health and wellness Word Searches

Diabetes & Oral Health 2024-11-11

8 Items: DiabetesToothLossXerostomiaOralHygieneMiracleFluidToothMobilityImmunoglobulinPoorGlucoseLevel

Health Word Search 2025-12-12

8 Items: wristinjurythroatbruisecoughingaccidenttoothachetemperature

Health Food x Junk Food 2025-08-08

16 Items: milkricesodacakeapplebeanswaterpizzacandycarrotorangetomatohotdogchocolatehamburgerfrenchfries

Reagan R 2024-05-16

15 Items: Energy that is storedThe total distance movedThe ability to cause changeHas a definite shape and volumeelectrons in the outermost shell.The process of changing directionHas an indefinite shape and volumeExplains how particles in matter behaveAnything that has mass and takes up spaceHas a indefinite shape and definite volume...

Macro Chapter 21 Vocab 2024-10-29

17 Items: exports minus imports (X-M)a period during which real GDP decreasesgoods and services purchased from other countrieswhen governments buy goods and services from firmsThe purchase of new capital goods (tools, instrumentsTaxes paid minus cash benefits received from governmentsThe expenditure by households on consumption goods and services...

AP LANG VOCAB 2025-09-17

27 Items: – severely critical– intervene with something– a security guard or watcher– being everywhere all of the time– something causing misery or death– to provoke or incite somebody into action– of, characteristic of, or resembling a lion– marked by doubt, uncertainty, or skepticism– to indicate something by action or implication...

Dumb Phones" on the Rise 2024-11-17

11 Items: ZtimemediaphonesphoneshealthAnxietyMinimalismtechnologyDepression(Fear of Missing Out)

Laws & Codes in Texas 2025-11-03

8 Items: body of laws which govern trafficgreatest possible punishment for the crime committedset of laws which are related to the punishment of crimes and offensesbody of laws which protects health, safety and welfare of the general publicserious crimes such as murder, kidnapping, robbery punishable by a year or longer in state prison...

British and Irish Dogs 2025-08-05

20 Items: Scent hound, used primarily to hunt hareA large, black and tan gundog from ScotlandPembroke and Cardigan are both types of what?What word goes in front of 'beagle' and 'blue'?Pepper and which other colour can Dandie Dinmont Terriers be?A terrier was associated with this city long before Noel and Liam...

Afro Word Search 2025-11-19

43 Items: Study of past eventsMovement to end slaveryTime that is yet to comeAfrican-Brazilian religionFamily descent and lineageFair treatment and behaviorAct of setting someone freeMusical bow used in capoeiraLegal and moral entitlementsProcess of receiving knowledgePolitical activist and academicLeader of Quilombo dos Palmares...

Word search 4 2023-10-17

11 Items: timetaskschangelessonhealthlessonsuniformteacherslearnerstuckshopprincipal

BIO235 2024-11-09

20 Items: - detect pain- Farsightedness- Nearsightedness- respond to light- detect organ pain- measures eye pressure- detect touch and sound- detect smell and taste- controls the pupil size- detect temperature changes- examines eye drainage anglechart - measures visual acuity- the membrane covering the eye- blood vessel layer in the eye...

Road to American Revolution and Revolutionary War Review 2022-11-28

25 Items: Shot heard round the world.The author of Common Sense.A 1767 law that taxed glass, paper, and tea.The author of the Declaration of Independence.The commander in chief of the Continental Army.Colonial activists dumped tea into Boston Harbor.This battle was the last major battle of the Rev. War.The only colony not at the First Continental Congress....

Ceramics Word Search 2025-03-11

24 Items: Stage when clay is moist and workableProperty that allows clay to absorb waterSheet of clay rolled out using a rolling pinClay pieces that serve a function; have a useProperty that allows clay to be shaped and moldedClay pieces that have been fired in the kiln onceMachine that uses high heat to vitrify clay pieces...

