUSTOMER CARE WEEK 2025-10-06

40 Items: OWLCCRAPPUMOCARDPLANHMISDESKFAREMERITALERTCHANGEVALUESDETOURACUMENPICKUPVEHICLEPLANNERCAPPINGFOCUSEDTEAMWORKINCIDENTPLANNINGOPERATORSCHEDULEASSURANCESTATEMENTMETRORAILBIKESHAREMANAGEMENTENGAGEMENTRELOADABLEOPERATIONSLEADERSHIPOF CONDUCTPARATRANSITCOMMUNICATEWITH PURPOSEFUNDAMENTALSACCESSIBILITY

His Word Search 2025-10-19

61 Items: hisheryouandthebighashimusesaycarcowtoyboyyourwantwhatwithlookdownfaststarparkfarmgirlbirdcoinsoilpullbookfootbushdrawwalkballtallroarforkballhairsmallnursemousebrownhouseprawnsaucewaterhorseboardwatersharechairlittlepurplesisterdoctoraugustsquareteachertractor

Unit 5 Vocabulary Words - Hard Mode 2025-03-21

12 Items: to gather togetherpriority, or first importanceto change or add to a law or documentto bring goods into one country from anotherto intrude on someone’s rights or possessionsthe act of doing what is expected or what is ordered by lawa person who worked to end slavery during the 1700s and 1800s...

Tertiaryeducation Word Search 2023-07-12

12 Items: fencebookwormDiciplineis go crazySkipp lessonsHas five cornersHas four cornerssynonym of stupidIn relaxed mannersynonym of higher educationSpiritually commune with deadPlace for living for students

Sight Word Search! Jan. 23, 2023 2023-01-23

59 Items: iitanmedouptobyheammybenoatisgoussotwohadranputhasareseemanlotyounotcantenthewasdidsheherhimbutandforbuesitszerofourlookwantfivewithdownwillthreegreenmondaypurpleyelloworangetuesdaysaturdaywednesday

3A List 2025-03-11

23 Items: hamwitheggswaterlunchsaladcoffeecerealto eatcookieto drinkbeverageto sharefood/mealbreakfastfor lunchhamburgerwhich/whatfruit saladapple juicestrawberriesto understandfor breakfast

Goforgod Word Search 2025-05-15

20 Items: lunchattirehusbandgrandpahome towngrandchildschool rolechurch mottoclass taughtwhereʻs my..eldest childathletic leaguefavorite numberinstrument playedathletic team namelaw school studentlearner expectationweekly Bible triviaschool abbreviationstart everything with

Scars Word Search 2025-09-15

60 Items: Iamyhetosomehesoatinonyouhowgotwasandoneoffthenotbitherputknowgoesthangetslikethatsays“whywithfacewannathesescarsfiendnightusualmommyknifetakeswhileturnscomesblademouthlet’ssmilefatherdefenddrinkercrazierkitchenherselfdoesn’twatchinglaughingserious”

DB1 Lessojn 16 phonic and sight words 2025-10-19

61 Items: hisheryouandthebighashimusesaycarcowtoyboyyourwantwhatwithlookdownfaststarparkfarmgirlbirdcoinsoilpullbookfootbushdrawwalkballtallroarforkballhairsmallnursemousebrownhouseprawnsaucewaterhorseboardwatersharechairlittlepurplesisterdoctoraugustsquareteachertractor

sleighride 2025-11-06

57 Items: aonisweupofbeusortooforyoutheandareyoohooOurtwojusthearringComeit’sridewithsnownicerosycozyliketakeroadsingthosebellscomfyWe’rebirdswouldLet’ssleightinglelovelycheeksbeforechorusweatherOutsidefallingfriendscallingfeatherjinglingtinglingtogethersnuggled

Unit 3 2025-09-12

13 Items: (adj.): filled up with.(verb): to use up; waste.(verb): to confuse and frustrate.(verb): to put into action; execute.(verb): to get in the way of, hinder.(verb): To not do something; refrain.(adj.): stubbornly persistent; determined.language, we usually get along pretty well.(noun): A group that attends an important person....

