fourth of july Word Searches

Break of Day 2025-10-20

36 Items: daysundusknoonhoursunupstartbeginclicknightdawnsauroramiddaysunsetzenithsinkinsunrisemorningpredawnsundownpredawndaybreakdaylighttwilightmidnightcockcrowdarknessdayspringnightfallafternoonnighttimeforbiddenpenetratefirstlightbreakofthedaysummersolstice

End of year 2025-12-15

67 Items: tiesixsadshybeltsuitcoatbillmenulazytillboredbeardwindyfoggysalesliftsgatessevenshelfhappyfunnyhoteltiringheightcloudyabroadcameraflightrelaxedhelpfulcampingclothespaymentwebsiteauctionaccounttrolleycustomslayoverreceiptsnowmanhelpfulclothesnecklacefriendlysunbathecheckoutarrivalsterminaldutyfreecustomerluxuriousvaccumingtalkativeextroventsouvenirs...

End of Year 2025-12-16

28 Items: GusAliJoyLizMrGEllaMrsCJalalPauloMissKMallekOliverJosephAndreaBatoulEshaalEmilioThayirPeteloAustenMohamadZondreiHarrisonMissRossMsGeorgeMrsAdamsMsMartinsMrsDavidson

War of 1812 2025-12-17

49 Items: warseaBayfireDawnStarflagportshipsJamestradestarsbattleanthemAndrewBannerAnthemgoverntreatyAmericaBritishfreedomlibertyMadisoncapitalJacksonpiratesstripesrocketscannonsloomingeconomyperchedfightingnationalSpangledNationalcitizensMarylandquenchedBaltimoreblockadedcommitteesurrenderWashingtonChesapeakeimpressmentdeclarationconstitution

Names of Christ 2025-12-28

25 Items: LordSaviorMasterCreatorProphetTeacherRedeemerAlmightyImmanuelAdvocateWonderfulMightyGodBelovedSonCounsellorHighPriestBreadofLifeKingofKingsOnlyBegottenPrinceofPeaceAlphaandOmegaKingoftheJewsHolyOneofIsraelHeadoftheChurchSonoftheLivingGodEverlastingFather

PART OF HOUSE 2025-12-31

31 Items: ROOFDOORWALLYARDFENCEPORCHCLOCKWINDOWGARAGESTAIRSGARDENCHIMNEYBALCONYMAILBOXBEDROOMKITCHENCUSHIONCURTAINPICTURESPEAKERSHUTTERSDRIVEWAYBATHROOMBASEMENTARMCHAIRFIREPLACELIVINGROOMDININGROOMTELEVISIONCOFFEETABLESWIMMINGPOOL

Branches of Science 2026-01-04

20 Items: BotanyBiologyEcologyGeologyPhysicsZoologyTaxonomyAstronomyChemistryCosmologyPetrologyEntomologySeismologyTopographyArchaeologyMeteorologyAerodynamicsAnthropologyOceanographyPalaeontology

Characteristics of Life 2026-01-06

20 Items: DNACellsLivingEnergyGrowthVirusesOrganismGeneticsResponseStimulusMovementNonlivingEvolutionMetabolismAdaptationDevelopmentHomeostasisEnvironmentReproductionIrritability

Articles of Confederation 2026-01-06

28 Items: warWeaklawsnineJohnKingTaxespeaceShayspowerThirdtreatystatesrightsGeorgedeclareHancockanarchystate'sArticlesMilitarystrengthnationalrevolutiongovernmentdeclarationindependenceConstitution

Types of Winds 2025-12-03

20 Items: loofoehnzephyrsimoomdiabloshamalhaboobtwisterpamperomistralchinooksantaanasiberiananabaticbergwindmaelstromharmattannoreasterkatabaticwillothewisp

Types of Keys 2025-12-03

20 Items: bitlockwardgateleverwaferpianobanjoswitchviolinguitarpadlocktubulartumblerdeadboltskeletoncylinderignitionmandolincombination

Terms of Endearment 2025-12-03

20 Items: mylovecherublovebugcuddlesdarlingfireflytwinklegigglessweetiesweetpeasnookumspreciousmoonbeamdoodlebugsugarplumstarlightangelfacesnugglebughoneybunchsweetheart

Units of Time 2025-12-03

20 Items: hourweekyearmonthepochjiffysecondminutedecadespringsummerautumnwinterperiodmomentcenturyquarterinstantsemestermillennium

Types of Galaxies 2025-12-03

20 Items: oddwavybentweirdlumpyringedclumpystrangeunusualtwistedcrookedknottedtangledchaoticpeculiarunstableirregulardisturbedturbulentintertwined