OdettesBudgetingLife 2024-12-19

35 Items: DebtEtsyGiftsPOBoxFamilyHealthNewCarTravelMedicalSavingsClothingFunMoneyHolidaysRoadTripSelfCareSuppliesVacationBirthdaysEducationFurnitureStarNotesAnnualFeesElectronicsLowPriorityCarInsuranceHighPriorityStudentLoansEmergencyFundMiscellaneousOneMonthAheadSubscriptionsCarMaintenanceContentSupportMovingExpensesVariableExpenses

Executive Branch Puzzle 2025 2025-02-07

35 Items: RunLawsFairCivilChiefPrimeMoneyPartySpentRulesHouseThreePublicBranchDutiesActionSenateChargeHealthCabinetCountryServantsMinistryMinisterSecurityDecisionAssemblyExecutivePortfolioPermanentPoliticalSecretaryEducationParliamentGovernment

Dauphin Way Lodge Recovery 2025-07-15

35 Items: HelpHopeLoveCleanFaithGoalsPeersShareSoberFamilyFutureGrowthHealthRescueStrongBalanceCourageFriendsJournalPathwaySupportTherapyBlessingMaturityPositiveSurvivalAwarenessCommunityGratitudeAcceptanceConfidenceAffirmationCelebrationInspirationEncouragement

Bridge Program Workshop 10 2025-07-24

35 Items: ClubCookLoanGroupHobbyTutorLearnMentorAbroadHealthDentalCareerGraderBusserOfficeCourseFacultyCashierBaristaStudentProgramActivityAdvocacyResearchVolunteerInsuranceAssistantAdmissionConnectionExperienceRecreationDishwasherAssociationRequirementAccessibility

A&O 2025-09-05

30 Items: HRISFITSAPMGMTOSCMBCMUMKTGCBDCZoomBABAENTREOPMGTACCTGFINANCminorsmajorsBIZEVALBookingshandshakedegreeplanCareerCoachBuerkCenterinternshipsstudyabroadtranscriptsFosterFridayCaseCompetitionsAcademicCalendarFoster's Mental Health Counselor's netid

EA and A 2025-10-21

35 Items: deaddeafheadleadquadswanswapwandwantwashbreaddealtdeathdreadheavyleaptreadysquadsquatswampwatchwaterbreathhealthspreadsteadyfathersquashwaddlewafflewallowwanderfeatherswallowbreakfast

Chapter 6 ED310 2023-02-14

10 Items: Data software______ ProcessingAllows ______ on documentsAssess the _______advantage_____lesson results and impactEncourages writing across the_________________dynamics within collaborative writingShare lessons, _______, and outcomes with other peer teachersTeachers create documents for instructions and _________ tasks...

Energy & Matter in an Ecosystem Challenge Word Search 2025-01-11

32 Items: living thingthe ability to do workrefers to land environmentsrefers to water environmentsprotection of natural resourcesprotist that makes its own foodanything that has mass and volumematter from a once living organisma consumer that consumes plants onlywaste products from living organismstwo or more elements that are bonded...

Supplements and Aids 2024-11-15

20 Items: BCAA, activates muscle protein synthesisclass of drugs that increases CNS activityfound in fat burning supplements and preworkoutsstimulant that reduces fatigue and pain while exercisingderived from leucine, promotes muscle growth (abbreviation)plant that reduces inflammation and aids muscle regeneration...

Histology Word Search 2025-10-02

22 Items: inflammation of a glandproduces hormones; no ductsSurgical removal of a glandmicroscopic study of tissuesAbnormal hardening of a glandAny disease or condition of a glandSecretes chemical substances into ductsincrease in bulk of body part/organ due toMalignant tumor originating in glandular tissuecontains cells specialized to contract and relax...

Pharmacy Crossword Puzzle: 'Discover Pharmacy!' 2025-08-04

8 Items: Opposite of diseasePlace where pharmacists workA liquid medicine taken by mouthA common Pain-relieving medicineWhere you go to get a prescriptionMedicine in solid form, often roundA doctor writes this for your medicineA person who prepares and dispenses medicine

Customer Engagement Hub Market: Trends, Growth Opportunities, and Regional Insights 2025-06-23

13 Items: playersdriversupdatesanalysissegmentationOpportunitiesthe rising trend of cloud-native engagement hubs and strategic partnerships among tech giants to deliver unified, data-driven customer interaction platforms globally....

