fourth of july Word Searches

Chapter 15 Vocab Word Search 2024-03-21

11 Items: A solution of known concentrationA compound whose color is sensitive to pH.The point at which an indicator changes color.The pH range over which an indicator changes color.The negative of the common logarithm of the hydronium ion concentration.The negative of the common logarithm of the hydroxide ion concentration....

Antibody Word Search 2026-02-28

12 Items: f 2 types of light chains present in ~2/3 of immunoglobulinsf 2 types of light chains present in ~1/3 of immunoglobulinsOne of the polypeptide units that makes up and immunoglobulin moleculeGlycoprotein that links immunoglobulin monomers together – only found in IgM and IgA...

Molecule Word Search 2023-01-10

13 Items: general makeuphow something is arrangedthe sum of all living matter on Earthis made up of many different kinds of atoms and moleculessubstances that cannot be separated into simpler substancessubstances formed when two or more elements are chemically joinedthe layer of gas surrounding a planet that is held in place by gravity...

Unit 2 Vocab Review 2024-10-29

13 Items: The study of God and religious beliefs.A Greek word meaning "assembly" or "church."A system of beliefs and practices about the divine.A personal connection to the divine or higher purpose.Someone who follows Jesus and adheres to his teachings.A Hebrew word for the assembly or congregation of Israel....

Competitors Companion Word Search - July week 1 2013-07-13

20 Items: OhioUtahIowaTexasMaineIdahoOregonHawaiiAlaskaNevadaFloridaOklahomaMarylandIllinoisColoradoCaliforniaWashingtonMississippiPennsylvaniaMassachusetts

Competitors Companion Word Search - July week 2 2013-07-13

20 Items: AyrPerthAlloaElginDundeeIrvineGlasgowFalkirkRenfrewAberdeenArbroathDumfriesStirlingPenicuikEdinburghPeterheadInvernessKilmarnockMotherwellCumbernauld

G1.5 (50-Word Reading 2) July Review 2025-07-22

24 Items: uponhugforaddoutputwalkfeedgivekisschickloosebrushdreamfairykittenpuppetbuttonstringcare ofducklingbutterflycaterpillar

Friendship With Mate - Sunday July 5th, 2026 2026-07-01

28 Items: KeepMateHappyLoyalHumbleHabitsMutualDoubtsOptionsMarriageLifelongSuitableUnevenlyFeelingsOvercomeDecisionsCarefullyCourtshipFriendshipPrinciplesRespectfulReasonableOriginatorChallengesProspectiveRelationshipStrengtheningCharacteristics

Spanish vocab 2026-01-16

28 Items: artmathtalklunchclassclassteachstudyfirstthirdfifthsixthninthtenthsecondfourtheighthspanishscienceenglishseventhscheduleinanhourhomeworkcomputerscalculatorsocialstudiesphysicaleducation

Module1: Introduction to pathology/Skeletal system 2023-12-20

18 Items: The primary site of ossificationThe most common form of arthritisA generalized decrease in cell sizeA generalized increase in cell sizeHaving more than one illness at the same timeAn abnormal change occurring in mature cells.The forward slippage of one vertebra on anotherA specific cancellous bone located in the skull...

X Word Search 2025-03-06

13 Items: XrayXenonXeroxXfactorXrayfish(a name)Xylophone(a type of ship)(part of a plant)(hugs and kisses)(a type of fruit)(a garden walkway)(short for xylophone)

Fantasy Cartoons 2025-07-27

15 Items: TimeShrekPrinceTangledthe PoohOwl HouseDuckTalesof ArcadiaSchool BusLion GuardLittle PonyTales of ArcadiaFairly OddParentsto Train Your DragonThe Labyrinth of Magic

The Basal Ganglia & The Cerebellum 2025-11-22

20 Items: Unclear, slurred, poorly articulated speechLack of coordination during voluntary movement of the limbsA lack of motor coordination that impacts one's ability to walkInability to rapidly alternate movements due to cerebellar damageAn involuntary movement causing the eyes to rapidly move back and forth...

