health Word Searches

Time Word Search 2025-04-28

100 Items: waydaymanloteyejobendlawcarkidartwarguyairtimeyearlifehandpartcaseweekworkhomeroomareafactbookwordsidekindheadhourgamelinecitynameteamideabodybackfacedoorgirlthingwomanchildworldstategroupplacenightpointwatermoneystorymonthrightstudyissuehousepowerlevelpartyforcepeopleschoolfamilysystemnumbermotherfriendfathermemberminuteparentothersofficehealth...

7th Grade 2025-10-20

100 Items: AVASunWikArtKIYAAYLAKINGLAWSEMMAJAKEFOOTSafeKindMathShopBANKSNIXONGEHRTDIXONTOMASKLINGGRACELOGANTEVYNGRANTSONESSTARRTWISSRYLEEWaughLunchVICTORCUEVASBRODENZAYLEEGOLDENANIYAHGORDONDECKERGORDONHARRISNATHANHILTONJAETYNKELLERKANNONDECLANKRUGERMARTINNELSONCARTERDARIANZARATENEVAEHZILLERDANIELLeflerWilsonCoomesJordanHealthRecessMACKSONBRAXTONFANCHERCAMBREE...

Happy New Year!!! 2026-01-06

100 Items: HopePathGoalsFreshFocusLearnResetHabitSparkGrowthChangeDreamsFutureVisionHealthCreateEnergyDrivenEffortThriveUpliftAspireNewYearJanuaryReflectPromiseImproveAchieveSuccessInspireBalanceMindsetPurposeCourageExploreImagineBelieveRestartRebuildRefreshElevateFocusedRoutineInsightJourneyForwardEmpowerResolveMindfulRenewalProgressAmbitionPlanningWellness...

Guilford County Reentry Resources 2026-05-30

100 Items: WayOurNewDayOneFitADSHopeOpenDoorArmyStepWardHighFoodGCCNSeedStopTeenHireGTCCKnowTriadUrbanEPassPointParksAdultHouseLearnFamilyUnitedExpertAlmondChanceChangeFencedStreetClinicMentalHealthRisingBudgetOxfordGrowthSkillsActiveResumeCopingCareerEthicsEmployPurposeProjectJourneyReentryFurtherFreedomMustardMindsetSuccessAwesomeEducateServicesPiedmont...

Sabah Oxygen - P1TA18 2024-07-08

102 Items: tophoseventtesttripzeroworkareadownlevelicingtopupnightshiftinertentryvalveplantspacesmokephonespeedlimitalarmcraneshoesupdateonlinebypassliquidbottomweightdialogvacuumoxygenhealthsafetyleaderpermitenergyheightsourcemobileglovesofflineisotankstandbymorningpurgingreactorstartupprocessdrivingvehicleprojecttoolboxliftingcoolingglassesleathernitrogen...

Mega Word Search (2) 2024-11-12

100 Items: busyagreebuildcloudearlyearthfieldfruitgroupguardguessheardoftenpeaceafraidanimalanswerappeararriveAugustautumnbrightcaughtcentrechancechangecircledecideenoughfamousflowerfriendfuturegardenhealthislandminutemodernnoticepeopleweightaddressamazingbelievebetweenbreathecenturyclimatecountrycourageexplorefinallyholidayimaginejourneylibrarymeasuremention...

2025 hypixel skyblock wordsearch! made by allyns on minecraft 2025-03-27

100 Items: sampetsgoldgoldbankharpmanajerrysimondantejacobanitamagicpestsspeedgardencombatforumsmayorsmuseumislandwizardthehubsummerautumnfrostyhealthsocialratpetgrowthlegionwisdomhypixelfarmingfishingalchemyreforgefanwikiminionstimedeotheparkthefarmstjerryredgiftdefensechimeraskyblockforagingdungeonssquidkidauctionsgoldmineteleportarmorsetminecraftcarpentry...

Time Word Search 2025-09-18

100 Items: waydaymanloteyejobendlawcarkidartwarguyairtimeyearlifehandpartcaseweekworkhomeroomareafactbookwordsidekindheadhourgamelinecitynameteamideabodybackfacedoorgirlthingwomanchildworldstategroupplacenightpointwatermoneystorymonthrightstudyissuehousepowerlevelpartyforcepeopleschoolfamilysystemnumbermotherfriendfathermemberminuteparentothersofficehealth...

Goal 6: Clean Water and Sanitation (100 Words) 2025-11-17

100 Items: AidHotMapPayTapWayCostDropFlowGoalHomeHopeKeepKindLifeLoadMakeMealNeedPureRainSafeSaveWellWashGoodMainSafeCoolTidyTaskCleanDrinkEarthFreshOceanRiverShareWasteWaterServeClearFloodAccessFamilyFilterHealthListenNatureStreamReducePlanetFilterSourceEnsureModelsSafetyPolicyActionAccessRepairSystemGrowthProtectSustainImproveHygieneSupportRespondQuality...