Employer-Of-Choice 2023-03-13

16 Items: teampridepassionintegritydiversitysuccessionmission-26sustainabilityperform-&-growresponsibilityemployer-of-choicehigh-trust-culturephycological-safetychallenge-status-quoorganizational-healthevery-employee-is-special

T. L. E 2025-02-03

26 Items: These are flat heateduse to hold food in placeUsed to open canned foods.where food is directly cookedThe toaster is typically a smalluse to strain solid to liquid ingredients.Used to slice foods more evenly and uniformlyMachines used to chill sandwiches and other foods.A knife with a sharp edge that has saw-like notches or teeth....

asdf 2025-11-14

12 Items: (adj.): causing damage, harmful.(adj.): cheerful and full of life.(adj.): ina dying or death like state.(adj.): able to be broken down naturally.(verb): to preserve in the memory forever.(adj.): harmful to physical or moral health.(verb) to cause the extreme embarrassment to.(noun): the act or process of bring back to life....

Game 2023-04-10

15 Items: The colour of chocolate.A small vehicle for travelling on water.The day before today. The letter starts with Y and ends with Y.An object for taking photos or making films or television programs.An object with a sharp blade used for cutting fruits, vegetables etc...It is a vegetable. The letter of the word starts with C and ends with T....

Get Well Soon, Hamdan! قيامك بالسلامة يا حمدان! 2025-10-25

12 Items: – ضغط– قوة– صحة– تمدد– عضلة– مدرب– شفاء– سكوات– لياقة– الدمبل– النادي– الأثقال

Epidemiology- Word Search 2025-05-03

5 Items: study of serum.The study of how disease spreads and can be controlled.are often collected for the diagnosis of bacterial pneumonia.is a preferred method for manual cleansing in health care when hands are not dirty....

Onboarding Word Search 2024-11-13

3 Items: The process of integrating new hires into an organization and its culture.The total monetary and non-monetary rewards given to employees for their work.Non-wage perks provided to employees, like health insurance, retirement plans, and leave.

Word Scramble 2022-11-15

40 Items: the ability to carry out a taskthe cost of operating a businessa natural ability to do somethinga business owned by a singular persona mental position with a fact or statethe worth or value of a good or servicemoney recieved on a regular basis for workNike is an example of an _____ (business type)the percentage of the industry's total revenues...

Reconstruction Test Review 2025-10-05

22 Items: Became president in the election of 1876The constitutional amendment that ended slaveryHe was the first African American to serve in the U.S. SenateCivil rights leader and journalist who exposed lynching in AmericaThe Supreme Court case that upheld “separate but equal” segregation...

Mental Health Awareness Month 2023-05-24

11 Items: swingsstressfatiguecourageinsomniaemotionsselfcareexercisetirednesscommunicatemindfulness

DOG 2025-01-31

17 Items: – The top of the neck.– The side of the face.– The digits on the paw.– The upper hind leg joint.– The joint on the front leg.– The rear end, above the tail.– The loose, hanging upper lip.– The dog's nose and mouth area.– The upper front leg attachment.– The area between ribs and hips.– The lower hind leg, above the paw....

Scrum Glossary 2023-07-21

34 Items: 10, See "Product Backlog __________"5-4, A self-managing team consisting of one Scrum Master, one Product Owner, and Developers.8, The selection of items from the Product Backlog Developers deems feasible for implementation in a Sprint....

Caffeine Word Search 2024-11-25

20 Items: a severe allergic reactionproduced from the formation of beetsa stimulant found in coffee, tea, and cocoanutrients people take in addition to the food we eat.a type of vegetarian that eats plant sources and eggsa type of vegetarian that only eats food from plant sourcespopular diets that claim to offer a quick fix to health issues...

The Nervous System :) 2024-02-21

15 Items: - the largest lobe of the brain- the sensory switchboard of the brain- part of the brain that controls breathing- part of the brain that coordinates movement- part of the brain in charge of memory and hearing- a disorder of the brain characterized by repeated seizures- part of the body that receives and sends sensory information...

Exercise Word Search 2025-05-11

50 Items: ArtYogaFilmMindMovieGamesGenreSpaceMusicHobbyFlavorNatureSportsPlanetAuthorDesignJourneyScienceHistoryCultureAnimalsTourismCuisineWritingAthleteFashionTextileFinanceExerciseDiscoverBusinessWellnessComputerPaintingActivityWildlifeCommerceDeliciousEconomicsAdventureNutritionAlgorithmTechnologyLiteratureInstrumentPsychologyEnvironmentArchaeology...