Geometry Vocabualry 2026-04-20

25 Items: In the same line.Collinear Not in the same line.Having the same size and shape.A statement that has been proven.To divide into two congruent parts.Segment A line with two distinct endpointsLines Lines that intersect a 90 degree angleThe common endpoint of the sides of the angle.A statement that is accepted as true without proof....

Lunes Word Search 2025-01-29

19 Items: MayJuneJulymarchAprilmondayfridaysundayAugusttuesdayJanuaryOctoberthursdaysaturdayFebruaryNovemberDecemberwednesdaySeptember

MITOSIS WORD SEARCH 2025-04-29

17 Items: the stage before mitosisthese pull chromatids apartnew nuclei form around chromosomeschromosomes line up at the equatorcytoplasm divides into two new cellsorganelle which has cell chromosomescell containing one set of chromosomeschromosomes are pulled to opposite polesa cell containing two sets of chromosomes...

Rachel & Christian's Wedding Search 2026-07-29

15 Items: where you metyour furry childgrooms birthplacegrooms middle namebrides new last nameyou guys are now ___we gathered on July __who said I love you 1stwhere you currently livewhere your first date wasyou both have one of thesemonth you met & got engagedWhere Rachel went to collegefirst real vacation togetherwhere Christian went to college

Nail Diseases and Disorders 2024-11-14

20 Items: nailspoon nailswhite spotsbitten nailstrumpet nailfolded nailsingrown nailsfungal infectionram's horn or clawtiny pits roughnessdeformity or diseasethickening of the naildarkening or black bandlifting of the nail plateskin becomes split or tornsplit brittle nails with ridgesthin white nail plate very flexible...

africa 2025-11-18

24 Items: rulerboatsgo betweenssole controltrading citylargest citymeans "people"sickled princeoral historiansmetallic elementsemidesert regionabundant resourcefertile grasslandsprecious commoditylongest known journeypeople conquered malilocation of the capitalbantu speaking migrantsenslaved Turkish soldierscenter of trade and learning...

Lech Lecha 5.0 2024-11-03

18 Items: מִצְרַיִם“messenger”King of ElamKing of Salem“KHohSHehK” חֹשֶׁךHer name means “flight”“father of a multitude”Hunger, scarcity of grain“noblewoman” or “princess”Son of Haran, Avram’s nephew.His name means “G-d will hear”His name means, “exalted father”Avram’s age when Ishmael was bornAvram ask her to masquerade as his sister....

Pencil slop 2026-05-28

8 Items: A form of artThe size of objectsThe parts of a human bodyAn art form using a cameracolors A form of color theoryA form of shading composed of dotsA form of shading composed of linesThe point(s) at which an object is perceived

Cell Energy Word Search 2025-02-21

18 Items: Requires oxygenDoes not require oxygenForm of energy for a cellLocation of the Calvin CycleFermentation common in plant cellsFermentation common in animal cellsOxygen is a by-product of this processLocation of the light-dependent reactionVital for animal life, produced by plantsOccurs in the cytoplasm to start respiration...

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

Skin care 2024-10-30

30 Items: boilWartpimplespink eyeswellingbirth markbeauty markchicken poxlack of pigmentpersistent itchingmedical practitionerpore clogging ingredientsover production of pigmentdarkened shade of the skinfoul-smelling perspirationabnormal growth of the skina permanent mark on the bodyredness caused by inflammationa small sac or blister filled with liquid...

Qualitative Word Search 2026-01-07

20 Items: Mass per unit volumeAmount of matter in an objectType of data that involves sensesA proposed explanation for an observationThe sub-atomic particle that has +1 chargeThe substance in which the solute dissolvesUsed to separate coloured substances in inkType of data that involves measurements being taken...

HVAC 2026-04-23

21 Items: Thermal Expansion ValveA gauge used to read vacuumA style of in-line metering deviceOverfill of refrigerant in a systemThe transfer of heat through a solidDevice used to measure vacuum preciselyMoisture that collets on cooler surfacesGauge that reads both pressure and vacuumHeat that can be measured with a thermometer...

commerce find a word 2024-10-17

16 Items: items of valuebest teacher in the worldvery safe and secure sharesa tax on the profit of a companya part ownership of a public companyvalue of an asset increases over timeacceptable to society’s current standardsall the investments owned by an individualplace where shares in public companies are bought and sold...

