health and wellness Word Searches

Word Search: ee and ea words 2023-04-28

14 Items: creekpeeledrepeatfreelyspeedygreeneruncleanreteachfeedingcheatedsweepingsweeteststeamingwheelbarrow

Cotton, Cattle, and Railroads Word Search 2024-04-26

14 Items: brandcottonlumberchisolmcowboysvaquerorailroadsbarbedwirecottonseeddryfarmingcompanytownrefrigeratedgoodnightlovingnativeamericans

Sabah Oxygen - P1TA18 2024-07-08

102 Items: tophoseventtesttripzeroworkareadownlevelicingtopupnightshiftinertentryvalveplantspacesmokephonespeedlimitalarmcraneshoesupdateonlinebypassliquidbottomweightdialogvacuumoxygenhealthsafetyleaderpermitenergyheightsourcemobileglovesofflineisotankstandbymorningpurgingreactorstartupprocessdrivingvehicleprojecttoolboxliftingcoolingglassesleathernitrogen...

Personal Traits 2023-03-03

25 Items: to refrain frompitiless, cruelfull of resourcenot alarmed, unafraidcautious, on one guarddiscolored, disgracefulunselfish, philanthropicnot yielding, determinednot prejudiced, unbiasedhaving an evil influenceformerly, gentlemanly, politehaving great influence, powerfultraitorous, disloyal, perfidiouskind and generous in giving money...

Spanis homework tic tac toe 2023-09-29

36 Items: YesAndTo runTo skiTo singTo drawTo swimTo workI do toWell...To danceTo skateAnd you?Also,tooI like to-To skateboardNeither...norTo ride a bikeTo play sportsTo go to schoolI like to_a lotTo write storiesI don't like to-Do you like to_?To read magazinesI like to _betterTo Listen to musicTo play the guitarTo play video gamesTo use the computer...

Inventions and Inventors during the Industrial Revolution 2023-09-28

7 Items: created antisepticinvented the radioinvented pasteurizationfirst four wheeled automobilefirst patent for the first automobileinvented the first electric light bulbinvented the electric motor and the dynamo

vehicle insurance 2024-05-14

21 Items: impairment of physical activitythe cost of an insurance policycombination of coverage bundled into one policythe scattered remains of something broken or destroyedperson in charge of processing claims to their resolutionagency in charge of keeping driving records of the driversstablishment specialized in repairing the framework of a vehicle...

fun word search 2023-11-08

5 Items: energy as electromagnetic waves or as movingwhen the object reaches the same tem as the air around the roomthe process by which heat or electricity is directly transmitted through a substance when there is a difference...

The traits of successful young entrepreneurs 2024-01-02

8 Items: Being able to come up with new and creative ideasUnderstanding how to use and spend resources wiselyContinuing in a certain action in spite of obstaclesHaving the ability to inspire others behind a central visionBeing able to have mutually beneficial interactions with peopleUsing this skill they derive what's true without conscious learning...

Cell Word Search 2022-09-02

10 Items: Cells that have a nucleus.Cells that do not have a nucleus.The smallest unit or subunit of life.Membrane The flexible “skin” of all cells.A structure in all cells that makes proteins.Wall A rigid “shell” that covers certain types of cells.The liquid inside of a cell. It is made mostly of water....

Brian's Winter Word search! 2024-04-26

12 Items: to light something on fireto drool saliva while eating something.a piece of ground rising on a marsh area.a person that opposes an enemy or opponentsomething that you need to survive in life.to close something very tightly and securely.stripped leather that can be used as material.sealed enough so that air cant escape or get in....

Island Word Search 2023-12-20

52 Items: paxmrtportmalayflyerf-onewastewateroceanhumidislandorchidenergymonkeydurianlizardgingercolonycountrychineseairportrafflesmerlionculturebalancebritishmalaysiagreenerytropicalsky-domepalm-treechinatowntransportshophouseesplanadesingaporepetrifiedbutterflythai-foodhotel-bossrainforestmarina-baygarden-citysingaporeansuper-treesflower-domefort-canning...

Breathing system 2024-04-25

12 Items: Organ that mucus comes fromAir passages inside the lungsThe major muscle of respirationThe chemical that you breath outThe chemical that you use to breathTiny air sacs at the end of the bronchiolesA cage of bones that protect your lungs and heartThe pair of spongy, pinkish-gray organs in your chest...

