hunger games Word Searches

Thankful for Science! 2025-11-19

15 Items: Energy that is storedPlants take in this gasPlants release this gasParade drums give off this kind of energyLeaves use this pigment to absorb sunlightThe oven cooks the turkey using this form of energyThanksgiving food gives your body this stored energyA pie sitting high on a shelf has this stored energy...

Immigrate Word Search 2025-10-30

15 Items: - to move to a country- to move from a country- the spreading and mixing of cultures- something that encourages people to move to a new place- something that encourages people to leave a place behind- an unusually long period in which little or no rain falls- a severe shortage of food that results in widespread hunger...

TWO Gaming Puzzle #1 Join us at discord.gg/twogg 2023-09-30

20 Items: Gaming term for a killClassic roguelike dungeon crawlerOld D&D term: To Hit Armor Class __Recklessly charging in, from a WoW memeUnclear areas of a game map until exploredSmall in-game purchases, often controversialUnit of distance, also a game streaming toolWhen characters explode into pieces in a gameWhen your character dies and can't be revived...

Olympic wordsearch 2024-07-27

22 Items: Sport of racing bicyclesSport of racing in waterEvent of throwing a spearSport of fighting with fistsSport of fighting with swordsMartial art and Olympic sportSport of lifting heavy weightsEvent of throwing a heavy ballSport of racing boats with oarsSport involving horseback ridingSport of racing boats with sailsSport of hitting a ball over a net...

El Hombre de Vocabulario/Quizlet 1A 2024-09-26

38 Items: oryesandto runto skiwell..to singto drawto swimto workto danceto skateAnd you?I do too.also, tooto skateboardto ride a biketo play sportsto go to schoolI like to_____.neither.. nor..to write storiesto read magazinesto listen to musicto play the guitarto play video gamesto use the computerto watch televisionto talk on the phoneI like to_____ a lot...

El Hombre de Vocabulario/Quizlet 1A 2024-09-26

38 Items: oryesandto runto skiwell..to singto drawto swimto workto danceto skateAnd you?I do too.also, tooto skateboardto ride a biketo play sportsto go to schoolI like to_____.neither.. nor..to write storiesto read magazinesto listen to musicto play the guitarto play video gamesto use the computerto watch televisionto talk on the phoneI like to_____ a lot...

Grade 1 Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Puzzle 1 2023-02-18

1 Item: GAMES FUTURE PROUD ORGANIZER INTELLIGENT MOTHER SMILE NURSE ROSES

M3 Parts of a Flower 2023-09-04

14 Items: the male gamete of a flower.Tough outer coat of the seed.Sweet, sugary fluid found in flowers.Part of the flower that stores pollen.Type of organ flowers are to the plant.Colorful part to attract insects and birds.Part of the flower that holds up the anther.The place where the male and female games fuse....

Unit 1 Review by Kaylin 2025-12-03

25 Items: Transfers STM to LTMRapid eye movement sleepProtective coating of axonConnects spinal cord to the brainaffects thirst,and sexual behaviorNumber of cycles per second in a waveControls visual information processingA dream usually remembered later in life.Control auditory and linguistic processingRegulates autonomic processes while asleep...

4º UNIT 2 2025-11-17

17 Items: Deeply in love. They’re _________ in love.Caring and generous. He’s a __________ person.Extremely shy. She’s __________ shy in public.Stay silent. Please keep ______ during the test.Start loving someone. He fell ____ her instantly.Laugh loudly. They roared with __________ at the joke.Easily angered. He’s __________ and gets angry quickly....

Compass Word Search 2024-12-20

13 Items: A device used to find directions.A stick of colored wax used for drawing.The line where the earth and the sky meet.A small device that makes a sound when blown.A large, bowl-shaped hole formed by an impact.A tall structure that helps guide ships at sea.A large group of stars and other celestial bodies....

Re’eh 5.0 2025-08-16

20 Items: Yeshua said, “I am the bread of _______.”This festival recalls leaving Egypt in haste.Yeshua said the bread He gives is His ______.What kind of birds are specifically forbidden?In the Shemittah year, what is to be released?This festival is also called the Feast of Weeks.What food did the fathers eat in the wilderness?...

NFL Teams (Super Bowl Clues) 2025-11-30

32 Items: Tied for most Super Bowls won (8)Won four Super Bowls in six yearsWon two Super Bowls in one decadeWon four Super Bowls, two with Eli Manning as MVPThey won their only Super Bowl appearance against the ColtsThe first team in history to win a Super Bowl after being 0-2Never won the Super Bowl, closest being the inaugural Super Bowl...

My Word Search 2023-04-19

15 Items: opposite of possiblethe school you go towhat number is this?a sport for self-defenseI wonder what a Maltese Poodle is?what's the opposite of impossible :)a sport that contains a big orange ballthe name of a toy rabbit from a famous booka real-estate board game for up to 2-8 playersin this sport you kick the ball with your feet...

