fourth of july Word Searches

Greek Mythology & Literature (Module 8, Lesson 4) 2025-11-17

29 Items: — Who was the Greek god of war?— Which Greek god ruled the seas?— Who was the king of the Greek gods?— Who was the Greek god of the underworld?— Which goddess represented love and beauty?— What was the mythical home of the Greek gods?— Which god served as the messenger of the gods?— Who was the queen of the gods and wife of Zeus?...

Adlerian Therapy 2024-09-17

17 Items: DreamsLifestyleRecollectionsConfrontationSpitting in the client's ______First name of founder of Adlerian TherapyKey concept of feeling connected to othersAdler emphasized this type of therapy approachThe therapeutic movement that Alfred Adler is associated withThis term refers to feelings of inferiority in Adlerian thought...

BTGHS Section 2: CH 4-7 Vocab 2024-04-30

15 Items: covered in tarloyal, reliableabout to happenextremely unpleasantrepetition and routinefemale spirit who criesunpleasantly cold or wetpale orange tropical fruitlose or lack vitality, weakof a distant foreign countryspun thread used for knittingleave, unable to move through lack of winddistance of a place north or south of equator...

Chep & Raquel 2025-01-24

17 Items: Groom's first nameBride's middle nameHoneymoon destinationLocation of engagementBride's birthday monthBride's favorite drinkGroom's birthday monthGroom's favorite flavorCouple's favorite pastimeBreed of Groom's first dogBreed of Bride's first dogCouple's anniversary monthCouple met during this eventCouple's favorite pizza store...

skeletal wordsearch 2025-12-09

13 Items: Patella is a ___ boneTarsals are a ___ boneWhat joint type is the elbowWhat bone is the sternum classed asThe femur is classified as a ___ boneType of bone the vertebrae is classed asWhat joint is tough cartilage at bone ends___ joint is surrounded by a joint capsule___ skeleton forms the central axis of the body...

Gender 2024-11-12

7 Items: The male version of a wifeThe male version of a waitressThe female version of a princeThe male version of an heiressThe female version of a bachelorThe female version of a conductorThe female version of a gentleman

Basic Level Shaatibiyyah Intro and Bios Scholars and Students Wordsearch 2025-03-01

7 Items: Scholar of Shu'bah and HafsScholar of Qaaloon and WarshScholar of Al Bazzi and QunbulScholar of Khalaf and KhallaadScholar of Al Doori and Al SoosiScholar of Hisham and Ibn DhakwaanScholar of Abul Haarith and Al Doori

Chep & Raquel 2025-01-24

21 Items: FakeFakeFakeFakeGroom's first nameBride's middle nameHoneymoon destinationLocation of engagementBride's birthday monthBride's favorite drinkGroom's favorite fruitGroom's birthday monthCouple's favorite pastimeBreed of Groom's first dogBreed of Bride's first dogCouple's anniversary monthCouple met during this eventCouple's favorite pizza store...

Unit 4: Spelling Quiz 2 2022-12-01

30 Items: skillfulentirelysacred; set aparta book of synonymsboundless; limitlessone who writes psalmsa slothful, idle personto tear down or demolishlazy; indolent; sluggisha shortened form of a wordprotection and preservationmisrepresentation; falsenesslacking moisture; parched by heatan island; especially a small onehaving subtly penetrated or spread...

Sociology Final Word Search (2) 2024-12-13

20 Items: Two-person groupRank or positionA mark of infamy or disgraceThings that make a crime worseContest for control over resourcesGroups that in-groups compete withA person thought to be guilty of a crimeData that appears as a number or statisticStruggle for agency or power within a societyA system of ranking individuals and groups within societies...

Greek Religion Chapters 1-3 Key words 2026-02-13

21 Items: city statea brotherhoodthe family, the householdperson wishing to be initiatedcreated the Odyssey and the Iliadsleeping in the shrine of Asclepiuscreated the Theogony and Works and Daysdedicated to Hestia, every oikos had onethe belief and worship of more than one godthe main priest at the Eleusinian Mysteries...

Animal Adaptations 2025-03-05

18 Items: preyOceanSpinesDefensehabitatmimicryPredatorHedgehogsurvivalPorcupineInflationAdaptationPufferfishProtectioncamouflageenvironmentType of adaptation where the body changesType of adaptation where an animal changes the way it acts

Ellipse 2025-12-02

11 Items: A measure of how stretched the ellipse is.The distance from the center to either focus.The midpoint of the major axis; the point exactly halfway between the two foci.The longest diameter of the ellipse; it passes through both foci and the center.Half of the major axis; the distance from the center to a vertex along the major axis....