Goal 6: Clean Water and Sanitation (100 Words) 2025-11-17

100 Items: AidHotMapPayTapWayCostDropFlowGoalHomeHopeKeepKindLifeLoadMakeMealNeedPureRainSafeSaveWellWashGoodMainSafeCoolTidyTaskCleanDrinkEarthFreshOceanRiverShareWasteWaterServeClearFloodAccessFamilyFilterHealthListenNatureStreamReducePlanetFilterSourceEnsureModelsSafetyPolicyActionAccessRepairSystemGrowthProtectSustainImproveHygieneSupportRespondQuality...

1. Word Search 2026-02-05

100 Items: RunEatJoySpaSunAirZenFunWalkCalmRestBathYogaBodyMindSoulLoveReadCookLifeCareHealSleepWaterFruitRelaxPeaceHappyWholeFocusFreshLaughDanceQuietHealthStressEnergyActiveStrongSpiritVeggieHabitsNatureMuscleListenGentleChoiceMentalGardenActionFriendFamilyMotionLivingGrowthUnplugBreatheFitnessHealthyBalanceNourishHydrateJournalTherapyVitaminHuggingStretch...

U2L1 # 2 2026-05-12

22 Items: – en– casi– fácil– tarde– difícil– temprano– el examen– muchos(as)– los exámenesis/are... – hay...have to – tener quemany? – ¿Cuántos(as)?– La clase de mecánica– la banda choir – el coro– el arte English – el inglés– la historia Math – las matemáticas– la soldadura woods – la carpintería– las ciencias PE – la educación física...

Smart Word Search 2025-08-07

100 Items: PenBayEyeDogSynSunLovePinkBackFakeBallBlueViewBakeTurnBookBeerDareRainDareHopeHomeRiseFeelCalmSmartPhoneSmileAppleLaughDreamHappyValidBlackWriteBrainBreadMusicHeartEnterDrinkPaperDailyHungerDesireHumbleSearchCoffeeDragonEnergyFamilyMobileHealthVanillaHonestyFreedomMindfulForgiveMessageNumbersCorrectBelieveBlessedFingersCompanyExamplePaymentRespect...

Goal 1: No Poverty (100 Words) 2025-11-17

100 Items: UsAidBuyGetJobOwnPayTryBankCareCashCopeCostEarnFairFeedFoodFreeGiveGoodGrowHomeHopeKindLifeLoanLookLoveManyMealNeedPlanRentSafeSaveStayUnitWantWarmWellWorkZeroHopeBasicCheapDreamEqualHappyLearnMoneyPeacePowerPriceProudRaiseReachShareStartTruthWorldValueAssistBetterBorrowBudgetChangeChoiceCreditDinnerDonateFamilyFriendFutureHealthHonestIncomeInvest...

Search 2025-11-27

100 Items: doghothalfstirickyslimkeenbentcardriceleftsickgripshowkindpartfearfaceninedanceamucksniffdaffyspilldelaybirdsquietplanevaguereadysenseworryhealthknottyemployspringgreasysquarestrokeislandchargeextendwindowracialappearcelerydinnerreturnporterorganicfriendsdynamicgainfulexaminelonginghellishprogramdelivermundanezealousprotectelasticroastedreligion...

spanish 2026-04-21

41 Items: whyallbadmeatfishpeasriceI domanyoniondinnergrapesgrainsfruitsbutteryou dochickenlettucecarrotsto walkI thinkbecausepotatoestomatoespastriesI preferto thinkspaghettiice creambeveragessomethingbreakfeastI'm hungryI think sogreen beansI'm thirstyshould mustdia everydayto lift weightsfor ones healthtasty falvorfull

ANTONYMS 2014-12-14

103 Items: buywetlowfarnewrawnonedullidlecoldwesteasydeadcomegoodsoftthinfindshowmissrudesoftrichfalltamechildawakebeginworsecursewhitedirtynightearlyemptyenemyhappyfreshfirstnevergiantfrontdepththerewaterleastoutersobernoisyroughurbanfalselearnsmileabsentrejectactivedepartattackbeforerevealsafetylatterfuturehealthvalleyexhalesorrowseniordivideliquorborrow...

Stage 20 Culture Review 2023-05-11

23 Items: nikenikenikepseudo-sciencefather of medicinecenter of learninggreat griffin golfergreat griffin runnermade first water-clockAlexandrian astronomermade first steam turbinewrote a geometry textbookmeasured the circumferencefamous 20th century doctorfamous 20th century authorRoman contribution to healthtitle of first geometry textbook...

Amateur Radio Emergency 2024-11-19

25 Items: Resource managementSevere weather eventMessage routing systemPersonal status updateHealth status reportingCritical system supportPower supply reliabilityAlternative signal bandsTemporary safety locationInfrastructure assessmentCommunication alternativeNatural disaster scenarioCommunication coordinationEmergency event management...

Wild Swans Word Search 2025-03-21

21 Items: Mercy Ch 17Tings Ch 19Hiding Ch 17Victims Ch 16Suicide Ch 16Red Chengdu 20Denounce Ch 20Peasant Ch 21Loyalists Ch 19Meteorite Ch 21Jaing Qing Ch 15Knowledge Ch 15Gentleness Ch 16Scapegoating Ch 17Yan and Yong Ch 20Health Clinic Ch 18Pick pocketers Ch 18The People Daily Ch 15Communist Officials Ch 18Two Hundred Million Ch 21...

