fruit s basket Word Searches

One Team, One Mission Word Search 2025-05-13

15 Items: North ____ HealthcareOne ____, One MissionHigh ______ OrganizationNCH embraces a ______ cultureToday (Thursday)'s dress-up themeBehavior Standard beginning with CAcronym for our new standards of behaviorA week-long opportunity to celebrate our staffAt NCH, we engage in open and ___________ communication...

BTS and SKZ 2025-12-01

26 Items: hairband!Baby Mochihas two catsGolden Maknaeaussie leadermaknae on topLeader of KpopJin's NicknameJk's dog's nameRM's pornesian _____hobi's favortie drinkWinter bear (full name)_______ in the buildinghobi hates these animalsP-A-S-T-A and _____ -Jinsecret secret is SO amazingJk's english is so ____ -RMvoice doesn't match his face...

FOOD 2024-04-22

16 Items: tastes goodsugar is ______lemons are ______you cook food in thisyou cut food with thisstrong coffee is ______the first meal of the dayyou wash dishes in the _____how you feel when you want to eatyou put food in this to keep it coldthe person who cooks food in a restaurantto stay healthy, always eat fruit and _____...

Anther Word Search 2025-03-17

16 Items: stylemale part of the flowerfemale part of the flowerbig and flat to capture sunlightpart of the flower with the pollenhow plants turn sunlight into foodgreen molecule found in chloroplaststransports water throughout the planttransports sugar throughout the plantreaches down into soil to gather watercell organelle where photosynthesis occurs...

seniors! 2026-05-14

15 Items: what collage is Leia going to?what collage is ruby a going to?what collage is joey s going to?what collage is Nora m going to?what collage is Nick v going to?what collage is Sean e going to?what collage is addi t going to?what collage is bella g going to?what collage is Anthony going to?what collage is Ashely b going to?...

Word Search 2022-10-13

19 Items: A feelingYellow fruitEnglish alphabetThe place we liveCapital of AmericaState with four i'sA very cold countrySmall armored animalA day where one is bornBest gym in the countryAlcohol, typically from ScotlandA series about six friends in NYTechnical item we cant live withoutOur really amazing teacher in English...

Vocabulario- Auténtico 1, Para Empezar 1 En La Escuela (PE 1) Word Search 2024-08-27

37 Items: 0123HelloPleaseSir/Mr.NothingSee youLikewiseAnd you?And you?Good byeDelightedmiss/MissThank youMadam/Mrs.Okay,so-so(Very) WellGood MorningGood EveningHow are you?Your WelcomeMy name is...See you laterGoood AfternoonSee you tomorrowWhat time is it?It's one o'ClockWhat´s happening?Thirty, Half pastWhat is your name?Pleaed to meet you....

Diabetes Crossword Puzzle 2025-12-11

7 Items: Law that eliminated redlining in 1968Can be seen as Type 1 or Type 2. What this section is all about!When two things are unequal, like neighborhoods in San FranciscoUsed to treat diabetes, and helps your body turn sugar into energyAfrican Americans are this percent more likely to have Diabetes in San Francisco...

Changing the Game 2026-03-26

11 Items: A player on the other teamSuggested or introduced as an ideaPlayers who try to hit the ball in baseballPeople in charge of enforcing rules in a gameBlocking a shot before it can go into the basketSomething that happens to you and helps you learnWithout being affected by something; no matter whatSitting or standing in a drooped or discouraged way...

NAKLJUČNO O TEBI 2025-03-14

11 Items: barva tvojih lasjamski škrat (na p)tako rekoč simbol rudarjevtobakove rolice, uporaba pri kajenjupijača, ki jo rad piješ ob kakšnih jutrihtudi njih popravljaš, namenjene so košnjitvoj stari avto znamke suzuki (na s, bil je kockaste oblike)ta sladica nas vedno spomni na tvoje ime (brez zamere) (vsebuje kokos)...

1. Word Search 2026-06-15

8 Items: You use this to cut food.You use this to eat soup or yoghurtsThis is something small you eat between meals.You use this to hold food and put in your mouth.This food is usually round and comes from Italy.You eat these. They are small and green or black.You put this in food to make it more tasty. It’s white....

Ball games 2023-03-18

11 Items: You hit the ball with a racket.You kick the ball and pass the ball.What do you do when you get a point?You throw the ball and catch the ball.You hit the shuttlecock with a racket.What is the word for getting the ball?You throw the ball in a basket to score.What is the word called when you hit a ball?What does the ball do when it goes up and down?...

World's Hardest Wordsearch 2025-12-18

1 Item: Canine Companion, M__'s ____ __ie_d, A __t!

SUMMER 2025-11-30

15 Items: I fly high in the wind.what summer is all about!a way to travel on water.a juicy pink summer fruit.eating outside on a blanket.a sandy place where you swim.the ocean moving up and down.you can find me on the shore.rub me on to protect your skin.what you do in the pool or ocean.a place full of water to splash in.the warm light that makes summer hot....