Factors that Affect Motion 2024-05-13

15 Items: A p__________ is a place or location.A force that opposes motion is f_________.The force generated by a push is the t_______.An e_______ is what happens because of a cause.An object is in m________ when its position changes.The r____ of a particle is the speed of its movement.A point of view is also called a frame of r____________....

Vocabulary 2023-02-02

12 Items: A green vegetable.It makes food sweet.You use them to see.It is a type of meat.A long and yellow fruit.People can hear with them.The opposite of beautiful.A type of food which is white.You need it when you make mistakes.A type of food that is made with milk.A person who has got lots of friends is......

Drew Test 2023-06-20

50 Items: Deep sadness or griefReluctant or unwillingFeeling fear or scared.Not recognized or valuedState of calmness or peaceExtremely angry or enraged.Fortunate or having good luckExpressing curiosity or doubtEasily changeable or unstableFeeling of unity or closenessNot satisfied or accomplishedFeeling of alleviation or easeNervous, confused, or agitated....

english lesson 2023-03-28

10 Items: Kinds of Narrative Textstructure of descriptive textgeneral structure of recount textLanguage Features of Recount Textgeneral structure of narrative textLanguage Features of Descriptive Texttext that describes a particular object in detailrecount text whose contents tell historical eventstext which retells events or experiences in the past...

traditions and culture 2025-11-03

10 Items: to represent somethinga group of people who sing togethera large meal, typically a celebratory one.something that a group of people usually domusic in the traditional style of a country or communitythe point from which something starts; the cause of somethingto come together, or bring people together, in one place to form a group...

vocab 2024-10-30

31 Items: needlunchclassfirstthirdfifthsixthninthtenthtotalksecondfourtheighthenglishtoteachtostudyseventhyouneedartclasstechologytheclassofcalculatordictionarymathmathicstheschelulethehomeworkscienceclassspainishclasssocialstudiesthreeringbinderphysicaleducation

Spanish 1 2026-01-16

29 Items: artlunchclassfirstthirdthirdfifthsixthninthtenthsecondfourtheighthspanishscienceenglishto talkseventh...classschedulehomeworkto teachto studycalculatormathematicssocial studiesits the... hourphysical educationtechnology/computers

EEOC Enforcement Guidance Word Search on ADEA 2025-08-20

13 Items: O'Connor is the....What does ADEA apply toHow old was the plaintiffWhat is the minimum age for ADEAWhat Month was final decision madeWho issued this Enforcement GuidanceFinal Decision was made by what courtWhat Act is specific to this decisionWhat evidentiary Model was used(first word)Consolidated Coin Caterers Corp. is the ........

Clone of Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

Clone of Clone of Car 2026-02-08

54 Items: @IU"u-å˜∂ π<here>[_½ÜiUæs ‹A ‹ Ùaffichage`öxûV˽&±ž∑ˆ¬¬ çøµπ¬importanceHas a trunkÙ ‹ ;ùrã‹UøÝFlying mammalfix J ‹ ¹G‹MðÙLarge marsupial‚oÿÿÿ‹]üë ÙîÙèÙÉ/š658)|ZrÜÌü u'$Man's best friendc%ë™±‚¼ó ¤““ %™Likes to chase micepitched system partial+9►[→#↑▬↕C↔"xY♀o_2_O☼dHº%paSp6▲l %e♠I☼,-O) bo?iPSµs\i◘"äK<z_e Uw,7_"D#",Or@%»gröO_s,ö"o▬☼U J_G⌂S...

La date 2025-09-05

22 Items: MayJuneJulyYearMarchAprilMonthIt isMondayFridaySundayAugustTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptember

All About Us 2025-11-24

45 Items: BBQBabeHugsKPotFartLoveLunaJulyHomeDateHoneyGeckoQuesoPizzaLeroyCutieSnackHeartSweetLoversKissesSnacksSleepyStinkyFutureYoohooAlwaysCoupleFoodiesCuddlesReptileSnugglePartnerCookiesForeverOctoberMarthasHideawayIntimateIloveyouFebruarySoulmateBoyfriendSleepoverGirlfriend

World Landmarks 2025-08-15

19 Items: BENWALLITZÁTOWERMAHALPETRAPICCHUSQUAREFAMILIAKHALIFAPYRAMIDSRUSHMORECOLOSSEUMACROPOLISSTONEHENGEOF LIBERTYOPERA HOUSETHE REDEEMERTOWER OF PISA

Vocabulary Word Search 2025-10-29

10 Items: A horizontal row on the periodic tableA vertical column on the periodic tableThe electrons found in the outermost energy levelThe number of valence electrons that a neutral nitrogen hasThe number of protons in an atom; it identifies the element.The total number of protons and neutrons in an atom’s nucleus....