Units of Measurement 2025-12-03

20 Items: tongrampintinchyardmilemeterliterquartouncepoundgallondegreecelsiuskilogramkilometermillimetercentimetermilliliterfahrenheit

Class of 2033 2026-01-12

56 Items: EliMiaAxlJadeJaceNoahMaraMaciLilyJackBellaSarahAveryKaseyEthanKadenTatumLilahAshyrLouieGavinCarterEvelynAshtonEllynnJosephAdelynZanderMaelieElijahKendalConnerJerseyMonroeSkylerHunterEloiseJethroBridgetAdalynnKarissaBrynleeKieghanBentleyBrandonDelaneyJamesonLillianEleanorBrieanaBrooklynMaverickLillianaLeightonJohnathanChristian

ELEMENTS OF FICTION 2026-01-09

21 Items: flatfoilroundstaticclimaxdynamicsettingconflictcharacterstructurenarrationantagonistexpositionresolutiondenouementprotagonistperspectiverisingactionfallingactionstockcharactercharacterization

Types of Drinks 2026-01-13

25 Items: TeaColaSodaMilkICEEWaterCocoaCiderJuiceAtoleCoffeeCherryEggNogSpriteSlurpeeJamaicaGatoradeLemonadeSmoothieHorchataDr.PepperMilkshakeFruitPunchHotChocolateCoconutWater

Attitude of Gratitude 2026-01-14

20 Items: HUGGIFTGIVEKINDLOVEHELPGLADGOODLIFEDEARWARMCARETRUEBESTBLESSSHAREVALUEPRIZELUCKYTHANKS

People of Byheart 2026-01-15

27 Items: JCPawSamZoeYourJuneSoneVlodKyleLanaDinaMetsiDevenAlinaJesusYuriyConnieOliviaTomwayJeromeTonyiaMarthaJackieCarlosArmandoAlfredoBrandon

Book of Psalms 2026-01-28

20 Items: joygladKingLordsingwalkgloryMercyteachpraiserefugereignsrescueBlessedDelivernationsrighteoussalvationDisciplineThanksgiving

Students of S1 2026-01-31

31 Items: RzaJaxMiaAmirKyleLinaEllaLeviPyaeMatinLoganAriahBlakeJasonRosieHayatArminElhamArcherSophieAshtonAliyahKaydenImogenImogenShukuriMarlisaSamanthaAlexanderAnnabelleElizabeth

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-04

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Vampires of Rockdale 2026-02-05

25 Items: ppeveinedtaserumgauzeplasmaneedlelancetsharpsglovesmedianarterysyringealcoholcubitalbasilicspecimencephalichepearinPhlebotomyhematologyvacutainercentrifugevenipunctureanticoagulant

Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Call of Duty 2026-01-21

39 Items: GazSMGLMGSASSoapAlexRudyYuriPriceGhostRoachFarahHadirDiegoNolanBarkovGravesMilenaSniperPistolNikolaiLaswellValeriaTheWolfMakarovShadowsShepherdAlejandroGhorbraniTaskForceTheButcherKonniGroupTrojanHorseDesertEagleLosVaquerosImranZakhaevAssaultRifleShadowCompanyRocketLauncher

History of Law 2026-02-12

29 Items: oathshirediceyfeudalcombatordealhobbesaustinwergildunitaryfederalstatuterousseaucivillawadversaryprecedentvigilantecommonlawbindinglawmagnacartapositivismcapitalismdivinerightretributionrestitutionstaredecisishabeascorpusconstitutioncriticaltheory

A Changing American Culture 2025-05-19

9 Items: To carryRequired as by lawThe speech and habits of a particular regionA new kind of music with a lively rhythmic soundA residential area on or near the outskirts of a cityA group of writers who tried to show the harsh side of life as it wasA tall building with many floors supported by a lightweight steel frame...

Unit 11 2024-04-25

9 Items: this zone has enough light for photosynthesislow level of primary productivity in lakes/pondshigh level of primary productivity in lakes/pondsContains 20% of the world’s available surface waterthis zone does not have enough light for photosynthesisAmount of water used for all purposes per person over a given time...

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

Surprise Trip 2025-07-29

15 Items: A girl born on January 15, 2016.A girl born on October 24, 2018.The sea witch from The Little Mermaid.The title used for the daughter of a Queen.The name of Taylor Swift's 4th studio album.A character who is the younger sister of #10.A device that converts sound waves into an electrical signal....