Our Lady Peace - Word Search July 2023 2023-07-07

31 Items: boyrunhopelifeanniecurveholesjuliasorrythiefclumsydeniedmettlenaveedrefugewaitedapologybirdmanblistergravitypicturerabbitsshakingcarnivalinnocentstarseedallowancedreamlandsimulationsomethingnesssupersatellite

Monday Morning Mixclub #73 - 27 July 2026 2026-07-28

24 Items: FuzzboxStimpiesPaulSimonRonnieLaneTheStrokesDinosaurJrBeachHouseAsherWhiteDarkCornersTheHitchersSuzanneVegaDarrenHaymanTheBeachBoysQuietHollersElvisCostelloTheAvalanchesTeenageFanclubKankawaNagarraRhiannonGiddensTheShortwaveSetSilkroadEnsembleManWomanChainsawBrianJonestownMassacreEddyCurrentSuppressionRing

Year 5 light 2025-04-10

30 Items: SunRayBeamDawnTorchLaserMirrorObjectObservePhotonsDiffuseTwinkleRainbowEinsteinLightbulbBlackholeRadiationIntensityLess lightScatteringLuminescentThe best subjectDark area or shapeTo take in or swallow upNot letting light throughChange of direction of lightPermitting the passage of lightThrowing back by a body of light...

Clothes 2026-05-18

24 Items: a hata baga tiea coata ringa shirta skirta dressa jumpera jacketa T-shirta necklacesome bootssome shoessome sockssome glassessome trainerssome earringsa pair of jeanssome high heelsà main a handbaga pair of shortsa pair of trousersa piece of jewellery

The Cell Cycle 2026-04-16

27 Items: The male reproductive cellThe female reproductive cellExactly the same in genetic makeupA cell that has two sets of chromosomesThe membrane that surrounds the nucleusReproductive cells such as sperm and eggBody cells that are not reproductive cellsA cell that has only one set of chromosomesThe final stage where two nuclei begin to form...

Lesson 1,2,3,4,5,6 2024-07-19

54 Items: dayartecoclubtripshowcoldnoserestgamefeeddogstripthisgradefirstthirdfifthhanokearthfieldonionpantssocksfeverrunnywaterplantdancemusicmoviethesesecondfourthminhwasportstalentpotatodoctorsoccerssireumyunnoriconcertflowersmariachiflamencobirthdayheadachemedicinepineappletaekwondowatermelontraditionalstomachache

FAAS Adoptable Dogs - July 4 holiday edition! 2023-07-02

21 Items: kaitiaangelmyutenellyohanasashasimbaagathavivianhasbroruthieeugenemaryannkazshemlucilleheimdallsamanthapolpettaboulettescoobydoo

Spelling Bee Word Search (July 11, 2023) 2023-07-11

40 Items: guitargardenbananaamountwebsitemachinegiraffeeveningbalanceamazingmeasurefactorydocumenthomeworklavendersurprisediscovervacationlaughteraquariumaudiencehappenedkeyboardwildfirechampionclarinetlibrariesworksheetrecommendadjectivenutrientsvegetablehibernatedictionaryimpossibleappreciatebackgroundcamouflagemathematicsencyclopedia

Dustin & Chloe – July 2025 Wedding Word Search 2025-06-19

20 Items: LOVEVOWSRINGKISSCAKECHLOEBRIDEGROOMDRESSUNITYDUSTINHAKONELONDONTORONTOFLOWERSFOREVERROMANCETOGETHERCEREMONYHONEYMOON

Analytical Fun Event- July Word Search Activity 2025-07-30

21 Items: beachsharkshikingcampingsunburncapecodboatingheatwavesunshinecookoutsswimmingicecreambaseballrelaxingrainstormfireworksvacationspopsicleshamburgerssummerbreakindependence

algebra ll word search 2024-09-19

15 Items: GCFtermsrootszerosnumbersbinomialsolutionfunctionfactoringminomialsexpressionpolymonialsof polynomialspoint end behaviorform of polynomials

Ambassador Word Search 2025-04-21

17 Items: LeakOrderPolicyPardonActionTreatyCabinetImpeachCollegeof StaffPrivilegeSecretaryAmbassadorBureaucracyWhistleblowerSecurity Councilof Management and Budget

Advance Functions 2024-07-22

13 Items: To change the base, we used the:Statements that compare two expressionThe smallest repeating unit of the functionWhich is attached to the highest degree of “x”line that a curve approaches, as it heads toward infinityA set or group of functions that share common characteristicsA relation in which each x-value in the domain has a unique y-value...