Words with ch, sh,th and wh 2020-11-03

10 Items: shedwhipchimpbenchwhisklunchbrushshelfthinkcloth

Things that have to do with hockey! 2023-04-18

10 Items: pondpuckteamshotboysgirlsscoregoaliehurricaneslightenings

Enhance your life with mindfulness and meditation 2024-03-02

10 Items: nowfocusenhancebreatheserenitymeditationexperiencemindfulnesstranquilityconsciousness

Live in harmony with nature for peace 2024-03-02

10 Items: lifeexistpeacenatureplanetharmonyprotectecosystemsustainablesustainability

Countries by Number of Adults with Diabtes 2024-08-15

10 Items: USAChinaIndiaJapanEgyptBrazilMexicoPakistanIndonesiaBangladesh

Big Fan Of This stufg 2025-11-08

11 Items: CarmenNightsCrows or...Exit or StudioMonster monsterMade for solvingFriendship is MagicMy favorite musicalMy "favorite" musicalMy 12 year relationshipSomething to build with

Edna Word Search 2025-10-03

16 Items: mumEdnaCowboysteacherEdna OCEdna DCHomecomingEdna OL CoachEdna DE CoachEdna DB CoachEdna RB CoachEdna DT CoachEdna head coachEdna Corner CoachEdna Head Baseball CoachCoach with the best hair

Python 1 WS 2025-10-05

15 Items: programA container for a valueA whole number or zero with a signthis looks like one dot above anotherrules that define the way code must be writtenrules that define the way code must be writtenthe number system used by most modern computersan error in a program that needs to be correctedin single form it looks like ' in double form like "...

players with the most World Cups played part 3 2024-08-01

16 Items: cafupeledinozoffseppmaierlevyashinoliverkahndariosimicdeniscanizamarcwilmotsmariokempespaolomaldinirobertobaggiodiegomaradonafernandohierrorobertosensiniandonizubizarreta

ISWARAN THE STORY TELLER 2024-08-01

9 Items: hugedraggedisolatedstretch outtalking quietlyimitating someonewithout complainingto present to the minda person who works with, and tends an elephant.

trs23 3b w14 2023-05-24

15 Items: Forest.Not tidy.Seven days.A living thing with leaves.Walk in the forest or mountains.A machine that takes photographs.A fun place that kids go in summer.With strong colours, or very light.Throw and catch many things at once.Something that you eat to feel better.A computer that you can carry in a bag.A special time when people get together....

6th grade study 2024-05-15

15 Items: A spacehurricainA very hot planetits a giant ice agea giant cloud of gasits a planet we live onA planet that is now gonedot a black hole in spacedot a red dot in the galaxyA planet with a lot of ringsA lake of water with mineralscycle A cycle of water rotationITs a big glowingthing in the skyhole a black hole that will destroy anything in its path...

33 2025-08-17

15 Items: Wallet with chain.Gathering at night.Common biker jewelry.Outdoor meal with bikers.Lubricant essential for engine healthEvent celebrating biker independence.Substance burned to power a motorcycleMeasure of gasoline quality and performanceDevice for communication or music on a rideAnimal that riders watch out for on forest roads...

Can You Beat Mr. G. with a 5 minute Headstart 2021-05-28

24 Items: heatdcellforcerepelsoundenergymagnetseriesattractbatterycircuitgravityconducterosioncurrrentfilamentcomponentinsulatorlightbulbparrallelfossilfuelelectricitystreamtablecontactpoint

Can you Beat Mr. G. with a 5 minutes Headstart 2021-06-01

24 Items: heatdcellforcerepelsoundenergymagnetseriesattractbatterycircuitgravityconducterosioncurrrentfilamentcomponentinsulatorlightbulbparrallelfossilfuelelectricitystreamtablecontactpoint