Vocab Part 2 2023-02-28

15 Items: a popular votemilitary draftthe right to votecan defend with logicking noble and easantssudden overthrow of the governmentmilitary static where they burn or destroy cropsto formally give up control of a country or stateto incorporate into an existing political unit, such as a city or country...

Vocab 3 2024-09-18

15 Items: A living part of an ecosystemA nonliving part of an ecosystemStep in a food chain or food webAn organism that makes its own foodAn organism that cannot make its own foodA consumer that eats both plants and animalsConversion of light energy from the sun into chemical energyOrganism that feeds on plant and animal remains and other dead matter...

Deaf Appreciation Month Word Search 2025-03-11

15 Items: Not completely deafDeaf Awareness MonthTo have loss of hearingA device that can help people hearA famous deaf inventor and businessmanThe last name of the inventor or hearing aidsA famous deaf disability rights activist and an authorThe past of deaf or hard of hearing people and cultureA famous deaf composer and pianist in the 1700s and the 1800s...

Micah 4 The Lord's Reign in Jerusalem 2023-04-30

21 Items: You will go off to ???We will walk in His ???I will make your horns ???Many say, "Let her be ????"There will be no ??? anymoreArise and ??? daughter of ZionAnd their ??? into pruning hooksNo one shall make them ???anymoreAnd they do not understand His ???I will gather the lame and the ????Now it shall come to pass in the???days...

Word Search 2025-12-15

20 Items: App for short videosSweet ring-shaped treatSuperhero movie universeSport played with a hoopTakeaway food with toppingsPopular casual or sports shoesPlaying video or computer gamesWhat you hold to play most gamesUsed to listen to music privatelyThe part of a car that makes it runOnline game where users create games...

Criminal Thinking Errors 2025-07-01

15 Items: A criminal thinking error that shows a failure to follow through with commitments and intentions.A behavior of criminality that displays a lack of accountability for one's actions or obligations.A positive attitude of being thankful or having a readiness to show appreciation for and to return kindness....

Medical Marijuana Word Search 2024-12-02

7 Items: Another term for marijuanaA type of Schedule 1 controlled substanceThe action of working together for a common goalEnsuring patients are cared for, their needs are met and heardA set of principles and standards that nurses follow to provide optimal care...

Semperfidelis Word Search 2024-04-15

24 Items: light and liberty-UNCto err is human-Senecafrom sea to sea-CanadaFor humanity-Wake ForestMake haste slowly-Augustusmind and hand-NC A&T + MITbuyer beware-famous proverbo the times! o the customs!always faithful-US Marine CorpsI think therefore I am-Decartesthus always to tyrannts-Virginiaart is long,life is short-Horace...

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

DEPOSITS SYSTEMS 2024-11-05

15 Items: USED TO ROUTE THE CORRECT CALLS TO YOUUSED TO FILE CLAIMS AND SERVICE REQUESTSUSED TO TRANSFER CLIENTS AND ACCEPT CALLSUSED IN MOBILE BANKING AS A DIGITAL ASSISTANCEUSED TO GUIDE THE CLIENT TO THE CORRECT DEPARTMENTYOUR MAIN RESOURSE FOR KNOWLEDGE AND GUIDANCE ON CALLSUSED TO CAPTURE COMPLAINTS AND VIEW PREVIOUS COMPLAINTS....

Vocabulary Words 2025-11-25

13 Items: adj. -French origin, bizzare "odd/fantastic"adj. -Latin origin, from vulnerare "to wound"v. -Latin origin, from in "in" and durus "hard"v. -Latin origin, from examen "a test, balance, or weight"n. -Latin origin, from per "through" and specere "to look"v. or n. -Latin origin, from contra "against" and stare "to stand"...

Nurse Word Search 2025-09-22

25 Items: Your mom and dad.Work that you do after school.The leader of the whole school.The children who learn at school.The place you go to learn every day.You can find swings and a slide here.The teacher writes on this with chalk.You carry your books and pencils in this.A short break for playing between lessons.The room where the school secretary works....

How Can Hormone Health Help Me? 2025-07-01

21 Items: CalmFocusEnergyMemoryStrengthImmunityRecoveryVitalityStrengthDeepSleepDigestionEnduranceClearSkinFertilitylongevityStableMoodMetabolismConfidenceResilienceMentalClarityRegularCycles

constitution terminology 2023-01-22

20 Items: Having two branches or chambers.The first term amendments in the U.S. ConstitutionComposed of the Senate and the House of Representatives.A person who shapes or creates a concept, plan, or system.To control or supervise by means of rules and regulations.The funds or revenue of a government, corporation, or institution....