Sugars 2025-09-02

16 Items: linkages found in glycogenthe unbranched type of starchcommon to all N-linked glycosidespolymeric form of glucose in plantsthe major structural polysaccharide in plantsisomers that are not mirror images of each otheramino acid responsible for N-glycoside formationclassification of any sugar that can be oxidized...

Floral Design Vocab Review 2024-11-04

62 Items: Red, Blue and YellowTotal area a person can seeThe outline of an arrangementLight reflected off an objectJapanese style of floral designVisual or tactile feel of an itemAppealing odor emitted by flowersCenter of interest that draws the eyeThree colors side by side on the wheelType of shears used to cut woody stems...

1 Samuel 17 2026-07-09

8 Items: Promised LandHome of GoliathEnemies of IsraelFirst King of IsraelYoungest son of JesseChampion of the PhilistinesSimple weapon made of leather and cordOrdinary objects that became powerful weapons

PLF Word Search - July 2024-07-01

8 Items: shredrosessummerrecyclefireworksbullwinklesdefensepaneloaaprenovations

Inkspiration 2022-06-23

25 Items: catdogSIGNbookgamedreamhobbymottomoviecareercoupleANIMALfriendcopycathometowninterestmarriagememoriesmilitaryrelativechildhoodsuccessesOF A CHILDmilestonesOF A LOVED ONE

Women of UPS (March, 2023) 2023-02-24

13 Items: EVP & Chief Corporate Affairs and Sustainability OfficerFirst woman package car driver, beginning in 1943, Los AngelesBoard of Director - President and CEO of Lumen Technologies, Inc.UPS’s first woman pilot, joining the newly founded airline in 1988Board of Director - Group President, Pfizer Biopharmaceuticals Group...

Inherent Powers - Word Search Activity 2024-01-28

11 Items: The Supreme Law of the Landthe Contract that Ended World War OneMs. Mangum’s Favorite Color (x2 points)Purchase made by President Thomas JeffersonA Form of Government that the United States HasDocument Written by Abraham Lincoln to Free the SlavesConsists of the House of Representatives and the Senate...

Retrieval 2025-01-06

11 Items: The brittle bone disease OThe body's primary source of energy CThe bodies secondary source of energy FHow many components of health there are TThe type of health that relates to friends SThe type of health that is effected by obesity PWhen a person has a large body fat percentage OThe name of the hormone released during exercise S...

Words, words, words. 2025-11-17

17 Items: The King's wifeprince of NorwayPoured in the earsbrother to Opheliawhat the Ghost desiresa brother and murdereranother word for ecstasystabbed behind a tapestrydaughter of the King's advisorthe main setting of the tragedythe capital crime of this tragedyspeaks the first line of the playthe only person the Ghost spoke to...

Middle East Geography Challenge Word Search 2024-12-09

15 Items: The capital city of IraqThe largest river in EgyptThe largest country in ArabiaA large mountain range in western ArabiaThe sea that separates Egypt from Arabia80% of Arabia is part of this environmentA country that borders Saudi Arabia and OmanThis country is east of Iraq and north of OmanThe country where you can find the Great Pyramids...

WHI.1 Vocabulary Practice 2025-05-25

15 Items: more than necessary ___________________skilled craftspeople __________________way of life of a society ____________________also known as the New Stone Age ____________________also known as the Old Stone Age _________________________way of life characterized by little movement _________________...