Calg 2026-02-07

177 Items: cfadayfunicesunzoobeercamphikeikealakeshoptripgameskinjomusicrodeosunnytrailalcottcinemagelatolocalsmuralssoccersunhattubingtennisbuskersconcertdaytrippopcornraftingballcapsballgamebeltlinebowriverchilldaychipotleicecreamkayakinglemonadeloungingriverfunsunblocksunnydaybeerpatiobbqseasonboardwalkcityparksfoothillshydrationinglewoodparkbenchriverwalk...

Calg 2026-02-07

177 Items: cfadayfunicesunzoobeercamphikeikealakeshoptripgameskinjomusicrodeosunnytrailalcottcinemagelatolocalsmuralssoccersunhattubingtennisbuskersconcertdaytrippopcornraftingballcapsballgamebeltlinebowriverchilldaychipotleicecreamkayakinglemonadeloungingriverfunsunblocksunnydaybeerpatiobbqseasonboardwalkcityparksfoothillshydrationinglewoodparkbenchriverwalk...

Echoes of Honor – Castles & Classes WORD SEARCH 2025-04-24

171 Items: BOTHCAREFARMFOODGATEGAVEGIVEGROWHARDHAVEHELDHEREHILLHOSTKINDKINGLANDLIFELIKELIVELUTEMADEMANYMAZEMOATMOREMOSTPASTPLAYPOORRICERULETAKETELLTHANTHEMTRAPTRUEWELLWEREWIDEWITHWOODWORKABOUTARROWBRAVEBUILTCODESDANCEDOORSENJOYEVERYFEASTGAMESGIANTHONORJAPANLABORLATINLEARNLORDSLOYALMUSICNOBLEODORIPOWERRIGHTROYALRULESSLITSSPEAKSTONESWORDTHEIRTHICKTHOSETRUTH...

Sip and Search 2025-04-26

30 Items: Is left handedIs right handedAnnie's occupationAnnie is this signAnnie's "mi amoray"Wilson's occupationWilson is this signWilson collect theseAnnie's favorite foodWilson's favorite foodWilson's favorite sodaAnnie's favorite seasonAnnie loves shopping hereWilson and Annie met hereWilson's favorite holidayMonth that Annie was born...

Ancient Rome 2025-06-08

20 Items: The first emperor of Rome.The king of the Roman gods.The ruler of the Roman Empire.A large unit of the Roman army.A garment worn by Roman citizens.A member of the wealthy, ruling class.A common citizen or lower-class Roman.A term Romans used for non-Roman people.A political body that advised Roman leaders....

OC Creator 2025-09-06

170 Items: TANCATBATALTSANDMINKDOG,FOX,BEARCUB,FOX,BAT,CAT,DOG,WOLFIVORYPEARLOLIVEBEIGEMOCHAAMBERSABLECAROBSEPIAMUSICGAMESBIRD,FISH,WOLF,ENVY,FEAR,MAGE,REBELFOOL,GIRL,PUNK,COZY,KPOP,KIND,CALM,FIRE,WIND,DARK,VOID,SOUL,METALBEAR,LION,ROSE,PINK,BLUE,NAVY,TEAL,MINT,JADE,LIME,PLUM,ONYX,OPAL,BRONZEBAKINGCRAFTSSNAKE,RABBITPRIDE,GREED,WRATH,LEADERARTISAGOTHICANGRY,...

Echoes of Honor – Castles & Classes WORD SEARCH 2025-04-24

171 Items: BOTHCAREFARMFOODGATEGAVEGIVEGROWHARDHAVEHELDHEREHILLHOSTKINDKINGLANDLIFELIKELIVELUTEMADEMANYMAZEMOATMOREMOSTPASTPLAYPOORRICERULETAKETELLTHANTHEMTRAPTRUEWELLWEREWIDEWITHWOODWORKABOUTARROWBRAVEBUILTCODESDANCEDOORSENJOYEVERYFEASTGAMESGIANTHONORJAPANLABORLATINLEARNLORDSLOYALMUSICNOBLEODORIPOWERRIGHTROYALRULESSLITSSPEAKSTONESWORDTHEIRTHICKTHOSETRUTH...

Risk Reduction, Wellness, Health Literacy 2025-04-30

25 Items: Reduces risk of injury in sport.Crucial for an athlete's well-being.Practices for better rest and recovery.Can impair healing and immune function.Needed after intense training or games.Personal check for unusual body changes.Can influence risk behaviors in athletes.Tracking patterns to prevent future harm.Strategy to balance training and recovery....