Stress Word Search 2025-04-14

100 Items: BadFunJoySadZenBlueBodyBusyCalmCoolFlowGoodHardHelpLifeTimeWalkWorkYogaAngryExamsGoalsHappyHumanJollyMerryMusicPeaceProudQuietReadyRelaxSpaceSportStudyUpsetVibesWorryCourseEnergyFamilyHealthMemoryMentalNatureSchoolStressStrongTemperUnsureUnwindAnxietyBalanceBoredomBreatheCapableCollegeContentFailureFlowersFreedomHobbiesLessonsLibraryReadingSuccess...

YMCA 100 Year Anniversary 2026-06-05

100 Items: funjoyrunbodycampcaredrawmindopenplaysafeswimwalkYMCAyogacoachcycledancefaithgameslaughlearnproudsharesmileunityyouthactivebrightcaringenergyfamilyfuturegivinggrowthhealthimpactleaderlegacymentorsportsspiritstrongupliftvaluesvisionachievebalancebreatheempathyempowerexplorefitnesshelpfulhistoryhonestyinspiremissionpurposerespectservicestretchsupport...

Getting Motivated to Change S1 2026-06-23

100 Items: godgrowworkwilllifeideapeerfearbeginthinkalterforcedreamgoalssmartfaithguiltmoneychangeaspiredesirefuturehealthfamilymentordefinewisdomfixatetargetbeliefgettingaspectsconductdrivingpurposeprogramsuccessfriendsparentsmethodshurtfulspecifyearnestbehaviorattitudeinternalexternalpersonalcoworkerpatiencespecificproblemsfeelingslazinessmotivatedimpactful...

Money Matters 2025-10-01

17 Items: Something you oweFixed pay for a jobWorking for yourselfPay after deductionsPay before deductionsMoney taken out of payPay based on sales madeMoney earned or receivedMoney spent on somethingPay based on hours workedSomething valuable you ownHealth insurance for seniorsExtra money given for serviceA plan for income and expenses...

Pathophysiology Word Search 2025-01-25

20 Items: The cause(s) of a diseaseHow the disease process evolvesThe physiology of altered healthA compilation of signs and symptomsThe functional effects of a diseasePresent at, and usually before, birthA manifestation that is noted by an observerThe death-producing characteristics of a diseaseAggravation of symptoms and severity of the disease...

Heidi 2024-06-10

12 Items: to like: __________being bad: __________the lowest part: __________having good health: __________to go into a place: __________a large, grand house: __________not being able to see: __________a chair for people who can't walk: __________Peter pushed the wheelchair down the __________.Heidi's grandfather had two __________ that gave him milk....

Physical Activity 2026-04-24

19 Items: Outdoor spaceBad consequencesGood consequencesActivity with rulesrules and regulationsYoung people aged 13-17The state of being activePeoples views and beliefsChanging physical positionpaid position of employmentMāori holistic view of healthmore opportunities than othersless opportunities than othersA result of something happening...

Reform Review 2025-04-10

10 Items: The right to voteThis lead to the reform eraThe man who reformed schoolsHarriet tubman's famous railroadThe book showing the world slavnerySusan Anthony and Elizabeth StantonThe fight to decrease achocol consumptionThe man who wrote The North Star newspaperThe hudson river school and this go togetherThe woman who reformed mental health and prisons

Global Crises Scramble 2026-03-10

14 Items: TSTMEELTENS (Where humans live)TAREW (H20)_____________________________EGA (How old you are) ___________________DOOF (Solving world hunger)__________________EACPE (no fighting) ___________________________WAL ADN TJSIECU (Legal process)_________________________OPALUTIPNO (the number of people) _________________________...

Shannonstrange Word Search 2023-06-22

99 Items: msgfdaalt317326319frmsosprdled3859botoxjapanbadgeindiadonuthippaswirlbatchbmramrigidcrackemptymrnobuauditssnacksinvertliquidopaquealtheaclienthybridjobaiddefectbrokenhealthjohnleegermanykimtechproductlowfillsareptalockersplacardsshutdownnewhiresperiodicatypicalmedicinemeltbackhazardousrejectboxdropgaugeclearanceprojectidbiopharmasteeltoeshazardous...

Thanksgiving 2025-11-16

100 Items: EatNapPieBakeCornDishFarmFastFoodGoodHomeHopeLoveMealNutsOvenSideAcornAppleBeansBreadBrownCheerCiderFeastGourdGravyGreenHonorLoyalMaizeMercyPartyPeacePecanPlateQuietRoastRollsShareSpiceSweetTableAutumnBasketBountyButterChurchColonyDinnerDonateFamilyFellowFlavorFriendGatherGivingGobbleHealthHumbleLessonMemoryNativeOrangeParadePeoplePrayerRecipe...

Goal 1: No Poverty (100 Words) 2025-11-17

100 Items: UsAidBuyGetJobOwnPayTryBankCareCashCopeCostEarnFairFeedFoodFreeGiveGoodGrowHomeHopeKindLifeLoanLookLoveManyMealNeedPlanRentSafeSaveStayUnitWantWarmWellWorkZeroHopeBasicCheapDreamEqualHappyLearnMoneyPeacePowerPriceProudRaiseReachShareStartTruthWorldValueAssistBetterBorrowBudgetChangeChoiceCreditDinnerDonateFamilyFriendFutureHealthHonestIncomeInvest...