Borrowed English Words - J.A. Finley 2023-12-11

15 Items: Word for coffee, 4 lettersA social mistake, 7 lettersA large pink bird, 7 lettersSour yellow fruit, 5 lettersVery strong; masculine, 5 lettersUncoordinated individual, 5 lettersA well-known French pastry, 9 lettersAnother name for a cyclone, 7 lettersHighest ranking naval officer, 7 lettersLarge wave caused by tectonics, 7 letters...

Kugla Word Search 2025-11-17

19 Items: Dan prije Božića.Čime grijemo vrat zimi?Sinonim za riječ "darovi".Vrijeme pripreme prije Božoća?Voda u krutom agregatnom stanju.Snažna snježna oluja praćena vjetrom.Zimzeleno drvce koje se kiti za Božić.Godišnje doma s najnižom temperaturom.Gibanje zraka koje često pojačava hladnoću.Mokri, djelomično otopljeni snijeg na cesti....

Good luck buddy :] 2026-03-26

145 Items: :]KeyJarUrnUFOKegFishKiteTackSafeHookPuckPailMoonySunnyAlarmVoidyQuillQuiltWagonStampAnvilGavelPlatePlankGaugeCiderCageyVinylScrewKazooOrganYo-YoEaselRadarRanchDrillBanjoLanceStarryJanvexDominoShrimpFossilGirderCursorOutletBuzzerTurtleHurdleLocketCobwebAbacusKlaxonShovelScytheNapkinEmblemRacket13JOHVZXeropixZIPFileToolboxTorpedoCowbellRicotta...

Tanks For being a Lovely Gurl 2026-04-12

22 Items: L/44,1965, cannonGerman,1979,best MBT?Russian, sniper, NagantPersonal armored vehicleBlocks signal, scorestreakPineapple, stick, fire etcStandard rifle round,not 556multiple layers, plastic, metalsemi-auto, American rifle, Ping!Indian, rifled gun, extremely heavynamrehs backwards, World War 2, 75mmtank destroyer, Korean War,long range...

Animal Word Search 2025-11-16

12 Items: star-nosedmicroscopic “bears” in “water”three hearts, blue blood, and a beakunderwater crop circle artists and balloonistsmammal with the longest gestation (around 22 months)a bear with transparent fur (hollow hairs) and black skinmammalian architects whose creations can be seen from space...

ww4 u16 2024-09-23

15 Items: a flowershabby and worn outto cut off branchesheavily built; thicksetto strongly dislike or hateto put out as a fire or lighta place where fruit trees growa large branch or limb of a treeoften seen or experienced; knownwell-suiting, fitted, appropriatehappy with what one has, satisfiedto gain or get by making an effort...

Vesturheimsferðir og nýlendustefnan 2024-10-30

14 Items: Hvaða viðurnefni fékk David Livingstone?Hvaða íþróttasamtök voru stofnuð árið 1904?___________ og landkönnun var helsta markmiðið þarnaHvaða land var kallað "dýrasta djásn" bresku krúnunnar?Deilur um ____________ komu af stað borgarastríðinu 1861Landamæri álfunnar voru ákveðin á þessari samkomu árið 1885...

Cooking Around the World 2025-11-30

15 Items: salty, sweet, sour are?I make food taste exciting!stirring ingredients together.the person who cooks the food.a hot place where burgers cook.a cheesy circle kids love to eat.long, squiggly strands you can slurp.tiny white grains found in many meals.warm and served in a bowl with a spoon.noodles’ Italian cousin in many shapes....

Priče iz davnine 2023-11-30

12 Items: Djed triju dječaka.Vladar zlih i opakih sila.Silno je bogat i stoluje pod morem.Strašni zmaj s Kiteža kojeg je ubio Relja.Moćna sila vladala na zemlji poglavito u močvarama.Prekrasan mladić zamišljen umjesto sunčane svjetlosti.Tajnovita planina na kojoj se zbivaju svakojaka čuda i strahote....

Priče iz davnine 2025-12-21

12 Items: Ime ribarevog sina.Vladar šumskih bjesova.Majka Jaglenca i Rutvice.Starac koji je imao tri unuka.Bog Sunca koji je unucima rekao istinu.Ime orla koji je Rutvicu odnio na Kitež-planinu.Ime medvjedice koju su Zatočice poslale da naudi Jaglencu.Ime ribara koji je ostavio ženu i dijete u potrazi za bogatstvom....

Vocabulario 1.1 2023-09-27

39 Items: orbutmorealsowaterfruitjuicefriespizzato eatto buyto runcookiebeforeto restto drawto workto swimto drinkto writeto studyactivityice creamsoft drinkto do homeworkto play soccerto read a bookto ride a biketo ride a horseto learn Spanishto go for a walkafterward, afterto listen to musicto practice sportsto play the guitarto watch television...