180 Winter Words Search 2025-11-17

180 Items: HATICEJOYPIEELFCOLDSNOWDARKPINETREEWINDCOZYSALTWOODWOOLHIKEHOLYNOELYULESOUPWARMPLOWTOYSYAMSCORNHOMESHOPSTARBOOTSCOATSCABINIGLOOCHILLCOCOASCARFWINDYSANTAELVESHOLLYPEACEANGELBELLSSTORMSIDESCARDSPUNCHJOLLYGIFTSMUSICGRAVYHYMNSFEASTMERRYGAMESBREADPARTYCHOIRPEACEFROZENWINTERSEASONGIVINGSHOVELFREEZECHILLYFROSTYGLOVESFRIGIDCAROLSBAKINGTUBINGWREATHLIGHTS...

Calg 2026-02-07

177 Items: cfadayfunicesunzoobeercamphikeikealakeshoptripgameskinjomusicrodeosunnytrailalcottcinemagelatolocalsmuralssoccersunhattubingtennisbuskersconcertdaytrippopcornraftingballcapsballgamebeltlinebowriverchilldaychipotleicecreamkayakinglemonadeloungingriverfunsunblocksunnydaybeerpatiobbqseasonboardwalkcityparksfoothillshydrationinglewoodparkbenchriverwalk...

Hannah's Favourite Things 2024-10-23

35 Items: Sandy funWatery funNight birdSpikey plantArtistic worksFastest bicycleBird or Biscuit?Stories on paperCrazy loud friendYummy baked goodsPlace of learningLine of mini flagsSomething you playDelicious hot drinkReally good cuddlerHannah's best friendOne horned real beastHow you go into spaceItch it whilst codingPretty bits on plants...

Diary Of A Wimpy Kid 2025-05-05

1 Item: MANNY, GREG, ROWLEY, RODRICK, FAMILLY, CHEESE TOUCH, VIDEO GAMES, TEENAGERS, SCHOOL, SNAKE STREET

Title, Word Search 2024-10-26

2 Items: beef, wallaby, turtle, fish, lamb, chicken, culture, tradition, cattle farms, fauna, native, exotic.aim, goal, purpose, ingredients, steps, tools, measuring, making, cooking, tablespoon, mixing, food safety, wash hands, rules, equipment, instructions, games, sequence, safety,Top Tips, convention, conduction, radiation, heat.

Srujani Word Search 2025-06-25

1 Item: birthday twentyone birthday cake balloons family gifts wishes happy babyjunks games love joy celebration august

Unit One Vocabulary 2025-08-15

24 Items: Exchange of GoodsBelief in many godsMain crop produced in a specific placePerson skilled at making things by handFine and fertile soil found near riversMore than is required or necessary, extraSubstance from which other things are madeEarliest form of writing invented by SumeriansSympathy for the beliefs and practices of others...

Egypt Word Search 2025-02-11

10 Items: An ancient civilization known for its pyramids and pharaohsAn ancient civilization known for its philosophy, democracy, and Olympic GamesA powerful civilization that ruled much of Europe, North Africa, and the Middle EastA civilization with a long history, including the Great Wall and inventions like paper...

Swimming 2025-09-14

20 Items: American swimmer who won 11 Olympic medalsAustralian sprinter known as “The Missile”Australian swimmer nicknamed “The Thorpedo”American swimmer nicknamed “Missy the Missile”American swimmer who won 23 Olympic gold medalsAmerican swimmer who competed in five Olympic GamesHungarian swimmer known as the “Queen of Backstroke”...

Swimming 2025-09-14

20 Items: American swimmer who won 11 Olympic medalsAustralian sprinter known as “The Missile”Australian swimmer nicknamed “The Thorpedo”American swimmer nicknamed “Missy the Missile”American swimmer who won 23 Olympic gold medalsAmerican swimmer who competed in five Olympic GamesHungarian swimmer known as the “Queen of Backstroke”...

New Year Games 2025-12-22

1 Item: The largest planet in our solar system

Holiday Word Search 2025-11-25

191 Items: ElfFirIcyOilRedToyCardCoalColdGeltGiftGiveLampListLoveNoelRoofSingSkisSnowStarTreeAngelBellsBootsBoughCedarCiderCometCupidFaithFudgeGamesGeeseGreenHollyJollyLatkeLordsMaidsMerryMusicPartyScarfSpiceSwansSweetToastTreatUnityVixenAdventBakingBrightCandleChillyDancerDasherDonnerEggnogFamilyFrostyGatherGlovesGrinchHoHoHoIcicleJoyfulKaramuKinaraLadies...

Advent Word Search 2024-12-07

194 Items: bowboxeveHamhatPiecoalcoalColdcozyHolylolalovemackmilkniceNoelPineSledsnowStartanktapeToysBellsbootsbreakCardscarolCedarchaoscheerciderciderCometCupidDollsElvesgamesGiftsHappyHollyJollyListsmagicMerryolivePartypeacepennySalessantaSaucetrainTripsVixenAdventAngelsantlerbakingbrightchivescookieDancerDasherdinnerDonnerEggnogFamilyFrostygrinchhohoho...