Slang Words - Can you keep up with the Cool Kids? 2025-05-23

50 Items: LLitCapBetBaeFitDubAteIckFlexSlayDripFireVibeFOMOMoodWokeYeetGOATShipSussBruhHypeDeadRizzSimpSaltyGhostExtraBasicShookSquadShadeGucciSlapsChillValidZestyLowkeyBoujeeSavageGlowUpBussinBoomerHighkeyPeriodtSaylessPressedThirstySnatched

Spanish Man 2023-02-10

32 Items: ofmytheflagdeskdoorhereyourmouseclocktablechairtherein/onposterscreenwindowbehindwhere?it's acomputerbackpackkeyboardtrash canon top ofunderneathin front ofsome, a fewWhat is this?next to,besidepencil sharpenerThere is, There are

January Word Search 2025-11-24

20 Items: To dress warmly in many layers.A cold, brisk feeling in the air.A severe snowstorm with strong winds.A sky completely covered with clouds.An involuntary movement caused by cold.A slight warming that melts ice or snow.A mix of rain and snow falling together.To remain inactive or asleep during winter.A fireplace area used for warmth in winter....

Guess the Club, soccer 2025-03-21

12 Items: Madrid(Stadium)(Young star!)(Top striker!)(Star midfielder!)(Legendary player!)(Legendary captain!)(Nickname – "Los Blancos")(Era of superstar signings!)(Most Champions League wins!)(Spanish league they play in)(Big rivalry with Barcelona!)

Accelerated Math Word Search 2024-11-21

20 Items: An angle less than 90°says that two things are equalAn angle which is equal to 90°An angle which is equal to 180°Two angles that add up to 90 degreesTwo angles that add up to 180 degreesAn angle is more than 90° but less than 180°An angle that is more than 180° but less than 360°Changing a shape using turns, flips, slides, or resize....

1G words 2022-10-21

60 Items: iaittobemyatisofdoinupmegoamonnoanweshewhyseebighadforyesandyoutheallwhoarethewasonehascangetlikedownlookwantlovethatwithcomesaidlotsthistheywantherelivewentwillhavetherecan'twherelittle

Classic Literature 2025-03-17

42 Items: PanPoeEyreFarmKingEmmaLewisGamesCarollAustenBrontePotterAlcottHamletCarrieQuixoteHeightsDraculaDickensRowlingRebeccaMacbethOthelloMatildaBeowulfIvanhoeTwilightStardustCervantesHemingwayStevensonSteinbeckDickinsonDivergentWonderlandand JulietPersuasionFitzgeraldnShakespeareFrankensteinand Prejudicewith the Wind

Goforgod Word Search 2025-05-15

20 Items: lunchattirehusbandgrandpahome towngrandchildschool rolechurch mottoclass taughtwhereʻs my..eldest childathletic leaguefavorite numberinstrument playedathletic team namelaw school studentlearner expectationweekly Bible triviaschool abbreviationstart everything with

SPELLING BEE EXTREME WS 2025-10-01

56 Items: onatinsitforwinwonoldmankidskyhisbeewithtakefrombookformwordwantchairstageplacestartyoungmaybephotoimagebeachcloudaboutspelldreamposterbannerlittleschoolanswerskillswinnertrophybecomecurtainsubjectdiscoverpicturestrophiesspellingnewspaperastronautcharactersmicrophonephotographparticipantexceptionalregistration

Barometer Word Search 2023-05-22

15 Items: when colder air moves to warm air masswhen warm air mass moves to cold air massa weather device that measures air pressurea group of air with same pressure and humiditya device used to messure wind speed and directionthe weight of the molocules of a large mass of airwarm air mass is caught between two cold air masses...

Communication Skills 2025-05-01

6 Items: Speak to the family with ... to show your understanding of the emotional impactAvoid using a patronising ... when explaining the condition/medication to the childUse ... to make sure the patient feels heard and all questions are answered satisfactorilyExplain the diagnosis with ... so everyone present understands the condition as best as possible...