E3C2 2024-11-12

36 Items: newgamelateagainvarioushometownfestivalancestorfull moontraditionlong timegame of yutholiday foodNew Year's bowrice cake soupHappy New Yearto make a wishname (honorific)meal (honorific)the solar calendarthe lunar calendarto die (honorific)traditional holidayto talk (honorific)to spend (day, time)to sleep (honorific)New Year's gift money...

How Well Do You Know Us/Me? 2026-05-14

21 Items: My favorite foodMy favorite fruitMy favorite seasonFirst date locationMy favorite TV showMy favorite F1 teamMy betta fish's namee month I was born inOur future dog's nameWhat's my middle name?What color are my eyes?What are my dog's names?Am I a cat or dog person?What soda is my favorite?My favorite day of the weekOne of our favorite restaurants...

Adventure Word Search 2026-05-21

129 Items: capfunhathoticesunantsballboatcampdiveheathikekitelakelawnlilyparkpoolraftrosesandshipsledsodabeachcanoechillclouddaisyferryfloatfruitgamesgrillhoneyhumidjuicekayakmangomelonoasisoceanpeachrelaxriverscubashellbikinibreezebucketcastlecoolercruisedivingflowergardenhikingicepopislandjunglelotionloungepaddleparadepicnicsandalshortsshowersplashcamping...

Palabras al Azar 2023-03-07

20 Items: a sneaky animalan extoic fruitMan's best friendthe color of an applemoisture for the skina device you play withword describing an injurya color on the Honduras flagwhat people drive on an dailytrips people take to get awayword describing having to waittype of support to help you seeword describing a tiring feelinga subject dealing with chemistry...

Vocab man 3A 2026-03-25

55 Items: hamteaeggsmilksodamealwithbreadtoastbaconlunchsaladapplepizzawaterdrinkneverwhichcerealbananayogurtcookieorangecheesecoffeeto eatalwaysI loveI likeright?sausagehot dogwithoutlemonadeiced teato drinkto shareyou loveyou likebreakfastfor lunchhamburgerevery dayof coursehow awfulfruit saladapple juicestrawberriesfrench friesorange juicemore or less...

Jon & Gloria 2026-06-22

22 Items: Brides last nameGroom's hometownThe Bride's collegeThe Brides hometownWhere the couple metHoneymoon destinationThe Groom's other jobName of the brides carThe Bride's birth monthGroom's favorite dessertThe couples favorite foodThe couple's favorite showThe couples favorite pizzaThe couple's shortest childThe month the Groom proposed...

food 2023-02-10

12 Items: a food that grandpa makesa green fruit I really likea green food that I really likea desert you have at your birthdaya round food you have for breakfasta orange vegetable with green leavesa yellow food that people like with buttera yellow food you can put on pizza or salada food with lettuce tomato's and other things...

Genocide Darfur 2025-09-08

8 Items: How many people were killed during the genocide?Against what ethnic group(s) was the Dafur genocide?What role did the Sudanese government play in the genocide?Which neighboring country received the most refugees from Darfur?What was the name of the Sudanese president indicted for war crimes?...

Green and human wellness certification 2026-04-23

9 Items: Energy efficient plumbing fixturesA LEED concept that refers to liquidsA strategy from the Mind concept of WELLThis WELL categories involves fruit and vegetablesThis type of garden supports mental and physical healthLiving Building Challenge uses these for their conceptsA Living Building Challenge concept that supports a just and equitable world...

SGEU Halloween - Find A Word 2025-10-01

25 Items: Where did Halloween originate?What do you call a group of witches?What is another name for a werewolf?What do the Irish bake on Halloween?What famous person died on Halloween?What is the fear of Halloween called?Which state produces the most pumpkins?What is another name for a pumpkin seed?What Halloween candy was named after a horse?...

everything 2024-12-10

250 Items: figskysuncaroiloldfogwetpenhatbeeantcowpigfoxcatdogdameggairgymowlonetwosixtenricepeascornlakebluebeeshivesandsaltfishwirecoldrainmosspinebodyfrogwormbearwolfboarlioncrablimeporkbeefmoldflaggolfbirdbassfourfiveninetapegluefruitapplemangopeachonionthymewheatpecantablechairgrasswaterriveroceanhoneybeachrockssharktreesseedsphotopaperfrostcellshuman...

Türkçe karakterler (Ç, Ğ, İ, Ö, Ş, Ü) İngilizce karşılıkları olan (C, G, I, O, S, U) harfleriyle yazılmıştır. 2026-04-14

30 Items: IKLIMKROKIMUCITUYGURFETIHISKANHARITAPATENTKULTUREMPATIMATBAAFRIGLERKOKTURKPARALELEKVATOROSMANLISUMERLERHITITLERKURULTAYIPEKYOLUMERIDYENILETISIMURARTULARISLAMIYETMALAZGIRTFERHATHOCAFENERBAHCESORUMLULUKLIDYALILARSOSYALBILGILER

AthenaUmishaM 2025-05-02

25 Items: Umisha's star sign?Umisha's Nans name?Couple's Profession?Month Athena was born?Mitchells first school?First holiday together?Month Mitchell was Born?Umisha's favourite fruit?Athena's Boyfriends name?What dog breed do we have?Which twin was born first?Where did Mitchell propose?What is Umisha's degree in?Where was their first date?...