Literacy and Learning across the Curriculum 2024-04-09

5 Items: journals A journal in which students record their responses to a text as they read.Which of the following instructional strategies does NOT promote exploratory writing?journal A journal in which students role-play characters by writing from the perspective of a given figure...

Big Bull Gets Bored 2023-08-30

8 Items: Fire Fighter: the people who put out firesBull: A male cow is called a ______________Fence: Something built to separate land into partsSplat: The sound made when something hits the groundEscalator: Electric stairs that carry you up and downBored: The feeling you get when you have nothing to do...

Precedent Word Search 2024-03-23

8 Items: a traditiona tax on imports or exportsa group of advisors to the presidentforcing people into service, as in the navya position of not taking sides in a conflictactivities aimed at weakening established governmenta meeting held by a political party to chose their party's candidate for president or decide policy...

Precedent Word Search 2024-03-23

8 Items: a traditiona tax on imports or exportsa group of advisors to the presidentforcing people into service, as in the navya position of not taking sides in a conflictactivities aimed at weakening established governmenta meeting held by a political party to chose their party's candidate for president or decide policy...

GF 2023-12-14

128 Items: dgrfabkeylmsvpdsevabloamhsappsetchholdmemonaviocappcrbsahdtestalarmghostmaltamergeonegfoxideportsscrapsetupshiftsofiastucktowertrashvaporvalveaustinbuffercleansequityglobalinlinemodulemunichpolishqewqewrecipereviewstatussubloturgentaerosolblockedchambercharliecompassdefectsdresdenexpiredinhibitmanagermeetingmonitoropsduckprocessqualityreticle...

review 2024-05-15

16 Items: a push or pull on an objectmoving away from what is expectedmolten rock stored below Earth's surfacetwo tectonic plates move towards each othera substance that consists of only one kind of atomplaces where plates slide sideways past each other.all the living things and nonliving things in given area...

SLO Review: The Dark Ages - The Middle Ages 2024-05-09

17 Items: What is the original language of the epic Beowulf?Who is the original author of the epic poem Beowulf?In what language is The Canterbury Tales first written?a two or three word phrase that replaces a one-word nounThe English language seems to begin when who leaves Britain?...

Can you find all 53 countries? 2023-05-05

54 Items: FasochadmalitogobeninVerdeegyptgabonghanakenyalibyanigerLeoneSudansudanangolaGuineagambiaguineamalawirwandaAfricaugandazambiaalgeriaburundicomoroseritrealesotholiberiamorocconamibianigeriasenegalsomaliatunisiabotswanacameroond’Ivoiredjiboutieswatiniethiopiatanzaniazimbabwemauritiusmadagascarmauritaniamozambiqueseychellesguinea-bissauRepublic of the...

POSTIES 1007 COVER 2024-08-29

6 Items: a person who buys and sells thingsThe ancient Greek word for China is _____.China started trading with _____ countries around 130 BC.something expensive that is pleasant to have but is not necessarya system of roads, lines, tubes, nerves, etc. that are connected to each other and operate together...

Science trivia jorge-Zachary-Dylan-Isabella 2023-05-06

6 Items: It’s the country where it is The Eiffel tower.It’s a thing that you use to clean your clothes.It’s the person who was the best president of USA.It’s the person who has created the most popular phones.It’s the city where it is Cristo Rey and Parque del perro.It’s a thing that you put on your wrist and you can see the time.

ANTONYMS 2014-12-14

103 Items: buywetlowfarnewrawnonedullidlecoldwesteasydeadcomegoodsoftthinfindshowmissrudesoftrichfalltamechildawakebeginworsecursewhitedirtynightearlyemptyenemyhappyfreshfirstnevergiantfrontdepththerewaterleastoutersobernoisyroughurbanfalselearnsmileabsentrejectactivedepartattackbeforerevealsafetylatterfuturehealthvalleyexhalesorrowseniordivideliquorborrow...

Stage 20 Culture Review 2023-05-11

23 Items: nikenikenikepseudo-sciencefather of medicinecenter of learninggreat griffin golfergreat griffin runnermade first water-clockAlexandrian astronomermade first steam turbinewrote a geometry textbookmeasured the circumferencefamous 20th century doctorfamous 20th century authorRoman contribution to healthtitle of first geometry textbook...