Jobs in health care 2024-03-21

11 Items: nursedentistorderlydieticiantherapistoptometristcardiologistpractitionerlabtechniciandermatologistxraytechnician

Cohesive Word Search 2025-02-10

30 Items: UnifiedDoubterPowerfulResidentGratefulSeparationExtremely angryLoyal and dedicatedEffect or influenceTamed for human useCombine into a wholeThe way someone actsOpen to harm or attackCareful and responsibleAccepting of differencesInequality or differenceOpen-minded or progressiveLack of interest or concernNatural impulse or behavior...

Sharks 2025-07-25

30 Items: makocoraljacksonmale cowstriped horsemetal in wiresvaluable metalto lie in the sunpirates of the ...yellow citrus fruitopen ocean swimmingflorence nightingaleclothes you sleep inbiggest fish in oceanhead shaped like a toolAfrican spotted big catcolour of ocean and skyspriritual agent of Godstripes and eats anythingmouth like a cookie cutter...

Christmas 2025-11-30

7 Items: globestoppersWreathsStockingsand baublesNutcrackersand garlands

Pirate Word Search 2025-06-22

12 Items: A costume with a helmet and hoseA costume that looks like a machineA round, orange costume with a stemA big, roaring costume from long agoA fancy costume with a crown or dressA costume with a cape to save the dayA costume with a cape and sharp teethA costume with a pointy hat and broomA costume with a hat, boots, and lasso...

10 Humanities Revision 2025-11-09

12 Items: The mixing of races.Being the same in status and freedoms.The forced separation of people by race.Man who challenged Terra Nullius and won.Contained area that held Jewish people in WW2.Mass genocide of Jewish people by Nazis in WW2.Feelings of contentment that come from good wellbeing.A member of the National Socialist German Workers Party....

Medi-Cal 2014-10-31

33 Items: LowTARxrayLongTermCareCardPlansneedyMentalHealthCountyIncomeDoctorsMedicalBenefitsHospitalCoverageMedi-calSuppliesMaternityEmergencyPediatricScreeningEquipmentMedicallyProceduresLaboratoryCaliforniaEligibilityPrescriptionsCategoricallyRehabilitation

First Three Words For New Year's 2024 2023-12-27

34 Items: joylovehopeplangracepeacefocuswisdomhealthgrowthcreatecharityservicebalancerespectpatiencekindnesshumilitygoodnesssimplifyorganizelearningexercisecuriositycommitmentcompassiongentlenessdisciplineprioritizeforgivenessstewardshipfaithfulnessthankfulnessencouragement

Welcome to Integrity 2024-08-20

34 Items: GymArtMathBandWaiteLunchMusicNeagleCivicsRecessChorusSkillsHealthOConnorTessmerTauroneDohertyAlgebraScienceLockersTissuesIntegrityBackpacksOrchestraMontgomeryConnectionFieldTripsAssembliesEighthGradeAgendaBooksEngineeringLanguageArtsDigitalLiteracyComputerScience

Lifetime Sports 2025-04-07

30 Items: crewgolfropegolfartsyogadancetennishockeyhealthreliefskiinghikingwalkingcyclingstaminafrisbeearcherymarathonbaseballfootballswimmingstrengthwrestlingbadmintonpickleballbasketballvolleyballcheerleadingweightlifting

TBC 2025-11-30

34 Items: LGDLaraHugoBellKempHASSAdelePoppyHenryRickyJesseMasonLoganIrwinAleeahMarcusMaddieClarkeWatsonHealthJasmineCollierVanstanNanangoEnglishScienceRhiannonFranklinMcCarthyPatricksMcDonaldReligionTechnologyMathematics

Geometric Word Search 2025-09-27

18 Items: 23Forms occupy space, such as sculptures or buildings.- A line is a path made by an object moving across a surface.- describes the different ways elements of an artwork are arranged.- The art of making objects from clay and hardening them in a kiln.Shapes - are irregular or uneven shapes. These can often be found in nature....