Abundance Word Search 2025-11-15

129 Items: JoyLawPieBeanFallHomeOvenRealSideStewVineAcornBreadCakesFeastFirstFlourFruitGrainGreenLivesLunchMapleMealsPartyPeacePlumpRoastRootsSaladShareSixthSouthSpiceStateSugarSweetThirdUnityAutumnButterCashewCenterDinnerEatingFamilyFourthGivingGobbleGoldenLegacyLegendMashedNativeOriginParadePlentyPrayerRecipeSaucesSeasonSquashThanksTreatsTurkeyWarmthWinter...

Hickam AFB 2025-11-26

27 Items: Our streetVacation condoVacation islandVolcano in MauiVolcano in OahuOur favorite mallThe other big mallFavorite pizza placeBig comet in the skyNeighbor to our leftOur elementary schoolThe Blazer’s nicknameRyan’s ride to the BXThe big pink hospitalTasty fruit from DoleNeighbor to our rightBeach we went to oftenThe Gibsons lived here...

Vocab 3A 2026-03-19

54 Items: hamteaeggsmilkwithbreadtoastbaconlunchsaladapplepizzawaterdrinknevercerealbananayogurtcookieorangecheesecoffeeto eatalwaysI loveI likeRight?sausagehot dogwithoutlemonadeiced teato drinkto shareYou loveYou likebreakfastfor lunchhamburgerevery dayof coursesoft drinkfood, mealHow awful!fruit saladapple juicefrench friesWhich?/What?more or less...

Inappropriate for Dress for Success 2026-04-20

10 Items: COMFY PANTS FOR SWEATING AT THE GYMSHIRTS THAT SHOW TUMMY/BELLY BUTTONSSHOE THAT CAN BE PUT IN "SPORTS MODE"TIGHT COMFY PANTS ENJOYED BY MANY WOMENSKIMPY ITEM OF CLOTHING INTENDED FOR THE BEACHSHOES MADE FROM LEATHER, MADE FAMOUS BY HIPPIESSHOES THAT ARE INTENDED FOR COMFORT AROUND YOUR HOME...

Word Search puzzle 2024-12-09

20 Items: You sit on thisFull of pages to readMakes a ringing soundA white drink from cowsShows hours and minutesA round object for gamesWiggly and sweet dessertA tall plant with branchesWhite and fluffy in the skyA round fruit, red or greenA bird that quacks and swimsUsed to carry books or itemsShines bright in the night skyA creature that lives in water...

Abundance Word Search 2025-12-12

129 Items: OxDogFanPigRatRedCoinDrumFireFishGiftGoatGoldGongHomeJadeKnotLionMoonMythNianSilkBloomBrushCycleDanceDeityEarthFagaoFeastFruitHorseIngotLotusLuckyLunarMetalMoneyOperaPeonyQipaoSheepSnakeAngpaoBambooCustomCymbalDragonFamilyGingkoJujubeLegendLycheeMonkeyOrangeOrchidParadePeanutPomeloPrayerRabbitRitualScrollShrineSymbolBanquetCaishenCostumeCouplet...

Adventure Word Search 2026-05-21

129 Items: capfunhathoticesunantsballboatcampdiveheathikekitelakelawnlilyparkpoolraftrosesandshipsledsodabeachcanoechillclouddaisyferryfloatfruitgamesgrillhoneyhumidjuicekayakmangomelonoasisoceanpeachrelaxriverscubashellbikinibreezebucketcastlecoolercruisedivingflowergardenhikingicepopislandjunglelotionloungepaddleparadepicnicsandalshortsshowersplashcamping...

9321 The Sower 2024-03-06

10 Items: A person who plants seeds.Ground or soil that has a lot of rocks.Sharp, pointed parts of certain plants.Rised every morning and warms the earth.Rich, healthy soil that helps plants grow.The result of a plant growing and producing.A way or track laid down for walking continual repeatedly.A simple story used to explain a moral or spiritual lesson....

AD-SOYAD............................... bulmacada (Ç, Ğ, İ, Ö, Ş, Ü) yerine (C, G, I, O, S, U) harfleriyle yazılmış olabilir. 2026-04-14

32 Items: SIVASLOZANHAVZACEPHEKANTEAMASYAKONGREMECLISBALKANKAFKASBILECIKSELANIKERZURUMLAIKLIKMUDANYASAKARYAMONDROSISTIKLALMUCADELEMANASTIRCANAKKALEFERHATHOCAFENERBAHCECUMHURIYETBASKOMUTANMODERNISIKTRABLUSGARPMISAKIMILLIMUSTAFAKEMALKUVAYIMILLIYETEKALIFIMILLIYETESKILATIESASIYE

TANKS 2026-02-14

151 Items: L3AGSIS2IS3IS4IS7AjaxCV90EMBTM-84M1E3M6A1M103M109OF40SemoADATSASU57BMP2MCATTBHSTVLKF51UKPz70M36B1M36B2MBT70PGZ09PT76EArcherArieteConwayFiros6FV4005GBT155HetzerISU122M6A2E1M10GMCM41DK1Obj195Obj268Obj277Obj279Obj299Obj477Obj490Obj730Rapier2s7PionAbramsXBTR82ATG6RhinoK30BihoM109-52MachbetNamer30PumaIFVConcept3EMBT2022Leopard1M48PerehM50OntosM91Vihor...