15 2023-08-04

6 Items: the type of welder used on starship, not humanwhen the starship is mated to the super heavy boostera test of gas flow through the engines without ignitionthe first test article in boca chica, a flying water tankthis occurs on the outside of the booster and starship when it is fully fueled...

Nonfiction 2023-10-13

17 Items: topicessaysjournalsnonfictionstatementscommunicationA small eventCan be proved true.Written by that person.Records of daily eventsWritten by someone else.From one person to another.Order or sequence of events.One asks the other questionsPersonal beliefs; cannot be proved.Meant to explain, persuade, or informDiagrams, maps, charts, and photographs.

PE 1 2024-09-05

49 Items: 0123456789101112131415misshellomadamsir/Mr.nothinggoodbyesee youlikewiseits timedelightedvery wellthank youmy name ishow are youokay, so-sogood morninggood eveningyour welcomesee you latergood afternoonyou're welcomewhat time is itits one o'clockwhat's your namewhat's happeningand you (formal)thirty/half-pastsee you tommorrowand you (informal)...

Harry Potter and The Philosopher's Stone 2015-10-25

14 Items: SpellsHomeworkHogwartsSlytherinRavenclawQuidditchVoldemortRonWeasleyGryffindorHufflepuffHarryPotterDracoMalfoyHermoineGrangerPhilosophersStone

Snow White and the Seven Dwarfs 2020-12-10

14 Items: Doc1937HappyDopeySleepySneezyGrumpyBashfulHeighHoSnowWhiteThePrinceEvilQueenMagicMirrorPoisonApple

PART A - TEACHERS AND STAFF 1973 2023-08-28

14 Items: yorkolsonehmanjeskeparkerjohnsonedwardsshannonblosseraleksiukrollingskowalchukmacgregorfottypylypiuk

The One and Only Word Search 2021-01-15

14 Items: BobIvanRubyMackBossKimuSaraMayaJuliaRowdyStellaGeorgeKinyaniSnickers

Kate's Sky Science Word Search 2023-12-18

20 Items: rocks in spacerederection of lighta belief about the starsthe galaxy where we livegroups of stars in the skyan object orbiting the suna human that travels to spaceanother way to say big dipperthe study of anything in spacewhen something gives off lightanother way to say little dipperwhen a rock safetly lands on earth...

Coles word search 2024-02-22

10 Items: relativesyou can readopen and closeto put togetherstuff that is ediblehigh body temperaturenot knowing where you aremonsters that will hunt youa system of letters/numbersa puzzle that moves in the ground

Mathlete 2024-05-17

10 Items: I=Prtbelow zeroA = P(1+r)^tzero and abovea^2 + b^2 = c^2when you divide numbersthe percent of somethingwhen you subtract numberswhen you multiply numberswhen you add numbers together

Cardiovascular Word Search 2024-07-09

10 Items: Blue skinenlarged heartFast heart rateBottom of the heartHigh blood pressureInflammation of the veinNarrowing of the arteriesMuscular tissue of the heartIncludes heart, blood vessels, and bloodProfessional that specializes in the heart

Early Autumn 2023-01-19

20 Items: Mel to Paul.Main CharacterPatty to Paul.Father of Paul.Mother of Paul.Son of Mel and Patty.Paul to Mel and Patty.Spenser is this in his job.What is Spenser in this book?What can Spenser tell Paul is?What is Spenser towards Patty?What does Mel think of himself as?Paul feels this way about himself.What is Spenser feeling in this job?...

Capitales y Países Hispanos 2023-10-23

22 Items: capital de Perúcapital de Cubacapital de Chilecapital de Españacapital de Panamácapital de Ecuadorcapital de Uruguaycapital de Colombiacapital de Paraguaycapital de Hondurascapital de Venezuelacapital de Argentinacapital de Nicaraguacapital de Costa Ricacapital de Puerto Ricocapital de El Salvadorcapital de Guinea Ecuatorial...