☆Echo Word Search!☆ 2024-04-22

30 Items: The scientific study of insects.The scientific study of language.The art of thinking. Translated from Greek into "the love for wisdom".French composer and pianist, known for his Gymnopédies and Gnossiennes.Fictional band, created by Blur frontman Damon Albarn and artist Jamie Hewlett....

Circulatory System 2026-04-13

17 Items: clot the bloodartery on the neckAKA the lung circuitAKA the body circuittop chamber of the heartliquid component of bloodlargest artery of the bodybottom chamber of the heartartery on the upper arm / elbow________ blood cells carry oxygencarry wastes back TOWARD the heartartery on the side of the forehead________ blood cells fight infection...

Musicals 2025-01-16

15 Items: QManLineCatsRentGirlsAnnieWickedGreaseCabaretChicagoof MormonHairspraySide Storyof the Opera

World Religions Word Search 2023-02-06

15 Items: God in IslamA Jewish FaithJewish LanguageJewish Holy BookA God or GoddessMuslim Holy BookMuslim set of rulesThe Worlds Oldest ReligionFounder of the Jewish FaithA leader of the Jewish faithA religion with only ONE GodA religion with multiple GodsA religion followed by MuslimsFounder of the Christian FaithThe set of rules for Christians

Medical Terminology Scavenger Hunt/Word Search 2025-01-09

15 Items: meaning fastsuffix for thirstdefinition of cytesuffix meaning recorddefinition of nephr/osuffix meaning openingdefinition of the term glyccombining form meaning brain-ic, -ior, and -eal all meanhemi is an example of a _____combining form meaning cancercombining form meaning voiceboxprefix meaning few, very little...

Words for Parenting 2026-04-20

15 Items: the ages 1-3no boundariesfeeling of joystages of growthstrict parentingwhat you all areunacceptable conductdeep feeling of carecaring for your childa feeling of fear or uneasesevere acting out of a childmaking connection with your childtriggers fight or flight responseallows infants to strengthen musclesuses boundaries and limits in parenting

Reception 2023-10-22

23 Items: First dateAustin's jobKaitlyn's jobWho is older?years togetherour cat's nameTown of first homeAustin's first namecouple's dog's nameAustin's birth monthname of the best manKaitlyn's middle nameKaitlyn's birth monthKaitlyn's maiden namewhere did he propose?Austin's favorite sportour nontraditional petsnumber of months engagednumber of total siblings...

Afghanistan Word Search 2026-04-26

40 Items: WarSDSHUACIraqPlanNSC68UnionReaganSuburbsIdeologyof 1980.InternetSun BeltDoctrineMilitaryMovementsMovementsRed ScareAfghanistanContainmentand VietnamCoexistenceInnovationsand LiberalsConservativesMissile CrisesLuther King JrIndian Movementof the Cold WarEast – Cold WarFarewell AddressAmerican MovementsRights Act of 1964Christian Churches...

Nail Diseases and Disorders 2026-05-14

20 Items: nailspoon nailswhite spotsbitten nailstrumpet nailfolded nailsingrown nailsfungal infectionram's horn or clawtiny pits roughnessdeformity or diseasethickening of the naildarkening or black bandlifting of the nail plateskin becomes split or tornsplit brittle nails with ridgesthin white nail plate very flexible...

Mixed Religious words 2025-11-07

12 Items: Ceiling of Paradise7 of them are above usThe life after this lifeMiracle from Jerusalem to aboveEvery creation was made from itBest act of worship after beliefRising of the dead from the gravesEach believer should fear entering itA man of significant religious knowledgeYou need this to get reward for your deeds...

Cold War Word Search 2026-03-31

12 Items: Creator of CommunismThe last Tsar of Russia2nd Leader of the Soviet Union1st leader of the Soviet UnionPresident of the U.S. after FDRA "war" without actual fightingThe heir to Lenin that Stalin exilesPresident who fixes the Great DepressionWhen the free market controls the economyWhen the "People" own the means of production...

Unit 10 2024-05-14

15 Items: The smallest unit of lifeSomething that has never been aliveVariations that help a species surviveSomething that is alive or used to be aliveWhen two organisms both need the same resourceAll populations of different species in an areaPhysical differences between members of a speciesMosquitos and humans have this kind of relationship...