Diwali celebrations 2024-10-24

8 Items: Darkness (Represents ignorance and evil, which is dispelled by the symbolic lighting of lamps during Diwali)Firewoks (explosive displays that light up the night sky, symbolizing the celebration of victory and joy during Diwali)...

pasatiempos 2025-10-01

13 Items: A ball is usually involved.Goggles help you with this.You close your eyes and rest.A controller is in your hands.You sit on the couch and watch.Headphones are perfect for this.You turn pages when you do this.You race your friends doing this.You need a plate and fork for this.You use the oven or stove to do this....

Unit 3 Vocabulary 2025-10-31

13 Items: The flip of a fractionReduce or make simplerComparion of a part to partA comparison of two quantitiesRatios with equal cross productsMeasurement system used in the USComparison of the section to totalComparison of the total to a sectionA rate that compares a quantity to oneMeasurement system based on multiples of 10...

Words that begin with letter z 2025-03-03

8 Items: ZooZeroZoneZebraZipperZigzagZombieZucchini

unit 9 2024-05-01

20 Items: another name for petroleuminclude coal, oil, natural gasmost common form of hydro powergas cleanest burning fossil fuelsmall bubbles of NG trapped in iceany organic materials, including wastessomething that doesn't occur continuouslyusing a fuel for both electricity and heatareas with consistent wind with many turbines...

Olympic Greats 2025-09-14

20 Items: Australian swimmer nicknamed “The Thorpedo”American swimmer with 23 Olympic gold medalsNorwegian skier with eight Olympic gold medalsFirst woman to win Olympic swimming gold in 1920Czech runner who won three golds at Helsinki 1952Soviet gymnast nicknamed the “Sparrow from Minsk”American skier who won Olympic slalom gold in 2014...

Vayera 6.0 2025-11-09

23 Items: and a __________ .The second nation was?Lot flees to what city?G~d saved Lot because of who?“because you _____ my voice.”With whom was Abraham bargaining?Who greets the two angels to Sodom?Lot offers what to appease the men?One nation born from Lot׳s daughters.What rained, with fire, on the cities?And promised to make him a great _____ ....

Paul, Called to Serve Together with Other Brothers and Sisters 2022-03-06

20 Items: paullukemarkhelpservesilaslearnworkedaquilajustussimeontimothywillingtogetherbarnabastychicusphilemonpriscillacoorperationepaphroditus

Short -i and Long -, with Short -o and Long -o 2025-05-11

23 Items: findmostfilmlostmothcostbothkindrollfistcoldgoldtoldwildsoftpostwindmindchildscoldblindghostfriend

Words with parts: ture, sure, tion, sion, ous and ful 2025-06-21

30 Items: futureactionnationfamouspicturemixturemeasureclosurestationnervouscuriouscarefulhelpfulplayfulpressurepleasuretreasurevacationdecisioninvasioncheerfulfurnitureadventureeducationconfusionexplosiondeliciousdangerousbeautifultelevision

Module 1 Week 3- Words with Long i & Long o 2025-09-02

28 Items: signodorgroanreplydoughapplyniecethrownstrikemightystrollheightexciteslightdefinespidersilentrepeatcomposecontroldisplaybeneathproposeconfidebrightencommotionapproachedexcitement

My Life With the Chimpanzees 2025-11-06

6 Items: catlionzebrahippoelephantMan's best friend

Help Joltara with her homework 2025-12-07

6 Items: DayBirdcocoaCerealphoenixJoltara

CAFFEINE AND CANINES 10/20/2023 2023-10-20

31 Items: RetrieveA dogs kneeA dogs ankleA dogs “fangs”Most famous dogThe third eyelidA pattern of footstepsMy coonhound mix’s namemost popular male dog nameMy senior Yorkie dogs nameBroad head with short muzzlenarrow head with long muzzleMost popular female dog nameMy blonde shepherd dogs nameMy white and Brown dogs nameMy brindle pit bull dogs name...

grand canyon 2024-12-12

8 Items: fil ahousezipliningalot of foodpop and popcornwith my friends and wifenathan bryson Paige fabianjumping off the grand canyon

trs 3b w19 2022-06-15

11 Items: n. Sea.adj. Very tasty.n. A famous sports player.v. Another way to say 'can'.n. A place with sea all around it.v. When a plane goes to the ground.n. Something that is wrong or broken.n. Green plant that covers the ground.v. Ask someone to do something with you.n. A place to put an animal so that it can't run away....