Holly Jolly Week 2023 Word Search! 2023-12-13

16 Items: North pole employees2023 BRR Word of the Year"Furnishing Life's Best ____"The Grinch's canine companionRed and White striped holiday candyFestive red plant, a holiday favoritewarm and cozy garment for chilly daysfestive decoration often hung on a treeFall fruit often found in sauce or juiceFestive drink with eggs, milk, and spices...

Study guide for Our Midterm! 1.0 2026-01-14

16 Items: A fertilized egg cellWhen a seed begins to growA fast, automatic responseDifferent forms of the same geneA nerve cell that sends messagesThe organ that controls the bodyWhen a sperm and egg join togetherThe part of a plant that holds seedsReproduction that needs only one parentSections of DNA that carry instructions...

Vocabulary Word Search 2025-10-29

10 Items: A horizontal row on the periodic tableA vertical column on the periodic tableThe electrons found in the outermost energy levelThe number of valence electrons that a neutral nitrogen hasThe number of protons in an atom; it identifies the element.The total number of protons and neutrons in an atom’s nucleus....

Project 5 2025-08-20

1 Item: a red fruit

Kulturna baština na dlanu 2023-04-07

23 Items: VLADAR U EGIPTUMAUZOLEJ U INDIJIHRAM SVIH BOGOVA U RIMUAKTIVNI VULKAN BLIZU NAPULJATRADICIONALNA JAPANSKA VRATAJEDINO SAČUVANO SVJETSKO ČUDODRŽAVA U KOJOJ SE NALAZI CHICHEN ITZAMITSKO ČUDOVIŠTE - POLUBIK I POLUČOVJEKKAMENE KUĆICE GRAĐENE TEHNIKOM SUHOZIDANAJPOZNATIJA VUČEDOLSKA KERAMIČKA POSUDAPREZIME INŽENJERA SLAVNOG TORNJA U PARIZU...

Funny Ham Radio 2024-11-19

25 Items: "More power!""Beep boop beep.""How strong am I?""Is this thing on?"Wart (power supply)"Ham radio in space!""Hopefully it's low!""I need more spectrum!"Load (not the operator!)"Chasing those rare ones.""Who can talk the fastest?""Gotta keep the noise down.""My other antenna is a dish.""Just chatting with friends.""Sounds like a blender in here."...

OSMOSMIJERKA - Organski sustavi čovjeka 2023-03-15

12 Items: Vrsta zuba s kojima se siječe hranaOrgan u kojem nastaje kloridna kiselinaKemijske tvari koje ubrzavaju proces probaveNajveća i najelesatičnija žila u ljudskom organizmu.Parni organi u ljudskom organizmu koji proizvode mokraćuOrgan u ljudskom tijelu koji nadzire rad svih ostalih organaOrgan u kojem se izmjenjuju plinovi kisik i ugljikov dioksid...

Test 2025-12-07

10 Items: Where John stood—and where God often speaks.What Jesus says our hardest moments can become.How prayer used to feel—and sometimes still does.What John’s hard words were always meant to offer.The outcome of real repentance—something shareable.The winter in the room when someone beloved is gone.What must sometimes be cleared—and sometimes deepened....

Introducción a la Unidad 2: La comida 2026-01-12

10 Items: Another word for tasty or yummyA drink made by squeezing orangesCrispy chicken cooked in oil, like at KFCLong yellow fruit that Minions really enjoyWhen a person likes one thing more than anotherClear liquid that every living thing needs to drinkWhen a person gives something to others, they _____...

Growth 2023-06-28

12 Items: An animal that eats acornsThis big ape is endangeredThe name of an oak tree's seedThis animal lives in AustraliaThe type of snake that Mr Stones hasThe found that Mr Stones' snake eatsA fruit that is grown in the rainforestWhat you have made from toilet rolls this weekThe continent that Mr Davies' parakeet comes from...

Hidden Halloween Words 2025-10-07

10 Items: A spooky friend that says “Boo!” 👻It spins sticky webs to catch bugs. 🕷️It shines bright when it’s dark outside. 🌕A flying animal that loves the night sky. 🦇The sweet treats we get on Halloween night. 🍬She flies on a broom and wears a tall hat! 🧙‍♀️A spooky word for a place ghosts might visit! 🏚️The orange fruit we carve into Jack-o’-lanterns. 🎃...