Cheers To The New Year!! 2025-12-26

100 Items: EveNewJoyHourYearTimeBallDropHostGalaHornGlowMaskGownGoalWishHopeClockWatchPartyMusicEventToastPunchFeastGlassFluteSnackNoisePeaceDreamFreshStartTwelveFutureStrikeFamilyGuestsSoireeBuffetCheersDinnerEntreeBannerLightsBrightTuxedoChangeGrowthHealthMemoryCheersJanuarySecondsMinutesDancingFestiveFriendsHolidayBubblesDessertSparklePlatterSpiritsGlitter...

WH 2026-02-25

100 Items: CAREICONSPOETSPOWERVOICEACCESSALLIESBALLOTCHANGEHEALTHIMPACTJUDGESLEGACYMAYORSNURSESRIGHTSSAFETYVOTINGARTISTSAUTHORSBRAVERYCOACHESCOURAGEDIGNITYDOCTORSEDITORSFREEDOMJUSTICELAWYERSLEADERSLIBERTYPASSIONPURPOSESERVICEAMBITIONATHLETESCHEMISTSEQUALITYFOUNDERSHERITAGEMANAGERSMOVEMENTPAINTERSPIONEERSPROGRESSSCHOLARSSENATORSSTRENGTHTEACHERSACTIVISTS...

Maggie Word Search 2026-06-05

96 Items: BenArtNoraLucyCoraLiamLiviAlexTheaIvanAxelMathStormGhaniGrantAbbyKBobbyNaomiAbbyRGretaNawalAveryTakinBellaDylanTessaVivieMusicLunchOperaMaggieMargotArthurJordynWatsonNoelleFinlayConradAndrewHarrisVanderLinneaConallSummerOliviaConnorElilliSerenaJuliusLenoreWestonWalterElijahLaineyWillieHaakonJosiahHealthRecessCodingStephonWilliamMalcolmGabriel...

Safety with Fun activity 2025-12-04

3 Items: ::Power Zone Slip Trip Fall Gloves PPE Safety Health Ergonomics Harness Amcare

World Literacy Day 2022 2022-09-01

12 Items: PE is an exampleMath is an exampleMusic is an exampleThe sciences are examplesEconomics & Business are examplesPsychology and Islamic are examplesEnglish and world languages are examplesJournalism and Film Studies are examplesCreative Writing and English are examplesthe ability to communicate in varying contexts...

Einstein Word Search 2025-10-31

12 Items: recipient of a Nobel Prizecity where the prizes are awardedrecognizes outstanding written workphysics laureate known for relativitycity hosting the Peace Prize ceremonyprize for advances in economic scienceinvention that funded the Nobel Prizesawarded for discoveries improving healthhonors breakthroughs in molecular science...

Unit 17 2026-01-21

12 Items: harmfulfull of life, cheerfulpreserve in memory foreverclear and sharp impressioncause extreme embarrassmentable to break down naturallyin a dying or death like stateharmful to physical or moral healthmutually beneficial to one another's lifethe act or process of bringing back to lifeto take an unhealthy interest in unpleasant things...

EXPLORING THE ALLIED HEALTH COMPETENCY MODEL 2023-08-21

4 Items: recordkeepingindustrycompetency

Vocab 10 2023-10-23

11 Items: footto sharpengreat sufferingcause of unhappinesscome together as one unita total or humiliating defeatto defraud or swindle; to cheatinjurious to health or morals; poisonousto increase the severity of; to aggravateone who is intolerant especially in matters of religion, race, or politics; racist...

Health and Wellness 2025-04-01

2 Items: aprilfools

Unit 17 Word Search 2024-03-05

12 Items: causing damage, harmful.cheerful and full of life.supporting one another’s life.in a dying or death like state.to preserve in the memory foreverable to be broken down naturally.harmful to physical or moral health.causing the death of living organismsto cause the extreme embarrassment to.the act or process of bring back to life....

Compound Words Unit 10 2026-04-14

10 Items: Pain in the abdomen.A chair fitted with wheels.Feeling a great sense of wonder.For all future time; for always.A broadcast of current news reports.In a foreign country across the ocean.Satisfactory, acceptable, or in good health.Noisy excitement, confusion, or public outrage.An expression used at the end of a conversation....

Open Enrollment 2022-10-03

11 Items: dental plan providerRetirement departmentvision plan provider abbreviationHealth Savings Account Abbreviationoptional benefits like pet insuranceThe new medical plan provider for 2023Flexible Spending Account AbbreviationDiscount provider for wellness discountsWhere you log in to review/change your benefits...

HEATH & SAFETY 2025-09-28

11 Items: REGULATION COVERING SAFETY WEARREGULATION COVERING LIFTING AIDSregulation covering kinetic liftingregulation covering access equipmentREGULATION COVERING HAZARDOUS SUBSTANCESregulation covering equipment used on siteREGULATION COVERING WORKING IN CONFINED SPACESTHE LEGISLATION COVERING ALL REGULATIONS AT WORK...