Phospholipids Word Search 2025-01-27

36 Items: What is a term for “water-loving”?What is a term for “water-hating”?What does passive transport not require?How do phospholipids arrange in cell membranes?Is diffusion a spontaneous or nonspontaneous process?Membrane protein that spans across the lipid bilayer.What is the most abundant lipid in cellular membranes?...

Mr.Wordy.W.Wordison Wordsearch 2023-10-19

10 Items: Oldchance ofAdverb -lyDeath place------- centregeared and tieredleaders of countryseveral types of thingsannoying someone with courageseeing someone and knowing them

Electrical Circuits 2025-04-21

15 Items: unit of powera part of an elementthe opposition to flowone path in a circuitbomultiple paths in a circuitbase unit of an electrical unitboth series and parallel circuitsomething that can deliver energyallows electrical current to flowa circuit with a break in the pathhow hard it is for electricity to flowthe flow of electricity in one direction...

Arroyo Word Search 2025-09-16

15 Items: The haunted hall: __________The best grad year: _____________“Swear to God!”:__________________1 for DPA, 3 for DPC: _____________Has a house in Hawaii: _______________The school we currently go to ___________A teacher from New Jersey: _______________Someone who goes to school: ______________Not a teacher but still the goat: _____________...

123 2025-05-27

5 Items: мебельtable for studyingfurniture you sit onchair with arm restsbox inside furniture

jajshajjsjs 2023-05-31

10 Items: Pairs with thymineOrganic compounds used to store energyIn the double helix pairs with cytosineConverts the instructional genetic information stored in deoxyribonucleic acidEach nucleic acid has this, a 5-carbon sugar as a part of its polymer backbonePortion of the DNA double helix that provides structural support to the molecule....

Word Search puzzle 2024-12-09

20 Items: Frozen waterTells you the timeA round, juicy fruitA fluffy farm animalA long stream of waterA place where people liveA green animal that jumpsGives light when it burnsWhat you wear on your feetFlies in the sky with windA dark shape made by lightA sweet treat for birthdaysA tool used for eating soupA musical instrument you hit...

Time Flies When You're Having Fun! 2025-07-28

26 Items: Sped up26 milesFemale namePurring petsCity in TexasSpeedy canineFemale nickname00:00, not 12:00Puzzle in a gridCastle basementsCity in MilwaukeeSynonym of surpassSinging as a groupCity in MassachusettsTown in MassachusettsFlying fire-breathersLong-running TV quiz show___ science (a STEM major)___ science (a STEM major)Position in a sibling group...

The Perfect Crane 2025-05-12

6 Items: Very pleased.Strong and tough.Very finely well made and pretty to look at.To have a good opinion of it or to agree with it.You think it is strange or a little bit of a mystery.A friend or someone who spends a lot of time with you.

Eukaryotic Word Search 2025-10-20

6 Items: it is divided by that number.the two numbers are added togethera part of an atom with no electrical charge.the force or weight of air in the atmosphere.something is to watch it closely and note how it changes.it has complex cells with nucleid and may beeither unicellular or multicellular.

C2 bonding key words 2025-12-16

15 Items: A huge 3D network of atoms or ions.A huge 3D network of covalently bonded atoms.Particles with a diameter of approximately 1x10-5m.Particles with a diameter of approximately 1x10-9m.Particles with a diameter of approximately 1x10-7 - 2.5x10-6m.A mixture of two or more elements, where at least one is a metal....

Week 8 Thursday 2023-10-06

25 Items: course of studyTo buy somethingMario's occupationWorthy of attentionwritten communicationto support with evidenceHappens at the same frequencyBelonging to a particular personFirst in the order of importancea math sentence with an equal signA number that is not a whole numbersharing an edge or boundary; touchingConvert waste into a reusable material...