Madison & Wyatt 2025-01-21

20 Items: The wedding date.The name of the groom.The name of the bride.The name of the venue.For cards from guests.The month of the wedding.A favorite candy of the groom.What is the groom’s favorite drink.Dessert being served at every table.One of the bride’s favorite candies.Carries a basket during the ceremony.The main entrée for the dinner buffet....

HEF Rules 2026-04-20

20 Items: Rule 4: ____ Hard.Rule 5: Have ____.Rule 2: ______ your peers.Rule 3: _____ your school.Who should you ask for help?Can you jump off the swings?Where does your backpack go?When should you use the bathroom?Who is the Yellow Team counselor?How many minutes is each rotation?Who is the counselor of Green Team?Rule 1: ______ and Follow Directions...

My Bedroom 2026-05-08

41 Items: boxartfanbagdoorwallrobemesswiregamephonetablemarkerstickerblanketchargerlightswitcha "big phone"a type of shoethings you wearopposite of darka place for trashsomething you readalso a type of shoesomething you solvesomething you sit onsomething you sleep onsomething you write onsomething you play witha basket to put laundrya light you use at night...

4Boat 2026-02-11

30 Items: 🤷 <-- memeMeat StickLouie's Pal!Race of EarlsJeff's SpeciesEddie usernameEarls Astrology SignSoldier:76's #1 qualityCoolest Underwear DesignWatch This to See BomburRed Vehicle, Shoots WaterBest Shark Movie ProbablyBoat's Favorite Pixar FilmSomebody Scratch HIS back!Give a Shoutout To My ___!Fortnite Streamer HairstyleBoat's Newest Overwatch Main...

Homework 2026-03-26

14 Items: opposite of backits the same as campingyou stop doing somethingyou do this with your noseyou use this to make a tunething that not lasting for long.this is make a sound of uhhh(angry)if you go up a rock you will have toa healthy food which includes mango.You have to often do this to you pencila person of the highest rank or authority...

KUIS TEKS PROSEDUR 2025-11-12

15 Items: "Peganglah (P) + gagang pintu (S)"Teks prosedur harus disusun berdasarkan tahap yang...Bagian inti teks prosedur yang berisi urutan kegiatan.Petunjuk langkah-langkah melakukan sesuatu secara benar.Bagian awal teks prosedur yang menjelaskan maksud kegiatan.Kalimat yang berisi perintah untuk tidak melakukan sesuatu....

Prirodna i kulturna baština nizinskih krajeva 2024-11-20

13 Items: Gdje je pronađena Vučedolska jarebica? ______________________Što se nalazi u Iloku, Vukovaru i Čakovcu? _____________________Što ljudi najčešće promatraju na Lonjskom polju? ________________Kakve kuće se nalaze u Posavini kraj Siska? _____________________Koja životinja je posebni ukras Kopačkog rita? _____________________...

Cheetah Word Search 2025-10-12

10 Items: – What fruit do monkeys love to eat?– Which colorful bird can sometimes talk?– Which animal is the fastest runner on land?– Where do hippos and crocodiles like to swim?– What do giraffes eat from the tops of trees?– Where do campers sleep during a safari night?– What shines bright and hot in the African sky?...

Kindness towards animals 2023-02-22

11 Items: Animals provide us with sThey give us c as petsThey can guide b peopleIslam f to treat any animals badlySome pets can really teach you a lot about fWe are allowed to keep birds and f as petsSome pets are meant to live freely and not kept in a cWe are only allowed to keep d as pets for security reasons...

Riješi osmosmjerku s imenicama u vokativu. Pronađi u njoj zadane imenice.  2018-01-23

6 Items: đačebežemomčevraželovčevojniče

Digraph Practice - Ch Sound 2025-04-22

7 Items: write or draw witha domestic fowl kept for its eggs or meatis a type of dairy product made from milka sequence of items of the same type forming a lineis a large storage box with a lid hinged at one sidea seat typically having four legs and a back for one persona small, round, soft red or black fruit with a single hard seed in the middle

Unit 3 Review 2023-01-29

16 Items: of low quality, or not acceptableenjoyable, pleasant, or interesting:the liquid that comes from fruit or vegetablesthe flesh of an animal when it is used for fooda drink made with the juice of lemons, water, and sugara sweet food made with a mixture of flour, eggs, fat, and sugar...

9 2025-09-03

1 Item: tree, shoe, cup, basket, cap, lap

Literary GENRES 2024-11-07

11 Items: first tale collectors brothersThe Iliad and The Odyssey´s authorfabulist who was inspired by Aesopmain purpose of this genre is to entertainMedieval Latin term that means “things to be read.”author of "Pride and Prejudice" (1812), and "Emma" (1816),contains third-person narration and an omniscient narrator...