Translucent Word Search 2023-03-14

100 Items: translucentunderservedsuitabilityinquisitiveegalitarianorchestratecombinationinsensitivetwo-bedroomstand-aloneculminationcontentiousuncertaintyappointmentincrementalgrasshopperbelligerentdemocratizesalespeopleforeseeableconsecutiveinformationinstitutionawkwardnessfluctuationproliferatenervousnessattitudinalrespirationsubordinatememorabilia...

Safety Terms Word Search 2025-09-02

55 Items: OVAfiresmokehazardcogentincidentcontrolssecuritycode-redconvergecode-greyspill-kitwork-safecommitteeevacuationleadershipfire-doorsmock-codeselectricityinspectionscode-purplearea-wardenchief-wardenfire-curtainconsultationde-escalationcommunicationgas-cylinderssafety-cultureriskman-reportmanual-handlingdangerous-goodssafe-work-limitrisk-assessment...

Cyberbullying 2024-09-12

25 Items: Software that damages a device or steals informationInformation that isn’t true, often created to trick peopleInformation- A way to get help from a website if someone goes wrongA person who uses a fake online persona to gain the trust of someone else.Software designed to gain unauthorized access to and disrupt or damage a computer system...

Hospital Words 2025-05-30

99 Items: EMS,ICU,CareMRI,Draw,Care,Dead,Nurseswab,Womb,Cough,COVID,Death,gland,Rehab,CanterWoundeAgency,Biopsy,Center,Clinic,Dental,Doctor,Fester,Health,Doctor,Center,Medico,Office,organs,Trauma,Dentist,Disease,Funeral,Hospice,PharmacyHospitalNursing,Ovaries,Patient,HospitalSurgeon,Surgery,Clinical,Delivery,Dialysis,Doctoral,Hospital,Location,Meconium,...

Study Word Search 2025-08-18

105 Items: keyfunartwifiexamnapscooklockclubchattidygoalgrowstudycleanmusicpartyquietbillsnotesalarmpatiofloordecorrelaxfocusshareunitysmilehellotrustgamesplantlightpeacecoffeefinalsfridgesnacksloungemovieschoresdishesbudgetgradescampusenergybuzzerpostercreatehealthsafetyeventssportssignuplistenengagevisionlaundrykitchenrecycleweekendnetworkrespectfriends...

Adapt Word Search 2025-12-19

104 Items: QHARTCATDIYDOGFINFUNIBIJOYMAPBOOKCARECLIPFISHFLOWHIKEHOPEJAZZLEGOLUNAPONYRESTRIZZROCKSKOLSNOWTOOTWINGSELFADAPTBEACHBOXERBUNNYDAIRYGAMESGRACEHIPPOHUMORHUSKYINSPOMUSICPARKSPEACEPHOTOQUILTSLEEPTROUTTRUSTWEAVECOLLABDELULUENERGYGARDENHEALTHNATUREPOSSUMPURPLERASTERSTREAMTICKETVISIONAGILITYBALANCEBARBELLCAMPINGCHICKENCLAPTONCOMFORTCOURAGEFITNESSFRIENDS...

Health Information - Due by 3/23/26 @ 11 a.m. for a chance to win a prize!! 2026-03-16

27 Items: ROIPHIAriaJosiMaryTorySusanDixieHIPAAAimeeCodingBaileyChartsUploadClerksShannonPrivacyLindseyVeradigmScanningSecurityAssemblyKristinaKimberlynAbstractingDeficienciesTranscription

Mysteries and Investigations 2022-10-19

24 Items: lowlyaboutsectionsomewhatrecordedpanickedcompletepresent daylooking afterpeople in chargelet out blood fromarea under controlhung in one positionstayed close togetherin direct contact withperson serving militaryone-celled living thingstowns without people leftspoke without making sensesubstance that kills germswidespread attack of a disease...

Adapt Word Search 2025-12-19

104 Items: QHARTCATDIYDOGFINFUNIBIJOYMAPBOOKCARECLIPFISHFLOWHIKEHOPEJAZZLEGOLUNAPONYRESTRIZZROCKSKOLSNOWTOOTWINGADAPTBEACHBOXERBUNNYDAIRYGAMESGRACEHIPPOHUMORHUSKYINSPOMUSICPARKSPEACEPHOTOQUILTSLEEPTROUTTRUSTWEAVECOLLABDELULUENERGYGARDENHEALTHNATUREPOSSUMPURPLERASTERSTREAMTICKETVISIONAGILITYBALANCEBARBELLCAMPINGCHICKENCLAPTONCOMFORTCOURAGEFITNESSFRIENDSGLITTER...

BIO 345 Chapter 1 Word Search - MC 2025-09-05

20 Items: - A group of people- The cause of a disease- The physiology of altered health- Defects that are present at birth- A complication of signs and symptoms- Death rates for a specific population- A manifestation that is noted by an observer- Aggravation of symptoms and severity of the disease- The study of disease occurrence in human populations...