Unit 3: Senses 2025-12-03

32 Items: very smallunable to seeextremely bigvery interestingthe ability to seesomething you hearnot smooth; unevenfull of loud soundslikely to cause harmbrightness; not darkshaped like a circleunpleasant to look ateven and without bumpswith little or no lightwith little or no soundshaped like a rectanglenot dangerous; protectedvery unpleasant or sickening...

CAFFEINE AND CANINES 10/20/2023 2023-10-20

31 Items: RetrieveA dogs kneeA dogs ankleA dogs “fangs”Most famous dogThe third eyelidA pattern of footstepsMy coonhound mix’s namemost popular male dog nameMy senior Yorkie dogs nameBroad head with short muzzlenarrow head with long muzzleMost popular female dog nameMy blonde shepherd dogs nameMy white and Brown dogs nameMy brindle pit bull dogs name...

Who is this Resident 2025-08-02

3 Items: BingoCarrotsstarts with 3

Project Financing 2022-08-22

11 Items: Hello,DirectorSincerely,AyrapetyanInternational E.C.Box 10236 Shop No. 3053 Manama Centre, Bahraintigran.ayrapetyan@devcorpinternationalec.comsubmit your business plan, pitch deck or executive summary for us to review and to understand much better about your business and to further discuss a possible partnership....

CH2 - Waves and the EMS 2022-12-19

27 Items: The lowest point on a transverse wave.________________________The highest point in a transverse wave.________________________The interaction between waves that meet.________________________The material through which a wave travels.________________________A wave that requires a medium through which to travel.________________________...

1G words 2022-10-21

60 Items: iaittobemyatisofdoinupmegoamonnoanweshewhyseebighadforyesandyoutheallwhoarethewasonehascangetlikedownlookwantlovethatwithcomesaidlotsthistheywantherelivewentwillhavetherecan'twherelittle

1G powerwords 2022-10-22

60 Items: iaittobemyatisofdoinupmegoamonnoanweshewhyseebighadforyesandyoutheallwhoarethewasonehascangetlikedownlookwantlovethatwithcomesaidlotsthistheywantherelivewentwillhavetherecan'twherelittle

Sight Word Champion 2025-04-01

58 Items: Iahewememygotoofnoistwotheandbigseeyoucanforsheputonehasaresaweatwasoutallherhowourhavelikeplaylookwithwhatjumpwantsaidthisherecomedowntheygoodyourgirlwhenawayoverloveveryhappylittlefriendyellow

GAITS OF A HORSE 2024-01-18

11 Items: The different speeds the horse travels.A gait with three beats, it is between a gallop and a trot.When a horse moves backwards, legs move backwards as in a trot.A pace faster than a walk where a horse lifts its legs in diagonal pairs.A controlled version of a gallop, rider is more forward and out of the saddle....

this is wild 2023-11-23

11 Items: "Save"to Make a Word SearchSearch Generator Featuresthe wordsearch within your own website.your wordsearch, with or without the answers.are no ads, no watermarks, and no registration is required.your word search URL with others and they can try solving it online.the form to build your word search. A preview is generated for you automatically....

Immunology Word Search 2024-03-13

15 Items: Immunoglobulin producing cellsProtein encoded by HIV gag geneGold standard test for screening SLECells responding to parasitic infectionsSarcoma associated with HHV-8 infectionsAntibody is in excess compared to antigenMost abundant immunoglobulin in adult serumRegion of immunoglobulin that binds antigensMediator of Type I hypersensitivity reactions...

kelton 6th grade 2024-05-20

15 Items: the hottest planetthe closet galaxy to usthe closet star to earththe galaxy that we live inthe wave of thermal energythe closet planet to the sunthe second layer in the earththe largest in our solar systemthe only planet with life on itthe farthest planet from the sunthe first planet that we have visitedhas the most rings in the solar system...

Vocabulary - Kids Box 6 | Page 78 2024-10-05

11 Items: They spoke Latin.An ancient language from Rome.A way to show events in order.The Normans spoke this language.A tribe whose name starts with "J."To enter and take control of a country.The name 'England' comes from this group.People from France who invaded England in 1066.Areas of land with their own names and leaders....