Ski Word Search 2025-06-13

35 Items: fly - lataćrun - biegaćswim - pływaćjump - skakaćsing - śpiewaćcook - gotowaćdance - tańczyćdive - nurkowaćwalk - spacerowaćski - jeździć na nartachdo ballet - tańczyć baletskate - jeździć na łyżwachplay tennis - grać w tenisado karate - uprawiać karatedrive a car - prowadzić automake models - budować modeleread a book - czytać książkę...

FOODWORDSEARCH, HIDDENWORDSTOFIND 2025-02-05

1 Item: HASHBROWNS, CHEW, MUSTARD, BAGEL, COOKED, DIET, WIENERS, CALORIE, HIGHFAT, PATTY, HUNGER, SOFTDRINKS, MAYO, ROLLS, INSTANT, CHEESE, HARMFUL, COLA, PIES, BURRITOS, FUNNEL, FRITTERS, CRAVE, NACHOS, JERKY, PRETZEL, CORN, BEEF, ROOTBEER, COTTONCANDY, CARAMEL,

Dinosaur, Word Search 2024-06-14

1 Item: CLOUDS, FRUITSALAD, PINEAPPLE, ADVENTURE, FUN, GAMES, PLAYFUL, KIND, STRONG, BRAVE, TREE, GOAT, RAINBOW, SUNSHINE, LIVE, STARS, MOUNTAINS

Word Search: Fact and Opinion 2024-02-25

10 Items: the second largest Wikipedia in the world CE_U _ _ _Sa Aking Mga Kabata was not written by J_ _ E R _ ZA_The Philippines is the largest explorer of the fruit B_ _ _The Philippines created the S_T AND S_I_K_ used in Volleyball.Can be some of the most hospitable people in the world FI _ _ _ _ _ _ _...

The Beatitudes 2023-08-02

1 Item: Poor in Spirit, Mourning, Meekness, Self-Control, Mercy, Peacemaking, Righteousness, Persecution, Salt and Light, Heaven, Kingdom of God, Hunger and Thirst, Serenity, Pure of Heart, Son of Man, Humility, Forgiveness, Prayer, Wise Builders

The Beatitudes 2023-08-02

1 Item: Poor in Spirit, Mourning, Meekness, Self-Control, Mercy, Peacemaking, Righteousness, Persecution, Salt and Light, Heaven, Kingdom of God, Hunger and Thirst, Serenity, Pure of Heart, Son of Man, Humility, Forgiveness, Prayer, Wise Builders

Demeter 2025-10-03

21 Items: ruler of the Underworld; abducts Persephone.town where Demeter rested; center of her worship.king of Eleusis; welcomes Demeter into his household.servant who makes Demeter laugh and lifts her sorrow.infant son of Celeus; Demeter tries to make him immortal.boy who mocked Demeter drinking; transformed into a lizard....

Ancient History 2023-07-17

20 Items: 490 BCE Battle of _________.9500 BCE Settled _______ began.2560 BCE Great _______ of Giza.6000 BCE _______ was discovered.200 BCE Paper is invented in China.776 BCE ______ Games first recorded.323 BCE Death of Alexander at _______.508 BCE Democracy introduced at ______.1700 BCE End of _____ Valley Civilization....

Kinder 2026-02-12

208 Items: bincuppenrugtoyballbellcubeglueyarnapronbookschalkchairchartclockeaselgamespaperrulersongstimerabacusblocksbucketcolorspuzzlerecessshapessmocksballoonbeanbagcrayonsfriendslibrarymarkersmobilesnumbersorigamiplaymatreadingsandboxshelvesteacherwritingabcchartbackpackbooklistcalendarclasspetdaysweekexercisefeathersfloormathomeworkmealtimepainting...

Pokemon 2023-09-13

23 Items: I am made of 108 spiritsThey can run around 150mphThis pokemon has the most headsThis professor was once a championThis pokemon is eaten as a delicacyThis pokemon is featured on currencyThe original name of this was FoxfireThis pokemon has over 4 billion variantsThis pokemon was the first one ever createdThe only champion to not have a home town is...

Baseball 2025-09-14

20 Items: Another term for a baseball fieldLegendary slugger nicknamed “The Bambino”Historic ballpark home to the Boston Red SoxTeam with the most World Series championshipsSeattle team that signed Ichiro Suzuki in 2001St. Louis team with 11 World Series championshipsBroke Babe Ruth’s all-time home run record in 1974...

Ice Hockey 2025-09-14

20 Items: Player nicknamed “Mr. Hockey”Player responsible for guarding the netLongtime captain of the Detroit Red WingsMachine used to resurface the ice during gamesToronto team that last won the Stanley Cup in 1967Pittsburgh team that drafted Mario Lemieux in 1984Montreal team with the most Stanley Cup championships...