Yes! Word Search 2025-11-19

21 Items: METTALOTUSBUDDHADHARMASANGHAMANTRATEMPLEBEINGSRINPOCHECHENREZIGSUFFERINGNAMASKARACOMPASSIONMEDITATIONDEDICATIONcan simply copy the list below and paste it into the generator of your choice:Using an online generator is the easiest way to make a custom word search puzzle....

Ruler Word Search 2025-06-22

12 Items: A sheet you use to write or draw onThe person who leads the whole schoolThe room where students learn and workA writing tool with bold, colorful inkPeople you like to play and learn withA book with pages for writing and notesPages you read to learn or enjoy a storyA white stick used to write on chalkboards...

Chapter 4 Section 1 2025-11-03

13 Items: AgoraKnossosHoplitesHoplitesMainland __________ is a mountainous peninsulaThe first Greek kings were _____________________Early Greek communities grew up ____________________The Greeks were the first people to develop _____________like independent countries and varied in size this area is called...

AEG Word Search 2024-04-16

38 Items: airasgwildeiaegsoilsafewordsafeflowsoilarchwatercleanexcelearthhealthtimelysnacksrecycleleaderstestingsamplesclientsschoolsleadersteamworknutshellmanagersprojectscompliantdeadlinesstormwaterconsultingtechnicianaccountingconsultantsenvironmental

Brandon & Tiffany 2025-02-01

36 Items: FUNLOVECAKEKISSRINGADORETRUSTBLISSGROOMBRIDEDRESSDRINKSMALENYHEALTHCHEERSBRANDONTIFFANYFOREVERROMANCECHERISHSUPRISEPROMISELOYALTYWHISKEYFOREVERJOURNEYTOGETHERDEVOTIONTEAMWORKFAVOURITEHAPPINESSADVENTURECHAMPAGNEFLOWERGIRLSUNCONDITIONALENGAGEMENTPARTY

Junior Year in Review 2025-06-09

35 Items: ArtMathMassAPUSHHouseCommaLunchYondrHealthSummerWinterClauseFinalsEnglishHistoryPhysicsBaldwinRetreatChargerTechBarTheologyResearchMidtermsSentenceAssemblyWorkStudySemicolonFitzgeraldGradatGradSocialHallChromebookConvocationCollegeCareerMulticulturalGoogleClassroom

Summer Enrollment 2025-06-11

30 Items: FSAEOITIPPDentalVisionHealthTexFlexYou_OnlyDeadlineLong_TermBeneplaceTexa$averShort_TermDependentsERS_OnLineDisability401(k)/457Add_or_DropEligibilityPrescriptionJune23-July04Opt_Out_CreditAD&D_InsuranceYou_plus_FamilyExpress_ScriptsAlightSolutionsOptional_Term_LifeTobacco_User_StatusChild_CertificationHealthSelect_of_Texas

Patient Education 2025-08-05

29 Items: AidsChangeSettingLearningTeachingFeedbackLiteracyHandoutsCoachingResourcesPromotionWorkshopsEducationteachbackCurriculumAssessmentEvaluationEngagementMotivationCounselingMultimediaMonitoringInstructionEmpowermentInteractiveDevelopmentCommunicationUnderstandingDemonstration

Leadership class 2029 2025-09-02

35 Items: TASKFIREGOALSEXCELSPHERESTRESSCAREERTRADESHEALTHMISSIONCOLLEGEPATHWAYPLANNINGTANGABLERIGOUOUSTEAMWORKCIVILITYEXECUTIVEEDUCATINGCOUNSELORINTANGABLEEMPOWERINGPHILOSOPHYFLEXIBILITYPERSERVANCEENCOURAGINGORGANIZATIONSTAKEHOLDERSSELFRELIANCEMETACOGNITIONCOLLABORATIONSELFAWARENESSSELFDIRECTIONSELFASSURANCESELFCONFIDENCE

Spanish Vocabulary 2023-04-19

20 Items: catdogauntcamerafathermotherbrothercousinshusbandparentschildrendaughterdecorationsgrandfathergrandmothergrandparentscousin (male)aunts and unclecousin (female)brothers and sisters

The Crucible Vocabulary Review 2025-02-27

37 Items: bitliefbasinladlefactoagapegauntpoppetseededchristgibbetjoshuacleavelecheryprobitygullingandoveradamanthysteriaand abeldesolateclemencydenounceaffidavitcallouslybewitchedrepreievepenitencerescindedmagistrateand tobiaseffronteryproceedingsremorselessdisputationcondemnationconciliatory