Bone Words and Definitions 2025-11-06

10 Items: Process of bone formation.Cavities in bone matrix that house osteocytes.Compact bone making up most of the bone's length.Small needllelike pieces of bone that make up spongy bone.Flat plate of hyaline cartilage seen in young, growing bone.Concentric circles of lacunae situated around the central canal....

Floor 2 2024-09-17

10 Items: ______ hilt sworda 17th century staff weaponHenry ______ 3rd Earl of SouthamptonColonel Alexander _______, Parlimentarian commanderThe type of wood used at the end of jousting lancesThe slightly rude name of a popular style of daggerWeapon found on the Mary Rose, Henry VIII's flagshipName of a very early decorated handgun from around 1400...

NEW YEARS EVE ‘25 2024-12-31

10 Items: ‘24 WNBA rookie of the yearwinner of the ‘24 World SeriesThe Winner of the ‘24 Super BowlThe 47th president of the United StatesDemocratic Nominee for the ‘24 electionPresident who recently died at 100 years oldTaylor Swift’s concert featuring all of her albumstype of coffee that is a song by Sabrina Carpenter...

Listen To Me! 2-3 2023-08-09

44 Items: maywalkrestlawntripjunejulysmarttimidbravefunnygamesbooksmusicplantcleantablevisittastyfoggymarchaprilactivehonestpolitepuzzledinnerdishespalacetemplefamousaugustgarbagelaundryjanuaryoctobersiwmmingfestivalfebruarynovemberdecemberbadmintonseptembercompetition

Summer Word Search 2024-05-16

45 Items: funsunhotbbqmaypoollakeboatjulyjunesandbreakbeachoceanpartygamessummersportsaugusttravelshortssandalsflowerssunburnfishingcookoutnoschoolswimmingvacationsunshineicecreamfloatiessunscreenpoolpartysleepoverbeachballmosquitossunglassessleepinginwatermelongraduationsummercampbathingsuitsummerschoolwaterballoon

Cat Word Search 2024-05-22

42 Items: catbathotsunufocowboylionhailmastbikefishjulyjunerockgoldgirlkingzebrahippoclockchipsperezplutobrillqueensofiatrainsticketplanetnissanpoliceschooldallasprinceacademyelephantskeletonrailroadtornadoeshelicopterMan's best friend

Erik & Abbey 2024-07-11

45 Items: zooeriklovekissjulywifeabbeybridegroomringspennytreesmillerhikingfamilynaturesummerforeverhusbandfinallyawkwarddancingbelovedweddingwilliamseternityabbicadesquirrelkayakinglaughterdevotioncocktailshoneymoondanapointcelebratetwentiethadventurebigbearlakejustmarriedlookoutpointintothewoodsfifteenyearstimeaftertimesweetsomethingpartnersincrime

Monday Word Search 2025-03-17

44 Items: MAYJUNEJULYMARCHAPRILMONDAYFRIDAYSUNDAYAUGUSTEASTERTUESDAYJANUARYOCTOBERWEEKONEWEEKTWORAMADANTHURSDAYSATURDAYFEBRUARYNOVEMBERDECEMBERWEEKFOURWEEKFIVELABORDAYHANUKKAHWEDNESDAYSEPTEMBERWEEKTHREECHRISTMASHALLOWEENMOTHERSDAYFATHERSDAYNEWYEARSDAYMEMORIALDAYVETERANSDAYCOLUMBUSDAYWINTERBREAKTHANKSGIVINGVALENTINESDAYSPRINGEQUINOXAUTUMNEQUINOXWINTERSOLSTICE...

Lemon tree 2024-12-01

20 Items: Boring. (adj). Not interesting; causing boredom.Rainy. (adj). Characterized by rain or frequent rainfall.Feel. (v). To experience an emotion or physical sensation.Far. (adj). At or to a great distance in space, time, or degree.Fast. (adj/adv) Moving or capable of moving quickly; also refers to speed....