WHI.1 Vocabulary Practice 2025-05-24

15 Items: more than necessary ________________________way of life of a society _____________________skilled craftspeople __________________________also known as the New Stone Age ______________________________also known as the Old Stone Age ______________________________way of life characterized by little movement _______________________________...

PhT 100 Word Search 1 (Spring 2024) 2024-05-09

17 Items: To grind to a smooth substance with moisture.The basic unit of weight in the apothecary system.The dating of any medication that has a short shelf life.The liquid in which another substance is being dissolved.The determination of the covererage an insured is entitled.Complete destruction of organisms after they leave the body....

with VON 2025-02-05

15 Items: SurnameDating appFarming gameFirst date cafeDiscord channelName of boy catAnniversary dateName of girl catAnniversary monthFrequented KL plazaCondo we moved intoName of largest plantDream country to travelMultiplayer cooking gameCountry of overseas trip (not sg)

French Revolution 2025-12-08

20 Items: XVIRégimed'etatClergyEstatesAssemblyBastilleMonarchyJacobinsof TerrorGirondinsCourt OathAntoinetteGuillotineConventionBourgeoisieRobespierreNationalismSans-culottesof Public Safety

Energy Science 2026-03-31

15 Items: What kind of energy is in the wind?– What nuclear process powers the sun?What is defined as Force times Distance?What is the practice of using less energy?What is the unit of electrical resistance?What kind of energy is stored in a battery?What gas is released when biomass is burned?What increases whenever energy is transformed?...

science review wordsearch 2023-06-01

22 Items: Unit for workThe transfer of heat in the form of wavesHighly reactive nonmetal elements in group 17Solution that has more solute than the solventHow tightly packed the atoms are in a substanceDescribes both the speed and direction of an objectReactions that release thermal energy when they react...

Pinchas 2024-07-20

18 Items: Moses successorThe seventh day.Phinehas’ father.Daughter of Asher.Jeremiah’s hometown.Zimri was from this tribeSimon was know as a _______.Phinehas’ reward for his zeal.The 14th day of the first month.his Hebrew name means “3 Israelites”The new moon or the first of the month.Cozbi was the daughter of this Midianite prince....

Lech Lecha 5.0 2024-11-09

18 Items: מִצְרַיִם“messenger”King of ElamKing of Salem“KHohSHehK” חֹשֶׁךHer name means “flight”“father of a multitude”Hunger, scarcity of grain“noblewoman” or “princess”Son of Haran, Avram’s nephew.His name means “G-d will hear”His name means, “exalted father”Avram’s age when Ishmael was bornAvram ask her to masquerade as his sister....

8th grade Mother to Son (poem) 2026-01-22

9 Items: brokenspeaker of the poemlast name of the poetfirst name of the poetin the place of somethingsmall, thin, sharp piece of woodwide, flat place between sections of stairsqualities like glass that is clear & elegantset of steps used to get from 1 floor to another

Topic 3 2024-01-19

26 Items: means Incomerider with Paul RevereTax on legal documentsriders with Paul Revereclosed the port of BostonProtest against the Tea actharsh and unfair governmentNickname for British Soldiersthe leader of the Sons of Libertyauthor of the Common Sense pamphletWarned the approach of British TroopsGroup that protested British policies...

Identity Word Search 2026-04-29

20 Items: The feeling of being forced out of your home.The province where Jesse's family roots begin.The process of becoming healthy or whole again.A physical or mental dependency on a substance.Continuing to exist in spite of great hardship.The ability to bounce back when things get tough.Something passed down through several generations....