SAMPLE GRIDLOCK 2025-08-08

15 Items: An expression of happinessA vehicle that runs on tracksA piece of furniture to sit onThe natural satellite of EarthA large natural stream of waterA plant with a trunk and branchesAn animal with feathers and wingsA white liquid produced by mammalsA staple food made from flour and waterOrganized sound that is pleasant to hear...

Review Unit 1 and Unit 2 2025-10-04

2 Items: gym, reading, science, math, English, art, computers,homework, grade, flowers, rice, fruit, bike, camera, markers, building, bricks, guitar, robot, skateboard, tablet, cool, old, new, borrow

Životni uvjeti okoliša 2023-04-20

20 Items: najplodnije tloizmet domaćih životinjatlo se razlikuje po b_ _ _mijenja se ovisno o dubini tlatlo se razlikuje po s_ _ _ _ _ _ostaci biljaka i organskih ostatakatlo se razlikuje po v _ _ _ _ _ _ _ _tlo se razlikuje po k _ _ _ _ _ _ _ _sijanje biljaka mahunarki (djetelina)rahli rastresiti sloj Zemljine površine...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

Ponavljanje 2023-09-05

23 Items: Solus znači?Suze kojeg sina?Greška je u našim...Djelo Petra Zoranića.Ribanje i ribarsko...Otac detekstivske priče.Cvijet u Cvijetu s Raskršća.Zastrašujući likovi i događaji.Najvažniji pisac hrvatske moderne.Zbirka pjesama Ivana Bunića Vučića.Kranjčevićeva pjesma Gospodskomu...Vrsta romana Patnje mladog Werthera....

DOŠAŠĆE 2024-12-06

31 Items: ________ letećZlatnih _______Hvalospjev MarijeRaduj se o ________Zdravo budi _______Klikujte sada ________Raduj se grade ________Broj nedjelja u došašću?__________ nebesa odozgoAdventus znači __________Padaj s ______ roso svetaPoslan bi anđel _________Čuj, jasni______ odjekujeIme iščekivanog spasiteljaLiturgijska boja u došašću?...

Word Search Trivia 2026-02-12

26 Items: Favorite pieMy middle nameMy zodiac signMy favorite popMy favorite mealI love watching…My favorite colorMy favorite seasonMy favorite holidayUnscramble: iouyevolSecond favorite colorPlace of our fist dateYour favorite MLB teamRandom place we had s*xMy go to ice cream orderMy soccer number growing upWhat makes me the happiest?...

LITTLE RED RIDING HOOD 2023-07-31

1 Item: BASKET,BED ,HOUSE, FLOWERS, WOODCUTTER, FOREST, GRANDMOTHER

Ponavljanje 2026-04-07

1 Item: sprava s pomoću koje se možemo orijentirati u prostoru

Numbers and nouns 2025-05-22

13 Items: 10 x 10.Numbers from 1-10.Popular type of transport.The opposite sequence of number 3.Common fruit that is red or green.Bigger than a town, smaller than a country.Furry animal that lives in houses and barks.We read them to learn information or stories.Sequence of numbers that start with 1, 3, 5, 7, 9....

Leaf Word Search 2025-07-15

20 Items: What anchors a plant?What is an unwanted plant?What gas do plants release?What action transfers pollen?What provides energy for growth?What germinates into a new plant?What is the process of flowering?What part performs photosynthesis?What medium do most plants grow in?What develops from a flower's ovary?What kind of plant climbs or trails?...

Names In The Bible 2025-08-17

24 Items: Mother of IsaacHe built and arkBrother of MosesThe fallen angelHe betrayed JesusOur Lord and saviorThe mother of JesusHe's Jesus's cousinHe parted the Red seaJohn the Baptist's momThe first man on earthFather of many nationsHe denied Jesus 3 timesHis wife turned to saltAte the forbidden fruitHis donkey spoke to himFirst man to commit murder...

Coffee 2026-01-17

25 Items: Balanced roast levelBeans from one regionHeated milk for lattesClassic filtered coffeeGolden foam on espressoEspresso with foamed milkManual drip brewing methodPlunger style coffee makerPressurized brewing deviceDesigns made in latte foamCoffee steeped in cold waterMost popular coffee bean typePaper or metal brewing screen...

Holes Word Search 2023-05-05

18 Items: Who is shot and killedHe loves sunflower seedsThis man has stinky feetMr Sir loves to eat theseWhere is the camp locatedThis boys underarms stinkWhat vegetable does Sam sellWhat subject is Zero good atThis is Stanlley's counselorWho wears red venom nail polishwho helped Stanley dig his holeWhat did the Warden do to Mr. Sir...

me gusta 2025-10-24

18 Items: to consume foodto take a strollto consume a liquidcarbonated beverageto put words to paperliquid you need to surviveto close one's eyes to regain energysomething you need to do to make moneycinematic film meant for entertainmentto move on foot but quicker than walkinga digital program meant for entertainment...

South America Funny 2025-07-03

15 Items: What does a lazy volcano do?What's a dancer's favorite dip?What grain is always feeling super?Where do mountains go for a spa day?What fruit says "Bonjour, bonjour!"?What do you call a dramatic pack animal?What fish writes the best scary stories?Where do super strong women like to shop?What animal is always dressed for winter?...