SAGE Diversion 2016-04-20

110 Items: ArtMathLabsTextDeskSageLateBandFireNounVerbPoemsPaperLunchFieldTripsChairBenchTardystartDanceChoirdrillStudyFlashcardsclaimSimileSocialHealthSchoolBreaksSportsLockerBussesIdiomsGradesClaimsAdverbTestingReadingScienceWritingStoriesQuizzesHistoryStudiesPencilsGrammarFriendsLibraryCoachesJanitorFacultyCarpoolCounterLanguageMetaphorPrefixesSuffixes...

PACE 2025-05-31

100 Items: ELMAIDBARNDORMFERNPLANPACEPONDTEAMDEANSDYSONFAFSALUBINMARKSMEDIANORTHPATONPRIDESANDSSTUDYTBONEALUMNICAMPUSCHOATEGRADESHEALTHHONORSJUNIORKESSELMARTINMILLERNATURESENIORSOCCERSPIRITADJUNCTBUTCHERDIPLOMAFACULTYGANNETTLIBRARYMASTERSMORTOLANURSINGPROVOSTSCIENCESETTERSWELCOMEWILLCOXADVISINGBOUDREAUBUSINESSSERVICESCOMMUTERCOSTELLOFINNERTYFOOTBALLFRESHMAN...

El cuerpo y la salud 2026-02-11

20 Items: toearmpillcoughhealtha coldaccidentouter earprescriptionwhat you gargle withdónde trabaja una doctoraevidencia de una enfermedadthe body part that you hear withmedicina para curar una infecciónthe joint in the middle of your legthe person you see before the doctorthis organ pumps the blood in your bodythe joint that joins your leg with your foot...

Swachhta Pakhwada 2025 01st July – 15th July 2025 2025-06-28

48 Items: Water outletSweeping toolCleansing agentWaste materialsNeat and orderlyUnwanted materialScattered rubbishHygienic and cleanSanitation facilityContainer for wasteState of well-beingWaste disposal pipeContainer for trashLetting fresh air inReuse waste materialsBasic toilet facilityBreaks down naturallyPromise to stay cleanAction to tidy an area...

G&L Roots-Unit 17-Word search 2025-02-10

13 Items: onescausing damage, harmfulcheerful and full of lifein a dying or death like stateable to be broken down naturallyto preserve in the memory foreverharmful to physical or moral healthto cause the extreme embarrassment tothe act or process of bring back to lifetaking an unhealthy interest in unpleasant things...

Older Americans Mental Health Week May 24-30, 2026 (Last Full Week in May) 2026-05-24

14 Items: artyogasleeptaichiwalkingaerobicslaughtergardeningnutritionconnectionmeditationjournalingjigsawpuzzlesspiritualliteracy

CPPI Team Building June 2023 2023-06-27

12 Items: (USDA Innovation Hub)(Diabetes Prevention Program)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(Illinois Public Health Institute)(Building Resilient and Inclusive Communities)(State Physical Activity and Nutrition program)(Coalition founded, managed and staffed by IPHI with a new name)...

Health Related Components and Skill-Related in Physical Fitness 2023-09-12

6 Items: catlionzebrahippoelephantMan's best friend

"Find Me" 2025-03-28

6 Items: A caring guide who leads and protects.The promised deliverer or leader sent by God.Someone who restores health or makes others well.One who saves people from sin and its consequences.A person who shares wisdom and guides others in truth.Someone who rescues or buys back, especially from sin or evil.

Vocab - R Words 2026-02-25

13 Items: To make up forTo make friendly againTo restore to confidenceWild or disorderly conductA social gathering or partyTo make right (for a wrong)A basic reason or explanationProfusely widespread or commonHaving an unpleasant smell or tasteTo recover or regain health or strengthTo remember something forgotten or overlooked...

Chayei Sarah 2024-11-17

18 Items: אָבִינוּחַיַּי שָׂרָהRebekkah’s fatherAbraham’s servantRebekkah’s brotherThe first matriarchSarai means ________“to boast about G-d”Abraham’s other wife.King David’s personal prophet.This son of Abraham lived to 137The city in which Sarah is buried.These 2 Hebrew letters spell “father”This Hebrew letter represents revelation....

AH Word Search #1 2023-05-11

2 Items: What is the abbreviation for Online Health?What phone status should be less than 5 minutes?

chance's about me 2025-01-06

15 Items: My name is?how old am I?Do I like food?My puppies name is?My favorite game is?how much do I weigh?Something I'm good athow many dogs do I have?how many cats do I have?do I like PE or Health more?what is another game I play?what type of iphone do I have?do I use an apple or an Samsung?am I currently bulking or cutting?...

Epidemiology - Topic 4 2023-01-27

8 Items: Type of observational study designDoes it has comparison group? (T/F)A type of observational study designUsed to identify the c_____ of diseaseInvolving designing a study to test one or more h____Any factor that might influence the risk of disease (E____)Analytical epidemiology addresses "w___" a health problem occurs...

Inheritance Word Search 2024-08-03

11 Items: High in omega-3 fatty acidsRich in protein and vitamin DDense in vitamin K and calciumPacked with probiotics and proteinA complete protein and rich in fiberRich in plant-based protein and ironPacked with healthy fats and vitamin EHigh in fiber and supports heart healthA leafy green rich in iron and magnesium...