The Word Search 2025-08-29

8 Items: oftheandcatmatsathatthat

List B 2025-09-02

8 Items: ofanywithwillthatbrathandhave

word search 2025-09-27

8 Items: ofyouallwillfindneverthesewords

week 4 2025-10-15

8 Items: ofismytohedayshewas

The Word Search 2025-11-10

8 Items: ofTheitsownkindchaosmakessense

Summer 2025-06-19

75 Items: maphatredlakepalmcornflagbluehumidoceanbeachwavessaladfruitmoteltowelwhitebreezehikingbikingdivingtubingburgerhotdogpicniccruisetravelshortsparadepicnicfourthbonfiresurfingsailingcampingfishings'morescupcakehighwaygogglessandalst-shirtlibertysunshineheatwaveseashellswimmingcanoeingkayakingpopsiclelemonadeicecreambarbecuesmoothiesuitcaseairplane...

Compliance and Ethics Week 2025 2025-11-03

15 Items: TeamEthicsActionActionHonestyPoliciesAuditingTrainingsIntegrityComplianceof ConductMonitoringTransparencyCommunicationAccountability

Federalist vs. Anti- Federalist 2026-01-07

14 Items: POWERUNIONSTATESDEBATERATIFYLIBERTYCONGRESSHamiltonof RightsPRESIDENTAMENDMENTSFEDERALISTSCONSTITUTIONANTI-FEDERALISTS

Mongolia Word Search 2022-09-29

12 Items: the action of giving birth to younga group of young animals born to one animal at a timean individual organism that has not yet reached its adult form, sexual maturity or sizea difficult to define period of development when a cub begins to spend time away from its mother...

A Dog of Flanders pgs. 12-16 2023-07-10

12 Items: What is the boy's name?What is the dog's name?Where was the village near?Patrasche was a _____ once.Patrasche was a dog of ______.The grandfather was now _______.What is Nello's grandfather's name?What did the grandfather do before?What was in the center of the village?What kind of sound did the clock make?Patrasche wasn't _____ to stop and drink....

CELLS 2025-01-07

12 Items: steady statelacks a nucleushas a true nucleusa cell that gets biggera cell that gets smallera cell remains at equilibriummovement of water across a membranea type of cell transport requiring energya type of cell transport requiring no energyviral replication causing the host cell to burstmovement of molecules from high to low concentration...

trs23 ver2 u12 2022-11-25

10 Items: 100use your teethopposite of thina big, scary fishopposite of lighta yummy thing to eatcan lift heavy thingswill make you feel scaredtry to run and catch somethingthe outside of an animal or person

EMD Word Search Part 1 2025-12-02

6 Items: Pain Found on Card 1Type of Pain Found on Card 5Type of Attack Found on Card 3Type of Action Found on Card 4Type of Problem Found on Card 6Type of Reaction Found on Card 2

happy 2024-01-09

56 Items: fiemomdadsunjunejulyfishpoolbebemimidogshomeaddiefionapoppylunchphoneoceanmusicfunnyoliviajessiesummerspringtennisaugustvanityenergyeaglesspeerstiktokgradesfamilyhersheyspanishkittensfriendsjenavivetanlineslaughingexcerisephilliessnapchatpresentsbirthdayannabelletravelingnewjerseyflipflopssunscreenthirtytwovolleyballlemonwatertaylorswiftbathingsuit...

word search maker blake vaughn 2024-05-14

28 Items: maydayjunejulyyeardatemarchapriltodaymonthafteraugustmondayfridaysundaybeforejanuaryfebuaryoctobertuesdaynovemberdecemberthursdaysaturdaytomorrowcalenderseptemberyesterday

Enero Word Search 2025-05-13

30 Items: maydayjunejulyyeardatemarchapriltodaymonthafteraugustmondayfridaysundaybeforejanuaryoctobertuesdayfebruarynovemberdecemberthursdaysaturdaytomorrowcalendarseptemberwednesdayyesterdayyesterday

Cosmic Word Hunt 2025-12-03

16 Items: Earth’s natural satelliteA pattern of stars in the skyA giant ball of hot glowing gasEverything that exists in spaceA large object that orbits a starWhen a planet spins around its axisA small rocky object orbiting the SunThe force that pulls objects togetherA person trained to travel into spaceThe path one object takes around another...

Alan Turing's life and legacy 2024-06-14

16 Items: self-murdercaptured by the policenote used to communicatea synonym for homosexualthe city where he studiedTuring's job during the warTuring fathered this sciencethe Allies' enemies during the warthe poison Turing used to kill himselfa synonym for deciphering a secret messagethe machine used by the Nazis to send secret messages...