Chapter 13 Ancient Greece and Roman Empire 2014-04-15

19 Items: RomePopeAthensSpartaSenateEmpireCrusadeRepublicCitizensCarthageaqueductsHoly-LandGolden-ageCity-statesHellenisticMiddle-agesNation-stateFeudal-systemGothic-architecture

Off the Bench and Into the Game 2024-08-02

19 Items: homeheartrulestrustlovingchurchschoolfollowtwelveenemieskingdomtalentsabilitypreparedevotiondisciplesrepentanceinstructionsconsequences

Emma Lantz 6th Grade 2024-05-16

15 Items: The hottest planet in spaceNo longer considered a planetClouds that are low in the skyClouds that are high in the skyClouds that are light and fluffyWhen a liquid turns into a solidA tidal wave that can flood a cityA natural disaster that spits out lavaWhen lava hits water it melts instantlyThe measure of reflectivity of a surface...

Adjectives 2022-11-08

15 Items: happy and cheerful.evil or morally wrong.(of a person) feeling cold.unable to understand; perplexed.in a vulnerable position or situation.(of an object) easily broken or damaged.lasting or existing forever; without end.capable of or tending towards murder; murderous.(of a person) unfriendly and unwelcoming towards people....

June 2024 Safety Word Search 2024-06-18

11 Items: Four basic stepsFour basic stepsFour basic stepsSTF stands for slips trips and (5)Always place these signs on the floor when moppingProper footwear includes wearing footwear with good(8)The four basic steps to follow using a fire extinguisherDurina a fire call for help before leaving the building(5)...

func marx - t+m 2024-02-06

9 Items: Marxism is a _____________ perspective.Who introduces the concept of hegemony?What analogy does Parsons use to describe society?How does the social system ensure it's needs are met?What keeps the working class from developing class consciousness?What is the result of our loss of control over our labour and its products?...

9321 Good Samaritan 2024-03-01

9 Items: A religious leader in the church.The person who takes care of an inn.A person who lives near you or anyone you meet.A person who steals from others, often using force.A place where travelers can stay, like a small hotel.A person from Samaria and were unfriendly to Jewish elite.A feeling of wanting to help someone who is hurt or in trouble....

Weather Word Search 2024-05-06

37 Items: ElevationMeasures wind speed.Water in the form of a gasThe movement of air parallelHas an airtight metal chamber.Middle layer of the atmosphere.Lowest layer of Earth's atmosphereA device that measures temperature.Winds that blow over short distances.The increased cooling that wind can cause.The way Earth's rotation makes Winds curve....

Heidi 2024-06-10

12 Items: to like: __________being bad: __________the lowest part: __________having good health: __________to go into a place: __________a large, grand house: __________not being able to see: __________a chair for people who can't walk: __________Peter pushed the wheelchair down the __________.Heidi's grandfather had two __________ that gave him milk....