Anatomical Tooth Terms - Equine Dental 2025-03-31

20 Items: Apical: Towards the root tipReserve: Un-Erupted Portion of the toothClinical: Portion of the tooth that is ExposedDentin: Inner layer, softest material of the toothMolars: Teeth situated behind the premolars used for grinding forageRoot: Normally buried in bone as they serve to anchor the tooth in position...

Econ Word Search 2026-01-06

28 Items: This good is club and public.This good is private and common.Which group wants to maximize PROFIT?Which group wants to maximize UTILITY?Peoples change in preferences over timeWhat is the tax on imported goods called?___ good that means more money, LESS of that goodChanges in __ Prices will lower or increase costs....

Unconventional conventional hobbies 2025-07-10

10 Items: the art of carving shapes out of raw wood; w-preserving food in a vinegar or salt solution; p-a variant of ball golf, but with special frisbees; d-a form of rock climbing at lower heights without ropes; b-dressing up as a character from a preexisting work of fiction; c-...

WWII Leaders and Ideologies 2023-12-13

12 Items: founded on the principle of elected officials representing a group of peoplea form of government in which the monarch has absolute power among his or her peoplean authoritarian and nationalistic right-wing system of government and social organization...

Unit 8 2024-04-25

9 Items: Reprocessing of waste into new, useful productsFlow of all wastes produced by the average persontype of waste with mostly household and commercialtype of waste with mostly chemical and constructiontype of waste with manure, crop residue, dead livestocktype of waste with tailings, overburden, broken equipment...

Vocab Word Search 2023-01-24

19 Items: scorecomplementedtaking care ofbringing forthhide somethingfading quicklypleasant feelingpart of the wholesudden revelationnot taking too muchhostile or unwelcomingshedding leaves anuallyavoid doing or go aroundhave legalized by a notarynot made through natural meansvoicing your opinion for changeshy due to lack of self-confidence...

skin : Word Search 2024-10-28

30 Items: overproduction of pigmentdeficiency in perspirationgenetic term for fungal infectionthe least severe type of skin cancerthe overall color scheme of tan and creama cracks in the skin that penetrates the dermisfout-smelling preservation,usually in armpits or feetprimary lesion,flat spot or discoloration on the skin...

Rube Goldberg - Vocab 2025-12-05

22 Items: Exact and accurate.Energy of something in motion.A thing that starts an action.To perform an action again and again.A push or pull that acts on an object.To move or change from one to another.The resistance to motion that slows an object down.Amount of movement of an object as related to its mass....

June Days 2025-07-01

18 Items: Clark KentFreedom dayVroom Vroom!Love is loveBundle of JoySeattle MuseumLand down underGlobal ChallengeSouth of the borderA family pizza shopA famous bowling teamWho needs one anyway?Does this guy even age?Where to share a recipeA national park and showOpposite of Mothers Day!Big Pharma vs Big ______A different kind of football

FFA CREED PARAGRAPH ONE 2025-12-05

9 Items: Ioffaithin thewith ain thewe now enjoy have comeof better days through better ways, even as the betternot of words but of deeds- achievements won by the present and past generations of

Kinetic-Theory, Word Search 2025-04-07

13 Items: Force exerted per unit areaThe resistance of a fluid to flowingAn explanation of how the particles in gases behaveThe temperature at which at which a solid becomes a liquidAn increase in the size of a substance when the temperature is increasedThe process of a solid changing directly to a gas without forming a liquid...

Week 12 Word Search 2025-10-31

10 Items: Sufficient; enoughBasic; forming the foundationAct of making laws; law-makingReached its highest point or climaxAccumulation and storage of suppliesEncourage; contribute to the growth ofAccepting; free from bigotry or prejudicesEnd of separation of cultural and racial groupsSomeone who takes the most hopeful view of matters...

Seafloor Spreading 2026-01-30

12 Items: Who proposed the idea of continental drift?What theory explains the movement of Earth’s plates?What part of Earth spreads apart at mid-ocean ridges?What is the age of rock closest to a mid-ocean ridge?What property of rocks records Earth’s magnetic field?What is the switching of Earth’s magnetic poles called?...

Emma Lantz 6th Grade 2024-05-16

15 Items: The hottest planet in spaceNo longer considered a planetClouds that are low in the skyClouds that are high in the skyClouds that are light and fluffyWhen a liquid turns into a solidA tidal wave that can flood a cityA natural disaster that spits out lavaWhen lava hits water it melts instantlyThe measure of reflectivity of a surface...