Ice Hockey 2025-09-14

20 Items: Player nicknamed “Mr. Hockey”Player responsible for guarding the netLongtime captain of the Detroit Red WingsMachine used to resurface the ice during gamesToronto team that last won the Stanley Cup in 1967Pittsburgh team that drafted Mario Lemieux in 1984Montreal team with the most Stanley Cup championships...

roblox stuff 2025-04-21

204 Items: domveearmargTRUDnoobtaphvalkcoilzukapoobpestbivestatscagmarkspudfafajardobbynoobfinngigigoobfearpaulmedsseanazurejason1eggsswordreddyfollysplitpilby007n7barrysfothmicuprobuxgamesyattaastrocosmopoppydandylooeytapesgreedsorengreenjx1dx11x1x1xchanceelliotkatanarocketmedkitbrokergnarpyJeremyrobloxtycoonavatarpebblerazzledazzleboxtenteaganrodgersprout...

Kinder 2026-02-12

208 Items: bincuppenrugtoyballbellcubeglueyarnapronbookschalkchairchartclockeaselgamespaperrulersongstimerabacusblocksbucketcolorspuzzlerecessshapessmocksballoonbeanbagcrayonsfriendslibrarymarkersmobilesnumbersorigamiplaymatreadingsandboxshelvesteacherwritingabcchartbackpackbooklistcalendarclasspetdaysweekexercisefeathersfloormathomeworkmealtimepainting...

Amor Word Search 2023-04-19

30 Items: What is ____.____+adjectivetenernumberañosBasically netflixbasically an ipadbasically an alexawhat you call 7 daysyou say how old you are.how you describe somethingall of the object in a groupa disk used to record videossomebody you take a class withsomethingyou watch in a theatersomething you say when surpriseda devise that runs on electricity...

Unit 3.8 and 3.9 2025-09-08

20 Items: Monetary compensation usually paid hourlyDigital wallet service provided by SamsungMoney sent from one bank account to anotherExample of a digital wallet provided by AppleTraditional in-person learning led by a facilitatorEmployees learn while performing real tasks at workMonetary compensation usually paid monthly or annually...

S1U11 Unit 4 - Deportes Vocab 2025-11-26

55 Items: teamI winI playsoccerwe winI wantI loseto playwe playyou winathletewe wantwe loseyou playathletictalentedbaseballfootballthey winchampionyou wantyou losethey plays/he winsthey wantthey loses/he playsbasketballvolleyballs/he wantstrack and fieldto win; to earndeportes sportsI watch, look atwe watch, look atyou watch, look atthey watch, look at...

Kinder 2026-02-12

208 Items: bincuppenrugtoyballbellcubeglueyarnapronbookschalkchairchartclockeaselgamespaperrulersongstimerabacusblocksbucketcolorspuzzlerecessshapessmocksballoonbeanbagcrayonsfriendslibrarymarkersmobilesnumbersorigamiplaymatreadingsandboxshelvesteacherwritingabcchartbackpackbooklistcalendarclasspetdaysweekexercisefeathersfloormathomeworkmealtimepainting...

Night Vocabulary & Spelling Word Search 2023-02-24

25 Items: (v.) recall the past(adj.) the quality of being holy(adj.) offering little or no hope(v.) cancel officially; revoke; repeal(n.) open resistance; a hostile exchange(n.) an absence of emotion or enthusiasm(v.) have and exercise; to be able to use(adj.) known widely and usually unfavorably(adj.) conspicuous in position or importance...

Grownups 2026-02-06

229 Items: bbqgymbeercampdadsDeandockkidslakepoolraftShaqwifebullycabincanoechaoscoachcrowdgamesgoofygrillheartmusicpartyprankWileycareercomedyfamilyFrannyGloriahotdogschoolsequelsnackssummertennisbigkidsbondingcookoutcontestdancingdogparkdivorceexwivesfirepitfriendsfuneralhusbandinsultsmancavemidliferefereereunionrivalryshowoffteacherweekendyellingzipline...

1ESO 2025-06-02

230 Items: TVarmearlegarthatfunpoddogbigdiefatilloldwetbedlowbinrugauntfoothairhandnosecoatdeskitemmealsuitmeetmoveplayreadridebikesendtidywalkcluedarkevilgoldhatehideLentlonglookmainrichtallthintripuglywidelicksickparkbankcaféfactfairfinefreeportpostsinksofamouthteethuncleunderbootsbreakdiarydramadressgreatjeansmathsmusicrulershirtshoesskirtsockslunchsnack...

Ancient Greece 2025-05-06

28 Items: God of the SeaKing of the godsGoddess of the HuntGod of the UnderworldHe had the golden touchGod of the sun and musicGoddess of Beauty and LoveShe opened the mythical boxEpic poem about the Trojan WarKnown as the "Father of Medicine"Goddess of wisdom and war strategyCity-State that developed DemocracySparta was considered this government...