Emails And Letters Ch.6 2016-02-24

10 Items: LinkSendSpamEmailInboxAddressOutlookSubjectMessageProofread

Adjectives Ending -ed and -ing 2016-09-10

10 Items: boredboringrelaxedexcitedrelaxingexcitingdepressedinteresteddepressinginteresting

Spelling Lesson 42 and 43 2018-01-17

10 Items: hegosofitshethisthatdripquizdrop

Ducks, Geese and Swans IV 2019-03-02

10 Items: SurfEiderBlackVelvetStellersKingEiderHarlequinLongtailedLesserScaupCommonScoter

Gulls, Terns and Skimmers I 2019-03-02

10 Items: IvorySabinesLaughingKittiwakeRosssGullFranklinsLittleGullBonarpartesBlackheadedSlenderbilled

iMedia Pre and Post Production 2020-06-28

10 Items: RecceGenderScannerFootageHazardsAudienceLocationEthnicityStoryboardContingencies

Unit 3: States and Forms 2021-12-15

11 Items: gasheatflowmeltsolidsteamcausesteamliquideffectfreeze

Feria de Abril and Sevillanas 2022-05-04

10 Items: SpainFiestaPopularParadesDancingSingingFlamencoCalamaresSevillanasCelebration

Weekly Vocab #7 and 8 2022-11-01

10 Items: aloofvagueaugmentdiscordominousruminatesemblanceimprudenteccentricpropensity

Roles of Men and Women 2022-11-30

10 Items: roleswomenhinducaringsikhismchildrenpatriarchalmatriarchalchristianityresponsibilities

Water and changes in state 2023-01-16

10 Items: watermatterboilingmeltingfreezingcolourlessevaporationtemperaturetransparentcondensation

RENEWABLE AND NON RENEWABLE RESOURCES 2023-04-13

10 Items: airoilsoilwaterrocksplantsmetalsanimalsnaturalgasfossilfuel

Pets and Puzzles - Word Search 2023-07-10

10 Items: financewoodrowcongresseducationmarketingmembershiptechnologyvolunteerspublicationscommunication

Asking Pardon and Forgiving Offenses 2023-06-11

10 Items: healtimegracepeacelearnchangeconfessforgiverestlesshappiness

Fluid earth: wind and currents 2023-09-11

10 Items: windgyreoceanelninocurrentcoriolisupwellingatmosphereprevailingconvection

Ducks, Geese and Swans I 2019-03-02

10 Items: MuteBeanSnowBrentTundraWhooperGreylagBarnaclePinkfootedGreaterCanada

Enoch and Methuselah Genesis 5 2021-09-17

10 Items: HamNoahShemEnochGenesisJaphethMethuselahDescendantFellowshipDisappeared

Gulls, Terns and Skimmers II 2019-03-02

10 Items: PallassCaspianIcelandAudouinsGlaucousAleutianCommonGullRingbilledYellowleggedMediterranean

Internal Communications voice and tone 2023-10-27

10 Items: tonevoiceclearconciseengagedcredibleinformedinspiredincludedcompelling

Word Puzzle - places and transport 2023-11-15

10 Items: cartaxibikeplanecinemaofficemuseumsubwayhospitalbookstore

Services and stuff wordsearch init 2024-01-07

10 Items: grantenergyinsulationWhat the O stands for in ECODebt Fee's, DCA, Credit score impacted.Scheme associated with a product called StairSteadyYour great protector as you embark on this new journeyAn appliance that helps control the temperature in your homeConversation you have to assess a customer's financial circumstance...

Alma Thomas and Sylvia Snowden 2024-01-30

10 Items: howardpaletteradiantparallelsgeometrictechniqueportraitsuniversitywashingtoninspiration

DNA and RNA Word Search 2024-02-23

10 Items: dnarnauraciladeninethymineguaninecytosinereplicationdoublehelixtranscription

Embrace spiritual freedom and growth. 2024-03-03

10 Items: soulpeacegrowthbelieffreedomembraceexplorejourneyspiritualenlighten

Of Mice and Men Chapter 4 2016-05-13

14 Items: WifeSlimBarnPupsDreamRanchCrooksLennieGeorgeCurleyRabbitsMachineAppraisedSullenness

Definitions of Computer and Internet Terms 2019-01-30

14 Items: ZipBetaDiskModeCableModemMacroOASISPacketQWERTYTargetEmoticonSoftwareVirtualization

The Pit and the Pendulum Vocabulary 2020-09-28

14 Items: pitgaptombslipropeedgejudgegravefaintdevilmetalbladeterrorpendulum

Snow White and the Seven Dwarfs 2020-12-10

14 Items: Doc1937HappyDopeySleepySneezyGrumpyBashfulHeighHoSnowWhiteThePrinceEvilQueenMagicMirrorPoisonApple

alphabed soup de valentineishon and umeishon 2022-09-28

14 Items: runcokecookcakechefchipswaterapplecoffehabitshealthyicecreamhamburgerstawberry

Mountains and Mountain Ranges Word Search 2022-12-06

14 Items: alpsandespyreneesmountainshimalayasappalachianwesternghatssierranevadabluemountainsatlasmountainsrockymountainscanadianrockiesolympicmountainsblueridgemountains

Animals Starting with H and I 2023-03-03

14 Items: impalaiguanahaddockhagfishhamsterhornbillhorseflyinchwormhermitcrabhummingbirdindigosnakehippopotamusindianelephantitaliangreyhound