Teaching 2014-12-02

35 Items: artmathbandtrackdeskshealthchoruscivicsrecessshapesalgebraenglishsciencebiologynumbersspanishstudentssubjectsfootballbaseballprincipalcomputerssuspendedcafeteriaattendancetechnologyvolleyballnumberlinemediacenterspreadsheetinstrumentsfrontofficesocialstudiesphysicaleducationassistantprincipal

EHS Week 2022 Word Search 2022-08-19

36 Items: elonechowastelakinpartsmyehssalesteslaveoliaaustinsafetyhealthbatteryhotlineservicebatteryoneteamfremontcoolantaerosolsecurityforkliftshanghairoadsterelectricdeliverylogisticsworkplacerecyclingcybertruckinterstatesharepointtakechargeenvironmentpreparednesssustainability

What 2023 has in store for you... 2022-12-22

38 Items: loveloverestcalmfamemoneypeacequietcheerblisspeacegracehealthwealthtravelenergyfamilypraisesuccesspassioncouragesupportinsightlaughterapprovallaughteradventurefriendshiprelaxationpositivityconfidenceacceptancerecognitiontranquilityinspirationfulfillmentappreciationopportunities

WELCOME BACK CALCIUM! 2023-08-22

35 Items: artgymprekspedbocesmflacmusicgrowthhealthnursesrecesscalciumlibrarylearningsnowdaysstudentswarriorsadventurebidsheetscafeteriacustodialattendancefirstgradefriendshipthirdgradeindianriverourownstorysecondgradeamazingaidesconstructionkindergartennewyearnewyouadministrationbestofficestaffterrificteachers

It Takes A Village to Raise A Child 2024-09-18

35 Items: mythcarehomeyouthlocalclubswatchsafetyhealthgroupsSportsproverbAfricanvillagesecurityprogramschildrenCommunityeducationwellbeingresourcescontributerecreationupbringingactivitiesvolunteersenvironmentafterschoolperspectivesneighborhoodinstitutionssupportsystemmoralguidanceorganizationsextracurricular

CAPE 2025-08-05

36 Items: gasRobbJaneAnneLeahNolanurseMeganadbandoctorCanadatoxicsAnjaliSkylarKarinaKiemiaReykiaDakotaSkylarhealthjusticeclimateSabrinaTynetteNatalieLoujainsuccessactivistMichelleRhiannonPatriciacommitteeenvironmentfossilfuelssuperheroeshealthprofessional

Esmerelda Word Search 2025-10-23

36 Items: lizamysixtorimikedawnleahcaremindyeetyoloamiraericatessayouthadultunitspsychskirtsevenbrianajustinandrearachelmentalhealthvanessafrancisanaliciarashaynechildrenesmereldacontrabandchristopherpsychiatricmedications

Mr. Stanger's Last Day Word Search 2025-11-20

35 Items: DogsAuraCubsLamarMollySixthFifthSigmaMusicDarwinHealthEighthHipHopStephenStangerCharlieAbigailPontiacChicagoScienceHistoryEnglishSeventhTeacherStoriesGoodbyeKendrickSixSevenDietCokeChampaignThomasboroSubstitutePrideBucksMariosPizzaNameofMyFavoriteStudent

Eucharist 2023-11-13

9 Items: Going to the altar to receive...invoking the power of the Holy SpiritTranslation of Eucharist in Greek and thanks to GodAct of turning bread and wine to Body and Blood of Christ"to make holy" and shedding of Jesus' blood for our salvationthe highpoint of the mass and central sacrament with special title...

Domestic Word Search 2022-11-20

35 Items: mentraphelptvadwomenstoryhealthdangerverbalgroupsaccessrightsvictimsupportwebsitedomesticviolencephysicalproductsservicesreliablepositivenegativechildrenfinancialresourcespreventioninfluencesobligationconsumerismrealisationinformationinfographicsocialmediaresponsibility

Love Word Search 2022-12-26

35 Items: joyloveflowsafehopemagicfaithtravelfamilybeautyhealthgrowthchangesecurefriendscourageclaritymindfulforgivefreedomempathymanifestkindnessstrengthblessingfearlessabundancegratitudestillnesslimitlessconnectionproductiveinspirationbreakthroughspirituality