Favorite Things Christmas Word Search 2023-12-06

20 Items: Carol of the what?Means "God with us"Where Jesus was born.What kind of night was it?Candice loves to bake these at Christmas.Katie loves cookie making and going here.Jennifer R likes doing this to the Christmas tree.Benna loves going to mass with family at this time.Audrey loves attending this church service on Christmas Eve....

Holidays Around the USA 2023-12-08

15 Items: A cookie made with molasses and ginger.A festive song or hymn sung at Christmas.A Spanish phrase meaning “Happy Christmas.”A grouchy spoilsport who doesn’t enjoy Christmas.A nine-branched candelabrum used during Hanukkah.A small, decorative sphere hung from a Christmas tree.A candle holder for the seven candles lit during Kwanzaa....

Persuasive Devices Word Search 2023-07-27

18 Items: “All teenagers are lazy and rude!”“We met in 1999 when I was at University”Gets an emotional reaction from the reader“The Prime Minister is a total raving idiot”“All famous people live rich and exciting lives”“A teenager swore at me on the train. How lovely!”Suggests the reader must always support their country...

Technology 2025-01-26

14 Items: — a theme that is repeated many times- people who make up new things and products.- a new or improved idea, device, product, etc.— to break a hard problem up into smaller, easier onestrying again and again, even when something is very hard.— finding and fixing problems in your algorithm or program...

TechnologyJourney 2025-01-30

14 Items: — a theme that is repeated many times- people who make up new things and products.- a new or improved idea, device, product, etc.— to break a hard problem up into smaller, easier ones— finding and fixing problems in your algorithm or program— a placeholder for a piece of information that can change...

Holidays 2025-10-10

226 Items: DayBooHamHugRedBabyDropBatssuitBlueCakeCornEggsFallFlagFoodFoolGiftGolfHowlHuntJulyKissLambLoveMaryMoonNoelPinkPoemPoolTripSandtimeStarToysTreeYamsAprilBeachBellsBlackBunnyCandyCarveClockCoinsCupidElvesFeastFrostGamesGhostGhoulGravyGreenHappyHollyIrishJesusJokesLuckyMarchMagicMummyMusicNightPartyPeterPizzaRelaxSaintSantaScarySillySkullToastTreat...

U12 2026-01-12

11 Items: Taking everything into account; regarded as a whole.To seize or take hold of something suddenly and roughly.To win a victory over an opponent in a battle, game, or contest.An act of helping a teammate to score a goal or point in a game.A list of players taking part in a particular game or sports match....

Pumpkin, Word Search 2025-11-03

1 Item: PIES, PECAN, TURKEY, GRATEFUL, GREENBEANS, MASHEDPOTATOES, FAMILY, PARADE, FOOTBALL, APPETIZERS, PILGRIMS, NATIVES, APPLES, SPARKLINGCIDER, WHIPPEDCREAM, GRAVY, CRANBERRYSAUCE, STUFFING, STUFFED, GAMES, DINNER, NOVEMBER, CORNUCOPIA, COOKING, BAKING, EATIN

iMedia Key Words 2025-03-13

7 Items: A diagram used to generate ideas quickly and organise information.Industries that existed before computers and the internet (film, TV, radio & print publishing)Creative role which involves writing text such as press releases, blog posts or online articles...

VOCABULARY - S4A 2025-11-19

1 Item: model, blog, blog post, baking, puzzle, board games, exhausting, energy, hike, perform, yoga, cafeteria, follower, instagramming, facebook, block, swimming,running,camping,jigsaw,comment,learning,social media, youtube, basher

Make Word Search 2025-08-09

1 Item: name puzzle games chart of name listed below : clarence , roushel, eleazor , snehal , rukraj , ristan, ryson, aditya , swapnil, aishwarya ,anvay, prathamesh , sushmita, nikhil, vincia, claire, romel rion , roger , nikita aura,

First Day of School Word Search 2025-12-29

1 Item: close reading activities, vocabulary building, narrative writing Alphabet recognition, letter tracing, phonics games, reading comprehension of short stories, creative writing prompts, storytelling Counting, number recognition, simple addition/sub

Hanukkah 2022-12-07

10 Items: Judah Maccabee's nickname.Hanukkah customs include playing with four-sided spinning tops called ______ and exchanging gifts.Jewish scholars have also suggested that the first Hanukkah may have been a belated celebration of ______.In another interpretation, Jerusalem under Antiochus IV had erupted into civil war between two camps of Jews....

Hanukkah 2022-12-07

10 Items: Judah Maccabee's nickname.Hanukkah customs include playing with four-sided spinning tops called ______ and exchanging gifts.Jewish scholars have also suggested that the first Hanukkah may have been a belated celebration of ______.In another interpretation, Jerusalem under Antiochus IV had erupted into civil war between two camps of Jews....