Unit 6 vocab 2025-11-07

15 Items: tenthrightsrecall6 vocablibertiesnineteenthinitiativereferendumseventeenthtwentythirdtwentysixthof servicestwentyfourthof the state Governmentof the local government

Oak Island Depositor Theories 2024-12-01

25 Items: GrailTheoryTEMPLARVIKINGSCatharsBaronetof MaltaAntoinetteLOST PAPERSSHip TheoryMash THeoryGold TheoryKIDD treasureFrancis DrakeCipher TheoryDEMATERIALIZERHerring THeoryChamber THeoryHalpern TheoryOF THE COVENANTMAP/ FREemasonsTunnels/Box drainsKabbala/Gematria/Tree OF LifeColumbus-Ark of the Covenant THeoryof 7 people must die to find the treasure

TH10 U1 2025-06-23

24 Items: areapathaheada goalbehindthe viewthe pondthe trailup a tentand quieton a rootmade poolof breathof energythe treesin a cabina campfirethe silencein the shadeof the hikera water bottlenatural bridgeinstant noodlestop of the world

Halo (For baby Girl) 2026-04-12

23 Items: 343TankLAzorHumansZombiesJohn-117ATV of WarWormy BoysBig Monkeysrobotic dogsRank of shameRobotic deathRings aplentySnipers F*****robotic seeresmidevil robotsFlying, annoyingRace of The ElitesLittle floaty guysRace of the GruntsThey dont like humansSomehow Always has a fuel rodOver enginered crystal thrower

Citizen Word Search 2024-12-04

13 Items: Classicalrepu…a member of a political communitya religion supported by the state through tax moneythe care, guardianship, and control exercised by a deitythe principles of virtue as expressed in Judeo-Christian teachingsthe status of a citizen with its attendant duties, rights, and privileges...

Cellcycle Word Search 2026-01-07

12 Items: A part of the cell cycle when replicated chromosomes are separated into two new nuclei.The part of the cell division process during which the cytoplasm of a single eukaryotic cell divides into two daughter cells....

America Before the US 2026-07-19

25 Items: alliances of Native American tribesa plant that is grown to be sold for profitthe group of people in government who make lawsSpain's reputation as bloodthirsty conquistadorsNew York, New Jersey, Pennsylvania, and Delawarethe Algonquin, Mohawk, Ottawa, and Shawnee tribesthe Iroquois Confederacy, Cherokee, and Catawba tribes...

Glossary 2024-11-11

14 Items: Is a raftelevationsflat ground.enclosed bodyNatural area,low-lying areasjob in the camplanguage of landbetween mountainspoisonous effectspractice of plantingLower than the adsaining land.quantity of water flowing throughThe difference of heught from place to place

The Long Way Home Word Search 2025-09-12

16 Items: EarDewBeadMossGnomeStaffCreekBadgerLilvaraAureliaBerriesMushroomsFireplaceNanna Firlof Croaking Stonesof the Listening Leaves

Long County LIT-erary Terms 2025-12-08

15 Items: device techniques emphasizing sound.repetition of initial consonant sounds.(originally) a poem intended to be sung.a stanza or poem of four lines, usually with alternate rhymes.the leading character, hero, or heroine of a drama or other literary work.the study of historical linguistic change, especially as manifested in individual words....

The armor of god 2024-11-07

6 Items: of Truthof Faithof Salvationof the Spiritof Righteousnessof the Gospel of Peace

MYTHS AND LEGENDS 2024-09-19

15 Items: Giant wolf from Norse mythology.Greek goddess of wisdom and war.Greek monster with snakes for hair.Giant sea monster from Norse legend.Norse trickster god, brother of Thor.Egyptian falcon-headed god of the sky.Legendary bird that rises from its ashes.Greek god of thunder and king of the gods.Half-man, half-bull, trapped in a labyrinth....

Meanings from glossary 2024-11-11

14 Items: Natural elevationsan area of countrysideIs a huge body of salt water.Is the difference of height from place to place.Is an area of the earth's crust that is below sea levelsis the activity or business of growing crops and raising livestock.is the science or practice of planting, managing, and caring for forests....

Alzheimer's Disease 2025-04-08

14 Items: lose track of thesemost common cause of dementiamay stop in the middle of thismay put things in ______placesmay experience a change in thisdifficulty completing these tasksdifficulty with this may cause fallsthis loss is one of the earliest symptomspart of body affected by alzheimer diseasemay become irritable when this is disrupted...

Light Waves 2026-03-12

15 Items: to take into give ofto pass througha range of wavelengthsthe maximum height of a waveto bounce off without absorbingsource: an object that emits lighthow often or fast something happensanything that has mass and takes up spacethe distance from one peak of a wave to the nextthe number of peaks of a wave that pass in a second...