WORDS WITH ENDING EL AND IL 2023-12-12

14 Items: borneaseljeweluntillevellabelbrianasequelfossilvesseltravelchannelpresantschristmas

The Ant and the Chrysalis 2014-01-30

10 Items: anttreetailshellwingsanimalprisonsunshinechrysalisbutterfly

Ducks, Geese and Swans II 2019-03-02

10 Items: GadwellMallardEgyptianMandarinBaikalTealRedBreastedEurasianTealRuddyShelduckCommonShelduckEurasianWigeon

Connecting words and Causal Conjunction 2020-10-23

10 Items: yetduetodespitebecausemoreoverlikewisethereforeotherwiseeventhoughadditionally

Unit 3: States and Forms 2021-12-15

11 Items: gasflowmeltheatsolidsteamsteamcauseliquidfreezeeffect

One and Done Word Search 2022-09-28

10 Items: fcsdmsnegbalreceiptwriteoffrepaymentgorbypassoneanddonevalidationadjustmentreleasedate

Saint Patrick Search and Find 2022-11-01

10 Items: saintescapeirelandBritainslaverypatrickcatholicstpatrickconversioncanonization

Stuff Mercedes likes and says 2022-12-19

10 Items: menoffdonecatsmusicit Outsamanthaquittingtake thisseasoning

Faimly 1 Spanish and furniture 2022-12-01

10 Items: sonhousenephewkitchenbedroomgrandsonbathroomgrandfatherliving roomdining room

Dreams and Circumstance 2 (Thursday) 2023-08-18

10 Items: uncertainlythreateninglycommon; nothing specialsome new information; newsoverbearingly proud; haughtyfreed from any question of guiltwithout care; in a slapdash mannerruler who exercises power in a harsh, cruel mannerdeviating from the established norm, model, or rule"religion" of those who don't believe in God and/or are uncivilized

International trade and business growth 2023-10-02

10 Items: gross domestic producta businesses competitionproduced in another country?an example of non trade barriershow fast something can be done #when a company has a specific uspexchanging goods between different countrieswhen a worker focuses on a specific operationWhen individuals, businesses or governments buy products or...

Goldilocks and the Three Bears 2013-10-20

10 Items: Bigbedbabymamapapabowlbearchairmediumlittle

Figures from Legends and Myths 2024-01-21

10 Items: circenimuemedusabeowulfodysseussirgawainrobinhoodguineverekingarthurmorganlefay

Betye Saar and Alison Saar 2024-02-23

10 Items: snakeyorubavintageantiquetemptingbiblicaltricksterassemblagelithographspirituality

Overcome obstacles and embrace challenges. 2024-03-02

10 Items: fightconquerembracecouragesuccesstriumphobstacleschallengesresiliencepersistence

SHIPS OF FACT AND FICTION 2024-04-02

10 Items: mainebountymonitorarizonatitanicposeidonmerrimacklusitaniamayflowerafricanqueen

Shannonstrange Word Search 2023-06-22

99 Items: msgfdaalt317326319frmsosprdled3859botoxjapanbadgeindiadonuthippaswirlbatchbmramrigidcrackemptymrnobuauditssnacksinvertliquidopaquealtheaclienthybridjobaiddefectbrokenhealthjohnleegermanykimtechproductlowfillsareptalockersplacardsshutdownnewhiresperiodicatypicalmedicinemeltbackhazardousrejectboxdropgaugeclearanceprojectidbiopharmasteeltoeshazardous...

Vocab 10 2023-10-23

11 Items: footto sharpengreat sufferingcause of unhappinesscome together as one unita total or humiliating defeatto defraud or swindle; to cheatinjurious to health or morals; poisonousto increase the severity of; to aggravateone who is intolerant especially in matters of religion, race, or politics; racist...

Penthouse Word Search 2023-02-20

17 Items: spanatticcolumnstairsshelterpartitionfoundationplasteringfor storageabove your headcorner of hipped endto provide ventilationused as a binder in concretethe highest part of apartementwindow that has been placed in attic roomsomething that allow the door to open and closestructure the door leaf or panel provide a solid sturcture

Vocabulary Lesson 8 2022-11-08

10 Items: The _____ of the word "bright" is "brightest."Building a bridge requires _____ calculations.The word _____ is similar to the term "exonerate."Some conflicts can be _____d by proper communication.After _____ing the data, the scientist concluded a trend.You can use a pesticide to kill plants and an _____to kill plants....

1 2024-05-25

10 Items: The highest class of nobility and landed gentry.The highest circle of fashionable society in London.Conformity to accepted standards of behavior or morality.Grand hall where high society gathered for elegant dances.The class of landed property owners ranking below nobility.The traditional process of romantic pursuits before marriage....

Spanish Months and Days of the Week 2021-01-21

19 Items: mayoluneseneromarzoabriljuniojuliomartesjuevessabadoagostoviernesdomingofebrerooctubremiercolesnoviembrediciembreseptiembre