Dairy Products 2026-02-06

15 Items: Percentage of Reduced fat milkA good source of this food groupFat Type of fat in dairy productsLiquid produced from cows, sheep, goatCreamy frozen treat which, high if fatHeated cheese, and butter turn to liquidAdded essential vitamin, metabolic functionMixed whole milk, fat that does not separateCreamy, sour dairy product, often with fruit...

programske simulacije 2023-04-18

3 Items: virtualni program kojemu je svrha stvoriti vlastito iskustvo korisnikaprojekt koji je osmislio i vodio projektni tim dizajnera, istarživača, učitelja i programera na sveučilištu u Coloradu koji izrađuju simulacije iz raznih znanosti...

vocab list 3A 2024-11-21

55 Items: hamteaeggsmilkwithbreadtoastbaconlunchsaladapplepizzawaternevercerealbananacookieorangecheesecoffeeto eatalwaysI loveI likeright?sausageyougurthot dogwithoutlemonaidiced teato drinkto shareyou loveyou likebreakfastfor lunchhamburgerfood/mealevery dayof coursehow awfulsoft drinkwhich/whatfruit saladapple juicestrawberriesfrench friesorange juice...

spanish 2024-11-26

55 Items: hamteaeggsmilkwithbreadtoastbaconlunchsaladapplepizzawatercoffenevercerealbananayogurtcookieorangecheeseto eatalwaysI loveI likeRight?hotdogsausagewithoutlemonadeiced teato drinkto shareeverydayyou loveyou likebreakfastfor lunchhamburgerfood,mealof coursesoft drinkHow awful!fruit saladapple juicestrawberriesfrench friesorange juicewhich? what?...

El Hombre de Vocabulario/Quizlet 3A 2024-11-26

55 Items: hamteaeggsmilkwithbreadtoastbaconlunchsaladapplepizzawaternevercerealbananayogurtcookieorangecheesecoffeeto eatalwaysI loveI likeRight?sausagehot dogwithoutlemonadeiced teato drinkto shareyou loveyou likebreakfastfor lunchhamburgerevery dayof coursesoft drinkfood, mealHow awful!fruit saladapple juicestrawberriesfrench friesorange juiceWhich? What?...

Vocab List 3A 2023-04-28

55 Items: HamTeaEggsMilkWithBreadToastBaconLunchSaladApplePizzaWaterNeverRightCerealBananaYogurtCookieOrangeCheeseCoffeeTo EatAlwaysI LoveI LikeSausageHot DogWithoutLemonadeIced TeaTo DrinkTo Shareyou LoveYou LikeBreakfastFor LunchHamburgerFood,MealEvery DayOf CourseHow AwfulSoft DrinkFruit SaladApple JuiceStrawberriesFrench FriesOrange JuiceMore or Less...

Most Common Words That Start With F 2025-05-02

142 Items: fanfarfatfeefewfitfixflyforfunfacefactfadefailfairfallfarmfastfatefearfeedfeelfilefillfilmfindfinefirefirmfishfiveflagflatfleeflowfolkfoodfootformfourfreefromfuelfullfundfaithfalsefaultfavorfencefewerfiberfieldfifthfiftyfightfinalfirstflamefleshfloatfloorfocusforceforthfoundframefreshfrontfruitfullyfunnyfabricfactorfairlyfamilyfamousfarmerfather...

Bethany's Puzzle Pod Word Search 2025-12-19

21 Items: fave fruitJen's daughterOne of your BffsZack's cousin nameYour favorite ColorYour favorite flowerYour Daughter's nameZacks favorite Hockey TeamYour sister's hogwarts houseYour favorite amerian girl dollZack's favorite sister (i think)our fave dessert when I come overYour favorite Star Wars CharacterYour favorite Harry Potter Character...

Federal Financial Aid Word Search 2024-10-24

12 Items: COA-SAI= ___________ _______.Website where a student completes the FAFSA.Total amount of awards cannot exceed this amount.Process of paying charges on a student's account.Student must sign this agreeing to repay student loans.federal law that protects students educational records.The limit on how much loans a student can take out overall....

Intermediate I 2025-09-29

13 Items: Me permite capturar pantallaMe permite cambiar de ventanas.Me permite imprimir información.Me permite copiar texto, imágenes.Me permite agregar una pagina a favoritos.Principal característica de la IA GenerativaMe permite abrir una nueva pestana en el navegador.Programa de Inteligencia Artificial creado por la empresa OpenAI...

Takesix Word Search 2024-02-24

11 Items: Ra: The Egyptian ___ god.The crystal of true love.Hades' sacred counterpart.The state where I regrettably live.This last name is sitar-playing royalty!The ancient African kingdom south of the Nile.This cane-carrying rogue kept Joni's camera to sell.This black male acapella group's name plays on a Dave Brubek hit...