Words of the Day 2023-04-06

35 Items: hivairaidsrestviruswaterhearthealthcancerasthmastrokevaccinehygieneobesitypathogenimmunityepidemicpandemicexercisesunlightdiabeteswholisticnutritiongermtheoryantibiotictemperancemoderationtrustingoddanieldietdeprivationmicroorganismdirectcontactchronicdiseaseindirectcontactcommunicabledisease

Human Services Word Search 2024-09-10

35 Items: careneedsgoalsnursehealthskillsassistmidwifeserviceempathysupportguidancepositivecounselorabilitiescommunityambulanceaptitudesattitudeseducationcompassionprotectionbehavioursexperiencecasemanageroccupationsolderadultsspecializedsocialworkerdisabilitiesindependenceprofessionalschildandyouthrelationshipsrehabilitation

Animal Rights vs. Animal Welfare 2024-10-09

35 Items: ZoosCareHealthRightsEthicsComfortJusticeCircusesEqualityAutonomyActivismAdvocacyStandardsWellbeingSufferingAbolitionSentienceEnrichmentRegulationProtectionLiberationCompassionSanctuariesFurindustryConservationExploitationAnimalrightsAnimaltestingInherentvalueAnimalwelfareRehabilitationOverpopulationFactoryfarmingNonhumanrightsHumanetreatment

Word Search Puzzle #2 2024-11-17

35 Items: ARTMATHDESKDRAMABOOKSLEARNMUSICPENCILRECESSGRADESSCHOOLHEALTHHISTORYNUMBERSSCIENCEENGLISHFRIENDSREADINGLIBRARYCRAYONSTEACHERWRITINGALPHABETHOMEWORKBACKPACKSPELLINGSTUDENTSSUBJECTSSCISSORSCLASSROOMGEOGRAPHYELEMENTARYLANGUAGEARTSSOCIALSTUDIESPHYSICALEDUCATION

risk taking 2025-11-03

30 Items: riskliferightsdangerhealthmakingsafetytrustsskillsdevelopseekingsupportstrategythoughtsidentityfeelingspositivenavigatenegativesolutionsjudgementawarenessbehaviourconscienceresiliencemanagementchallengesrecognisingadaptabilityresponsibilities

Giraffe Word Search 2023-05-19

7 Items: an animal who is fat, gray and small.an animal who have big neck and is yellow.an animal fast, yellow or orange and violent.an animal who is Black and white, and have strips.an animal who is small, Black and walk underground.an animal who have a trank, if fat and live in forest.an animal who belongs to the tiger family and has a very loud roar.

Unit 3 Review 2023-01-29

16 Items: of low quality, or not acceptableenjoyable, pleasant, or interesting:the liquid that comes from fruit or vegetablesthe flesh of an animal when it is used for fooda drink made with the juice of lemons, water, and sugara sweet food made with a mixture of flour, eggs, fat, and sugar...

Integrated Medical Wellness Get to Know Us 2023-06-13

14 Items: The owner of the clinic.The psychiatrist on staff.The medical provider on staff.The house manager of Maya house.The house manager of Melinda house.The facilitator with the fancy haircut.The administrator for the whole clinic.The medical biller working the front desk.The therapist in charge of everyone's care....

Beauty 2023-10-25

50 Items: spagellooksstylenailscurlscreammouseblushbrushbeautymakeupfacialpampervanitylotionprimerpowderpolishfashionglamourclothesperfumehaircutmassagejewelrystylistmascarashampoocologneretinolskincarecosmeticflatirongroomingwellnessbathbombhaircarelipstickeyelinereyecreamvitaminslipglosshairstylehairdryereyeshadowconcealerhairsprayfoundationconditioner

Topic 1 - Introduction to Geography 2025-10-07

10 Items: County that Telford is located inRegion that Telford is located in______ jobs provide services e.g. teacher______ jobs collect raw materials e.g. farmerMade up of 3 nations: England, Wales and ScotlandStudy of the Earth's surface, environments and people_______ geography is the study of people and manmade features...

The Effects of Unionized Nursing on Patient Outcomes 2024-12-02

10 Items: SafetyBenefitsAdvocacyRetentionWhich act defines scope of practice and governs nursing unionization?Unionization provides reduced burnout and improved job satisfaction for this population.Unionization provides safer environments and consistent care standards for this population....