Clinicaldepression Word Search 2022-10-21

15 Items: UnhappyPsychoanalystA mental disorderRelated to emotionsA form of treatmentA bad way of thinkingAuthor of Harry PotterIn need of sleep and restFreud's theory on depressionA medicinal form of treatmentThe inability to relax or sleepA person who prescribes medicationAnother word for Clinical DepressionActor who's open about his depression...

Age of Revolutions word search 2023-10-12

10 Items: fearestateestateestategeneralof terrorof rightsguillotineof bastilleconstitution

cxcb 2023-12-26

8 Items: Mangandhiof Fireamadeusplatoonof AfricaLast Emperorof Endearment

Middle East Geography Challenge Word Search 2024-12-07

15 Items: The capital city of IraqThe largest river in EgyptThe largest country in ArabiaA large mountain range in western ArabiaThe sea that separates Egypt from Arabia80% of Arabia is part of this environmentA country that borders Saudi Arabia and OmanThis country is east of Iraq and north of OmanThe country where you can find the Great Pyramids...

Word search 2023-09-28

40 Items: warmauntwifejulyfoursunnyhumidrainyfoggywindyunclenieceaprileightthreenephewfathermondayautumnspringaugusttwelveeleventwentyfamilybrotherhusbandtuesdayjanuaryoctoberfifteenfreezingthursdaysaturdayfebruarydecemberthirteenfourteenwednesdayseptember

Sarah and Tyson 2024-05-03

43 Items: lovejunevowssuitloveringjulysarahtysonpiperbridegroomdressdanceyoubouremmenfamilykitimatweddingbouquetstevensflowerstequilakitimatromancefriendsforevermarriagetogethermarriagesteenbucknashvillegreatdanehoneymoonhappinessengagementcumberlandcelebrationkendalavenueclingmansdomelaketownranchcampbellriverhighschoolsweethearts

Rosalind's Word Search 2025-01-16

38 Items: NoTeaDogBeefJulyBlackBibleHawaiiGreensWinterDooneyMorningChickenReadingSaturdayFootballBenihanaRed.DoorCallalilyChristmasChocolateMargaritaTelevisionMade-A-WayWatermelonPerry.MasonBig.TroubleThe.JetsonsLife-SaversSweet.PotatoMary.J.BligeDecaf.CoffeeCicely.TysonEddie.MurphyBlack.PantherSugar.CookiesKirk.FranklinDenzel.Washington

Nervous System 2025-05-15

40 Items: ViaDietJulyBrainOrganItalyFocalPaviaNervesSportsSeizureMachineBalanceJanuaryEpilepsyMessagesMedicineDiscoveryNerveCellsBodySystemSpinalCordEnviromentElectricalTreatmentsNobelPrizeHomeostasisInformationPathologistInvoluntaryGeneralizedCamilloGolgiNerveNetworkBrainSurgeryCoordinationNeuroscienceWorktogetherNervousSystemCommunicationSilverNitrate...

Zero Word Search 2025-09-22

40 Items: sixmaypensayzerofivejulypinkblueopenworkthreesevenfortyfiftyblackwhitebrownrulerwriteclosecheckthirtyaugustsummerwinterspringautumnyellowmarkerpencileraserlistenfifteenhundreddecemberseptembersharpenercalculatorhighlighter

Key Words Review 2025-12-09

40 Items: dayMaydadmomhotweekyearJuneJulycoldhellomonthMarchAprilsunnywindySundayMondayFridayAugustfamilysistercloudygoodbyeTuesdayJanuaryOctoberbrotherweatherrainingsnowingThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptembergrandfathergrandmother

GAME FOR FUN 2026-03-06

40 Items: SNPFoxDogCatMayLionBearWolfJuneJulyTigerZebraPandaEagleHorseMarchAprilParrotRabbitAugustMondayFridaySundayGiraffeDolphinRaccoonJanuaryOctoberTuesdayElephantKangarooSquirrelFebruaryNovemberDecemberThursdaySaturdayAlligatorSeptemberWednesday