ALL THINGS POETRY/ DRAMA 2025-03-24

16 Items: smiling sadly!beings who have to die.loosely hanging threads or cords.the overall structure of the poem.a suspect in the missing crucifix.the sister who reported the brother.the sequence of events within a story.time or place where the story takes place.he was bullied because he was small and quiet.an institution for mental persons in the drama....

Juicers 2025-08-21

16 Items: LIMEAPPLEMANGOLEMONORANGEThis juicer "chews" fruits and vegetables.The fibrous material that is separated from the juice.The part of a masticating juicer that chews the produce.This type of juicer requires an operator to push a lever.The part of a manual juicer that extracts juice by twisting....

Florida Word Search 2025-02-04

13 Items: PoolWarmTripBeachWavesPlaneMeyersFloridaTwelfthVacationSunshineFebruaryof Mexico

Dialysis Access Word Search 2026-01-08

12 Items: Pus or drainage is a sign ofCan be a sign of an infection?Made from your own artery and veinThis can be a sign of infiltration.You should _________ if your access hurts.You should do this upon entering the clinicWe recommend you _________ your access daily.Not wearing tight shirts ________ your fistula....

Spelling 1 2024-03-26

10 Items: a span of time lasting 7 daysthe coldest season of the yearthe solid, main part of the treeto use your eyes to observe somethinga short informal letter or written messageto make something using materials you havean eating utensil that has 3 or 4 tines or spikesvery good or pleasant; excellent ex she is a super person...

External Funding Entities 2025-06-11

10 Items: A type of charityThe largest funding entityA foundation type funded by company profitsAmerican Heart Association is considered one of theseConsisting of family, corporate, and professional typesOne type of federal agency that provides funding to U-MFunding sources on a smaller scale from the Federal Government...

A Wildfire Changed My Life/Maui Strong 2026-01-31

10 Items: In a worried or nervous way.A feeling of being thankful.Periods of little or no rain.Eating up quickly and greedily.Covered in thick, healthy plants.Without stopping or slowing; non stop.Hot, glowing peices of wood or other material from a fire.A large fire that spreads quickly and causes great destruction....

Grand Mosque of Paris 2024-11-05

8 Items: Followers of IslamThose who live in ParisIslamic places of worshipMorocco's Eastern neighborMadrid is this country's capitalFlat bottom boats for carrying cargoThe French government during World War 2This is what the leading official of the Grand Mosque of Paris is called

Captivate Word Search 2023-12-10

10 Items: To blend or combineTo captivate or charmTo bring forth or elicitA brief flash or beam of lightExtremely joyful and triumphantEmitting bright or glowing lightTo attract and hold the interest ofThe state of being calm, peaceful, and untroubledAble to recover quickly from difficult conditionsA pleasing arrangement or combination of elements

The Kingdom of the Franks 2025-12-04

10 Items: Wife of ClovisCathedral built in ParisA tribe in the Gaul areaLaw Law of the Frankish empireThe Land North of the MediterraneanRuled over the Franks for a long timeFormerly known as the Frankish empireThe Capital city of the Frankish empireBriefly united the Franks under one flagThe only Religion allowed in the Frankish Empire

Atomic Wordsearch 2025-08-12

11 Items: A noble gas with atomic mass 39.9First element of the periodic tableA vertical column on periodic tableA horizontal row on the periodic tableThe branch of science relative to atomssimplified atomic structure by Niels Bohratomic model proposed by JJ Thomson in 1904Found in our bones, number 20 of periodic table...

Maid Word Search 2023-03-08

13 Items: tuxlovekissbrideDresshusbandmarriageof honourchampagnehoneymoonglamsquadbridetribebridesmaids

Constitution Word Search 2026-01-28

13 Items: LawsCourtTreatyJusticeCongressPreambleExecutiveof RightsAmendmentsRepublicanFederalismLegislativeConstitution

PATRICKS DAY 2026-02-13

14 Items: KEGHATBEERCOINVESTWELLGREENMARCHSHOESIRELANDOF GOLDRAINBOWSHAMROCKHORSESHOE

wedding 2024-09-23

58 Items: ginjayjoybeerbluecakegoldhugsjulylovelunarosevowswinebridebubbachriscigargroomnyjahterryblainebuffetfamilykissesscotchwillisatlantadancingdowningdesireeflowersforeverfriendsgeorgiapromiseromanceweddingbrigittecocktaillovinglymaldivesmarriagenovemberproposalsoulmatechampagneguestbookhappinesshoneymoonmatrimonyminnesotanewlywedshighschoolringbearer...