The British empire and the conflict with India. 2025-01-22

12 Items: WarIndiaSepoyDelhiMutinyEmpireBritainReligionRevolutionIndependenceConsequencesInterpretation

TO THE WOMAN WITH THE MOST BEAUTIFUL SMILE 2025-07-30

14 Items: IYouAndYouTheAndLoveMostTodaySmileLaughVivianForeverBeautiful

Words with oa (boat) o_e (rose) ow (window) o (comb) 2023-11-06

19 Items: agorodecoatboatsoaphopeconeknowgrowslowonlyoveropenbothstoneclosethrowyellowclosing

Spelling Fun with d, dr, g and gr 2023-02-20

12 Items: gabgetgotdabdipdotgrabgrubdrabdripdropgrits

Words with middle short vowel sounds A&E 2025-11-17

12 Items: CATBATRATMAPBAGHATBEDPENHENJETWEBNET

Group B long /e/ with "ee" and "ea" 2025-12-16

12 Items: freeeachteamteachteethwheelspeaksheepweavepleasesneezemeaning

animales-colores-trabajos 2023-03-02

20 Items: of bloodof grassbest friendof flamingosof the junglecolor of the oceanjob is to take picturesanimal with a long neckanimal that eats bananasanimal that likes cheeseanimal that produces milkthat you kill to make baconinsect that makes honeycombs- an animal that has 9 livesof cummings high school floorthe profession that flys planes...

Biodiversity Vocabulary 2023-10-06

20 Items: eats plantseats animalsword for Earthbreaks down dead mattereats plants and animalsgroup of the same organismweather patterns over timecollection of organ systemshunts and eats other animalscannot produce its own energyassociated with living thingsorganism that feeds off a hostgroup of different populationsis hunted and eaten by predators...

1G powerwords 2022-10-22

60 Items: iaittobemyatisofdoinupmegoamonnoanweshewhyseebighadforyesandyoutheallwhoarethewasonehascangetlikedownlookwantlovethatwithcomesaidlotsthistheywantherelivewentwillhavetherecan'twherelittle

THE OUTSIDERS Word Search 2024-12-08

47 Items: BobSocsParkGoldFireHopeDarryDallyRandySteveHouseRingsFrostRingsJohnnyCherryChurchFamilyRumbleJacketSunsetPonyboySodapopTwo-BitShepardLoyaltyCourageRivalryRespectJusticeGreasersMountainDrive-InHospitalViolenceStrengthOutsidersLocationsInnocenceNightmareNewspaperConcussionBrotherhoodSwitchbladeWindrixvillewith the WindGold Can Stay

IVE Songs 2025-01-07

39 Items: itamwayottwowdivelikelipsminepagewavewantmolywillheyaloveroyalbloodnightheartqueenresetfestacrushheartelevenkitschbaddieheroinecherishwith meclassicpaybackhypnosisaccendioof heartsyour girlthe recordsatisfaction

CHRISTMAS 2025-12-16

43 Items: JOYGODSINBABYLIFEGOLDHOLYKINGLOVEMARYSTARANGELDEATHJESUSMYRRHBIRTHCHOSENDONKEYDIVINESPIRITHEAVENJOSEPHMANGEROF GODSEALEDGABRIELWITH USMESSIAHREJOICEIS BORNWISEMENBELIEVESFORGIVENIMMANUELOF PEACEON EARTHREDEEMEDSHEPERDSBETHLEHEMSALVATIONCOUNSELORFRANKINCENSERIGHTEOUSNESS

ITS ALL ABOUT MICROSCOPIC LIFE 2024-03-01

22 Items: The powerhouse of the cellSingle Celled microorganismsone-celled aquatic organismsGreen pigment in plants and algaea substance capable of causing cancersmallest unit that can live on its ownMaterial within a living cell-jelly-likeSmall common fly found near rotted fruitViruses that infect and replicate in cells...