Unit 18 2024-03-05

12 Items: causing damage, harmfulcheerful and full of lifein a dying or death like stateable to be broken down naturallyto preserve in the memory foreverharmful to physical or moral healthto cause the extreme embarrassment tothe act or process of bring back to lifetaking an unhealthy interest in unpleasant things...

Greek and Latin Unit 17 2025-02-10

12 Items: causing damage, harmfulcheerful and full of lifeto preserve in memory foreverIn a dying or death like stateAble to be broken down naturallyHarmful to physical or moral healthto cause the extreme embarrassment tothe act or process of bring back to lifetaking an unhealthy interest in unpleasant thingsmutually beneficial,supporting one another's lives...

Nursing Burnout Crossword 2025-04-10

12 Items: Digital patient recordsGuiding, inspiring, and supporting a teamEmployee departure within an organizationTools or support needed for effective careAbility to adapt in the face of challengesStress, exhaustion, and fatigue in healthcareMeasures taken to protect health and prevent harmClinical decision-making and professional judgment...

Mmortalize: Word Search 2026-01-21

12 Items: causing damage, harmfulcheerful and full of lifeto cause extreme embarrassmentin a dying or death-like stateable to be broken down naturallyto preserve in the memory foreverharmful to physical or moral healththe act or process of bringing back to lifetaking an unhealthy interest in unpleasant thingsmutually beneficial, supporting one another’s life...

Unit 17 2023-02-23

12 Items: Causing damage, harmfulCheerful and full of lifeIn a dying or death like stateTo cause extreme embarresment toAble to be broken down naturallyTo preserve in the memory foreverHarmful to physical or moral healthTaking an unhealthy intrest in unpleasent thingsMutualy beneficial, supporting one anothers life...

Perfect 12#15 2026-05-21

15 Items: extremely fatboisterous; unrulyharmful to the healthtoo economical; stingythreatening; predicting evilapparent; pretended; professedcausing injury; evil or wickedhatred; the state of being hateda wild disorder, noise, or confusionhaving to do with what is being consideredhaving unlimited knowledge; knowing everything...

Infection Control 2022-11-02

20 Items: To dispose ofSafety Data SheetAn item that is reusableAn item that is disposableAmount of time to disinfectQuaternary Ammonium CompoundsThe ability to produce resultsEnvironmental Protection AgencyThe transfer of harmful bacteriaCaused by streptococcus bacteriaCan be used again and disinfectedKills certain pathogens on surfaces...

Greek and Latin roots 17 2026-01-21

12 Items: causing damage, harmful.cheerful and full of life.in a dying or death like state.able to be broken down naturally.to preserve in the memory forever.harmful to physical or moral health.to cause the extreme embarrassment to.the act or process of bring back to life.taking an unhealthy interest in unpleasant things...

Greek and Latin roots 17 2026-01-22

12 Items: causing damage, harmful.cheerful and full of life.in a dying or death like stateable to be broken down naturally.to preserve in the memory forever.harmful to physical or moral health.to cause the extreme embarrassment to.the act or process of bring back to life.taking an unhealthy interest in unpleasant things....

Vit/Viv 2025-05-12

9 Items: clear, or brightto bring back to lifeto exist, or to stay alivenecessary, or essential to lifea food substance that aids healththe act of cutting open live animals for scienceattractively animated, or lively (related to a person)friendly, lively, and enjoyable (atmosphere or event)....

PhT 100 Word Search 1 (Spring 2024) 2024-05-09

17 Items: To grind to a smooth substance with moisture.The basic unit of weight in the apothecary system.The dating of any medication that has a short shelf life.The liquid in which another substance is being dissolved.The determination of the covererage an insured is entitled.Complete destruction of organisms after they leave the body....

El Consultorio 2025-10-13

35 Items: bodybloodclinichealtha coldto fallto hurtcheckupsymptomto coughpharmacyhospitalto bleedaccidentto sprainto sneezea bandaidoperationinner earto be sickto run intoto get sickto get hurtthe dentistto get a shoto have painto be alergicthe outer earto break a boneto have a feverdoctor's officeto have a sicknessto take out a toothto give a prescription...

Reading Word Search 2025-09-04

107 Items: REDEYEEARARMLEGRUNMAPSKYSUNHOTDOGCATHEROBOSSKINGFILMSONGBLUEFACEHANDFOOTBODYFOODSWIMJUMPWALKMOVELAKEMOONSTARRAINWINDCOLDCOOLBIRDFISHLIONBEARTREEHOMEROOMMOVIEMUSICDANCESTAGECOLORGREENBLACKWHITEPHOTOSMILEMOUTHFRUITWATERSPORTDANCEHOTELRIVEROCEANSUNNYRAINYTIGERHORSESNAKEHOUSELEADERPRINCEYELLOWCAMERAHEALTHTRAVELTICKETFORESTSEASONSPRINGSUMMERAUTUMNWINTER...

Sussing out the Freeport Seuss 2026-02-05

20 Items: Our mascotTheodor GeiselMr. Brandt's slangThe Spring musicalLet's make this...Where the Whos liveHow Mr. Stell studies"Everybody needs a..."Our broadcasting networkMidway mental health dayBut let's make that our...Mr. Cooper's favorite bandWhat thneeds are made out ofSam-I-Am learns to love theseFreeport's favorite gas station...