ECONOMICS VOCABULARY 2025-05-01

17 Items: peopleusefulnessnatural resourcessum of all productsalternative choiceswork performed for someonemovement to educate buyersa tangible item like a bookbasic requirement for survivalrisk-takers in search of profitsSociety not having enough resourcestools,equipment,machinery,factoriesonly tasks people can do more efficiently...

Myasthenia Gravis 2024-06-06

10 Items: preferred symptomatic treatmentdropping eyelids seen in ocular myasthenia gravis______ weakness :primary symptom of myasthenia gravismonoclonal antibody that provides potent alternative therapyinhibition of this enzyme is target for first line treatmentsDisease in which body’s antibodies attack self-cells and -tissues...

Flight Word Search 2025-08-19

10 Items: Vocal sign of anxiety, frustration, or tension.Lack of interaction as a passive stress response.Physical sign of anxiety, frustration, or tension.Restlessness shown by constant movement or circling.Stress-related sweating without heavy physical work.Rapid or shallow breathing, flared nostrils, sighing....

English 8H Independent Reading Project : Maggie T 2025-12-06

10 Items: Who is Daisy's best friend?Who is the producer of The Six?Who is the male lead of The Six?Who is the female lead of The Six?Who does Graham fall in love with?Where does Simone go to pursue music?What was Billy and Daisy's first big hit?Where does Daisy go after her fight with Billy?What is the name of Billy and Camilla's daughter?...

Ancient Egypt 2025-12-12

10 Items: A family line of rulersThe belief in life after deathA system of picture-based writingA large stone structure built as a tombThe process of preserving a body after deathA decorated stone coffin for a preserved bodyA paper-like material made from reeds used for writingA ruler of ancient Egypt believed to have divine authority...

Apologized Word Search 2025-02-14

11 Items: LapWildBiteSmartCoveredEnjoyedcare ofDifficultRemembersApologizedComfortable

Emoji’s 2026-01-19

11 Items: SadMadHappySillyFunnyAngryExcitedNervousWithdrawnof controlAggression

Regular & irregular verbs 2013-02-07

10 Items: ofofpastpastdrawtenseteachdrawntaughtparticiple

BOOKS 2025-09-24

8 Items: AOFGIVELET'SROLLEROUNDJOSHUAAPPLAUSE

The Word Search 2025-11-10

8 Items: ofTheitsownkindchaosmakessense

The Word Search 2025-11-10

8 Items: ofTheitsownkindchaosmakessense

The Word Search 2026-01-09

11 Items: ofThethetheandthelionWitchNarniaWardrobeChronicles

Beach Boys Cars Song Word Search 2024-06-20

12 Items: downmy carmachinecar clubget arounddeuce coupecar of mineof ole Betsycherry coupethe drive inncoast highwaythe parkin lot

The World on the Turtle's Back 2025-08-27

9 Items: Truffles are considered a ________ .The new deck of cards wasn't very ________.The woman __________ searched for her missing dog.___________ the literary devices used in this poem.___________ the author's meaning in this paragraph.The knights swore to __________ the enemies of the king.Authors often employ ____________, to hint at future events....

ADOBE 2024-02-15

26 Items: slugpicamaskbleedframesgutterlayerspentoolpentoolopacityfeathertextwrapbrushtoollinkpanelpreflightrasterizeblendmodesmasterpagessmartobjectclippingpathgradienttoolgridsandguidesadjustmentlayersdodgeandburntoolPre-set effects that can be applied to images for artistic or correction purposes....

ADOBE 2024-02-15

26 Items: slugpicamaskbleedframesgutterlayerspentoolpentoolopacityfeathertextwrapbrushtoollinkpanelpreflightrasterizeblendmodesmasterpagessmartobjectclippingpathgradienttoolgridsandguidesadjustmentlayersdodgeandburntoolPre-set effects that can be applied to images for artistic or correction purposes....

ADOBE 2024-02-15

26 Items: slugpicamaskbleedframesgutterlayerspentoolpentoolopacityfeathertextwrapbrushtoollinkpanelpreflightrasterizeblendmodesmasterpagessmartobjectclippingpathgradienttoolgridsandguidesadjustmentlayersdodgeandburntoolPre-set effects that can be applied to images for artistic or correction purposes....

ADOBE 2024-02-15

26 Items: slugpicamaskbleedframesgutterlayerspentoolpentoolopacityfeathertextwrapbrushtoollinkpanelpreflightrasterizeblendmodesmasterpagessmartobjectclippingpathgradienttoolgridsandguidesadjustmentlayersdodgeandburntoolPre-set effects that can be applied to images for artistic or correction purposes....