Extras in Lego Video Games 2026-02-08

1 Item: RachaelRobotChicken

Thanksgiving 2025-11-21

250 Items: ATEBENBOBDANEATFUNHAMJOYNAPBANDBOWLBUNSCOOKCORNDINEDISHDUCKFALLFISHGIVEHOSTHUGSLOVEMEALMEATNUTSOVENPANSRYAHSAILSARASNOWWARMWIFEYAMSZEALACORNAROMAAVYNNBAKERBASTEBEANSBREADBROWNCANDYCANOECARVECIDERCRISPDEREKELYSEFEASTFLOATGAMESGOOSEGOURDGRAVYJAMESJAREDMAIZEPARTYPEACEQUAILRELAXROASTROLLSSALADSAUCESERVETASTETASTYTHYMETRUDYUNITYYUMMYAUTUMNBAKINGCLOVES...

Unit 3 Word Search 2025-11-07

99 Items: zoomomdaddollparkbirdfishcalmwifeswingcardsPre-kpuppyunclenieceblockspuzzlemuseumkittenrabbitturtledaringactivemotherfathersisterauntienephewto cryto liealwaysto jumpto drawdaycareoutsidecrybabyselfishparentsbrothergrandpagrandmacousinshusbandto fightto shareto colorto painttoy carstricyclecheckersaquariumobedientsiblingsgrandsonto laughto smile...

90 ~ ALL ABOUT BARBARA ~ 90 2025-01-10

1 Item: Alexander Amber Atlast ATJohnson AZavier Barbara Baseball birds Bloomington blueberries Bobbie Bogota books clamchowder colorfulflowers Colin Cooke crabcakes creamedspinach Doris earrings education Ellen elephants Europe Farm fishroe Gaithers garden games

90 ~ ALL ABOUT BARBARA ~ 90 2025-01-10

1 Item: Alexander Amber Atlast ATJohnson AZavier Barbara Baseball birds Bloomington blueberries Bobbie Bogota books clamchowder colorfulflowers Colin Cooke crabcakes creamedspinach Doris earrings education Ellen elephants Europe Farm fishroe Gaithers garden games

hi 2025-06-03

69 Items: PistolThe DubPistolsMinigunContentsDrum GunShotgunsRevolverBurst SMGNight HawkExplosivesCompact SMGHand CannonSix ShooterStorm ScoutPump ShotgunDrum ShotgunDual PistolsMachine GunsHeavy ShotgunSniper RiflesHunting RifleThe Big ChillQuad LauncherAssault RiflesInfantry RifleCharge ShotgunCombat ShotgunRapid Fire SMGMachine PistolShadow Tracker...

90 ~ ALL ABOUT BARBARA ~ 90 2025-01-10

1 Item: Alexander Amber Atlast ATJohnson AZavier Barbara Baseball birds Bloomington blueberries Bobbie Bogota books clamchowder colorfulflowers Colin Cooke crabcakes creamedspinach Doris earrings education Ellen elephants Europe Farm fishroe Gaithers garden games

Happy Word Search 2025-07-05

1 Item: BIRTHDAY, CAKE, CANDLES, BALLOONS, GIFT, RIBBONS, PARTY, MUSIC, CONFETTI, STREAMERS, LAUGHTER, FRIENDS, FAMILY, WISH, ICE CREAM, PIZZA, CUPCAKES, DECORATIONS, SURPRISE, PHOTOS, SMILES, GAMES, SODA, SNACKS, HUGS, DANCE, PRESENTS, FUN, LIGHTS, SWEETS, MEMOR

Peeta Word Search 2025-12-11

40 Items: the drunk guyto or at a distancestare angrily or sullenlyVolunteered for her sisterthat peeta gave to katnissskillfully, quickly, and neatlyvigor and spirit or enthusiasm.a false show, a make-believe actsaying the opposite of what you meanThe one that got reaped in district 12a quality that evokes pity or sadness....

English Words to Know 2025-01-16

43 Items: a pet animala place to sitthings you eata thing to readgood or pleasanta part of a housenot nice to look atthe liquid you drinkfeeling upset or madbeing nice to otherssomething to write ona place to buy thingsa place to buy thingsfeeling good, not sadfeeling bad or unhappynot big, little in sizenot small, large in sizea place where people live...

Peeta Word Search 2025-12-12

40 Items: The drunk guyTo or at a distanceStare angrily or sullenlyVolunteered for her sisterA food that peeta gave katnissSkillfully, quickly, and neatlyA false show, a make-believe actThe one that got reaped in districtSaying the opposite of what you meanA quality that evokes pity or sadnessBending and moving easily and gracefully...

Module 10 HMH Vocabulary 2025-02-01

23 Items: The 2nd VP of JacksonsNickname of the high tariff placed on importsThe creator of the Cherokee system of writingAn informal group of trusted(by Jackson) advisersThe practice of giving government jobs to political backersAn agency created to manage Indian removal affairs in western lands...