SPA2 U5 Vocab Word Search 2026-02-25

47 Items: foodrisktripsafecashexitcheapcheckpilotbeachaccessbudgethealthchangeflightmarketmuseumto landto findto planto stayclimateseriousluggagetouristsouvenirincludedentrancesuitcasepassportsecuritymonumentto changeto decideto travelexpensiveforeignerto take offto check-incredit carddestinationto say goodbyeaccommodationscosts/expensesto board/embark...

Infection Control 2026-05-16

20 Items: To dispose ofSafety Data SheetAn item that is reusableAn item that is disposableAmount of time to disinfectQuaternary Ammonium CompoundsThe ability to produce resultsEnvironmental Protection AgencyThe transfer of harmful bacteriaCaused by streptococcus bacteriaCan be used again and disinfectedKills certain pathogens on surfaces...

Unit 1 vocabulary Animals 2026-03-26

14 Items: TO HURTTO NEEDNOT KINDWHERE SOMETHING COMES FROMTO FEEL PAIN OR UNHAPPINESSVIOLENT OR UNFAIR TREATMENT OF SOMEONETO BECOME LIQUID AS A RESULT OF HEATINGSOMEONE'S OR SOMEHTING'S HEALTH AND HAPPINESSA POSSIBILITY OF TROUBLE, DANGER, OR DISASTERTHE SITUATIONS IN WHICH SOMEONE LIVES OR WORKSTHE NATURAL ENVIRONMENT OF AN ANIMAL OR OBJECT...

AmeriHealth Word Search #1 2023-06-03

25 Items: What does CE stand for?What LOB do you transfer?What LOB is Keystone First?What is the UCCF form called?What info can you find in Davis?What info can you find in Skygen?Where do you go to request a 1:1?What is the PA State System called?What call status should be under 5 mins?What system do you use to verify a member?...

Patho 2025-09-12

20 Items: The fundamental structure of cellsConditions that are present at birthThe explanation of how a disease evolves.The study of cells and extracellular matrix’sThe study of disease occurance in the populationThe predicted course action or outcome of a disease.A subjective complaint from an affected person that is noted....

Elderly Athletes 2022-10-17

10 Items: the limit does notAssessment tool for all agestype of exercise to do post THAreduced 30-35% with physical activitydeclines with age due to age-related changesinherited abilities and resistance to injuriesan easy way to measure physical activity levelfactor that includes having a strong mentalityaging adults were told to "act their age" aka be...

Human Flourishing 2024-12-17

6 Items: the way a person sees himself or herselfour true identity is based on being _______ of Godincludes aspects like emotional, social, intellectualour true identity involves living a life that reflects God's _____is the realization of an individual's potential and gaining a meaningful life...

Unit 17- Word Search 2023-02-21

12 Items: Causing damage, harmfulCheerful and full of lifeIn a dying or death like stateAble to be broken down naturallyTo preserve in the memory foreverHarmful to physical or moral healthTo cause the extreme embarrassment toThe act or process of bring back to lifeTaking an unhealthy interest in unpleasant things...

Unit 17 Word Search 2025-02-06

12 Items: Causing damage,harmfulCheerful and full of lifeIna dying or death like stateAble to be broken down naturallyTo preserve in the memory foreverHarmful to physical or moral healthTo cause the extreme embarrassment toThe act or process of bring back to lifeTaking an unhealthy interest in unpleasant things...

Unit 17 Greek and Latin Roots Homework - Ainsley Haws 2025-02-10

12 Items: causing damage, harmfulcheerful and full of lifein a dying or death like stateable to be broken down naturallyto preserve in the memory foreverharmful to physical or moral healthto cause the extreme embarrassment tothe act or process of bring back to lifetaking an unhealthy interest in unpleasant things...

Prepare 4 2025-10-12

11 Items: vey bigvery badvery tiredvery smallcalm and not busydifficult to think it's trueto go away from someone or somethinga young person between 13 and 19 years oldto leave your job or stop working because of old age or ill healtha written message from one person to another, usually put in an envelope and sent by post...

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

Vit/Viv 2025-05-08

10 Items: To bring back to lifefriendly, lively, andExtremely clear, or brightNecessary, or essential to lifeA food substance that aids healthTo endure, exist, or to stay alive(related to an atmosphere or event)The act of cutting open live animals for scienceAttractively animated; lively (related to a person)...

August Wellness Words 2025-08-01

15 Items: The reason you do something.A belief in your own abilities.A strong feeling of enthusiasm.Feeling or showing appreciation.A state of calm and tranquility.Deserving of respect and attention.The process of personal development.The ability to use your imagination.The capacity to endure and overcome.A state of physical and mental health....

33 2025-08-17

15 Items: Wallet with chain.Gathering at night.Common biker jewelry.Outdoor meal with bikers.Lubricant essential for engine healthEvent celebrating biker independence.Substance burned to power a motorcycleMeasure of gasoline quality and performanceDevice for communication or music on a rideAnimal that riders watch out for on forest roads...