Sports-Medicine Word Search 2025-09-10

13 Items: First team physicianThe father of sports medicineThe primary physician in the care of the athleteA multidisciplinary approach to health care for those seriously involved in exercise and sportA healthcare specialist who designs special diets with the goal of enhancing athletic performance...

Eat Word Search 2025-01-23

1 Item: yummy treats, play tag, play with toys, go to the beach, go to the pool, play soccer, watch cartoons, play video games, go to the movies, go to the mall, have ice cream, go to a friend’s house, walk the dog

Careers in languages 2026-01-05

15 Items: Investigates stories globally and interviews people in their native tongue to get the most accurate "scoop."Develops the technology that allows machines to speak clearly and naturally in many different languages and accents....

Bloggers 3 - U2 - vocabulary 2026-01-22

33 Items: Another word for athletic.Making objects out of clay.Moving according to the music.Using pencil to create a picture.Musical instrument with a keyboard.A group of people who sing together.A person who likes games or toys is...Audiovisual footage recorded by camera.Another word for intelligent or clever.Composing ideas by putting them in text....

Wedding 2024-07-08

34 Items: Name of Trevor's baby nephewCaseys uncle who lives in WashingtonName of Casey's brother who loves musicCaseys cousin who is a Barre instructorCasey's cousin who has been to AntarticaName of Casey's brother who loves to golfPlayed baseball with Trevor in high schoolMark's wife who played softball in collegeName of Casey's niece who played volleyball...

It happened in 2024! 2025-10-10

10 Items: Dame Maggie Smith died in September this year, played whom in Downton Abbey?Which fast food chain celebrated the 50th anniversary of opening its first outlet in the UK in 2024?A scrap of what was incorporated into each of the medals awarded at the 2024 Summer Olympic Games in Paris?...

Pub Crawl 2023-04-14

64 Items: Oman portJordan portfrench portAfrican PortSunny day barMalaysia portPort for Romeport in Maltabar on deck 15Hawaii CapitalPort in TurkeyName of our ship2nd Spanish portport in Sri Lankabuffet restaurantEmbarkation port 1Embarkation port 2South American PortAmerican Samoa porthome to birj khalifaFirst port in Mexicofirst Port in Tahiti...

Poseidon and Sea Creatures 2025-10-28

29 Items: Sea goddess and wife of PoseidonCity contested by Poseidon and Athenathreed-proned staff/weapon of PosiedonGod of the sea, earthquakes, and horsesCyclops son of Poseidon; blinded by OdysseusCity whose walls were built by Poseidon and ApolloTitaness and wife of Oceanus; mother of the Oceanids.sided against Zeus and turned into a monstrous whirlpool....

4B 0609 2023-06-08

20 Items: In Taiwan, people use LINE to ______ with each other.There was an ______ in the building, call 119 for help !There are two ______ routes you can take to the library.Police believed the ______ got in through the kitchen window.The ________ walk around on the floor looking for food that people dropped....

Vocab Word Search 2022-10-18

20 Items: The product life cycle stage in which sales rise rapidly.The particular group of customers a business seeks to attract.People who personally use a good or service to satisfy their own wants.Goods and services purchased quickly and without much thought or effort.The product life cycle stage when the product first appears in the marketplace....

Volfest: Word Search 2025-03-21

55 Items: Having a clear intention or goal.A purpose-driven goal or objective.Work done to help or benefit others.Working together towards a common goal.A new plan or effort to achieve a goal.Unity and mutual support within a group.Something given or done to help a cause.Assistance provided to those in distress.Help or support given to someone in need....

Gagan Word Search 2025-03-21

63 Items: gaganMerakiHeartistGoodwillJoyweaverSmilesmithChangemakerWholeheartedHaving a clear intention or goalA purpose-driven goal or objectiveWork done to help or benefit othersWorking together towards a common goalA new plan or effort to achieve a goalUnity and mutual support within a groupSomething given or done to help a cause...

Here’S Word Search 2025-03-21

55 Items: Having a clear intention or goalA purpose-driven goal or objectiveWork done to help or benefit othersWorking together towards a common goalA new plan or effort to achieve a goalUnity and mutual support within a groupSomething given or done to help a causeAssistance provided to those in distressHelp or support given to someone in need...

Foundations Review 2024-08-15

25 Items: actions of two or more rivals in pursuit of the same objective.Not using a good or resource to the maximum amount of efficiency.Allocating resources available in a way that benefits you the greatestMoney made by a business or individual after costs have been taken out.Obtaining the most possible satisfaction from a given amount of resources....

Back When? Back Then. 2026-02-10

38 Items: The "Fab Four" band that changed music forever.The iconic wide-legged pants from the groovy era.The trendy sneakers that came up over your ankles.The material your favorite blue jeans are made of.The shimmering, dancing style that ruled the 1970s.A 1960s slang word for something really cool or excellent....