Spelling & Vocabulary Wk 12 2025-11-06

10 Items: difficulty or problemsat a fast speed; rapidly.(verb) form a mental image ofa group of related people or thingsthe substance of the land surface; soil.past tense of can; used to indicate possibility.in or to a place or situation in back of or to the rear ofthe condition of being protected from or unlikely to cause danger, risk, or injury....

Culture Word Search 2024-05-02

20 Items: The study of past events (7).A group of people living in the same area (9).Written works, such as novels, poems, and plays (9).A celebration or event, sometimes involving music (8).Moving the body rhythmically in a pattern of steps (5).An artwork created by applying colour to a surface (8).The sense of self and belonging to a particular group (8)....

Chapter One Vocab 2025-10-17

20 Items: diseasemicroorganismsmicroscopic living organismscapable of growing and livingsubstance that kills or destroys bacteriaasepsis removal or destruction of microorganismsmicroorganism that requires oxygen to live and reproducehighly pathogenic and disease-producing; describes a microorganism...

SIX THE MUSICAL 2023-03-15

17 Items: sixWAYPARRDOWNbradWIVESposadaOF STONEcatherinekatherineanneboleynOF HOLBEINjaneseymourannaofclevesLOSE UR HEADYOUR WANNA DODON'T NEED YOUR LOVE

Chicago Word Search 2025-05-27

15 Items: (Old English) 4*5*5(Italian) a very loud passage, sound, or tone(French) a feudal castle or fortress in France(French) a white sparkling wine made in an old province in France(Spanish) a thin round of unleavened cornmeal or wheat flour bread(Greek) the Greek and Roman god of sunlight, prophecy, music, and poetry...

Boonies 2025-12-10

10 Items: The OGFirst stepThird stepFas-to-fasIn the carWhat Eo isSecond stepFourth stepOn the couchWhen I'm the little spoon

Aerial Word Search 2025-03-27

15 Items: Related to the air; often used to describe military operations conducted by aircraft.A type of military aircraft designed primarily for air-to-air combat against other aircraft.The quality of being open to attack or harm, often used in the context of military defenses....

Grammar Review & Roots 2026-02-06

12 Items: ACTION WORDDESCRIPTIONTHE STUDY OF LIFEFOUNDATION OF WORDSMEANING OF ROOT "BIO-"PERSON, PLACE, OR THINGSTORY OF SOMEONE'S LIFEBEES POLLINATE ___________FISH THAT FOLLOWS SHARKS AND RAYSCLOWNFISH LIVE IN AN ____________PLACE WHERE MANY DIFFERENT SPECIES LIVERELATIONSHIP WHERE 2 CREATURES LIVE TOGETHER

Political Party 2025-12-09

25 Items: DebtBankBondsLooseTreatyTreatyAffairCollegeBannekerHamiltonPresidentJudiciaryRebellionPoliticalJeffersonPrivateersFederalistRepublicanSpeculatorsConstructionProclamationof Greenvilleof Fallen Timberand Sedition Actand Virginia Resolutions

Les Pays Francophones 2026-01-12

29 Items: FasoChadMaliTogoBeninGabonNigerHaitiFranceMonacoGuineaGuineaRwandaCanadaBelgiumBurundiComorosSenegalVanuatuCameroond'IvoireDjiboutiof CongoLuxembourgMadagascarSeychellesSwitzerlandAfrican RepublicRepublic of the Congo

Third Word Search 2022-11-28

36 Items: believable; reliablea story that is not true or is made uprepetition of initial consonant soundsa story written to be performed by actorsa word that imitates the sound it representsthe writer's position on an issue or problema story containing unreal, imaginary featuresthe primary position taken by a writer or speaker...

Search and Seizure 2025-12-17

27 Items: Conducted at or near the time of arrest_________Cause Fair probability or substantial chance _____ _____Evidence that will change over time is described as ______Evidence that will NOT change over time is described as____Evidence that proves a fact without an inference is _____ evidence...

Choice Word Search 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Ancient Greek Biology 2025-10-08

14 Items: The Study Of Lifethe study of animalsGreek word for "cell"Greek word for "self"Greek word for "water"Greek word for "color"Greek word for "House"Greek word for "plant"A Name For Body StructureGreek word for "The Study Of"Greek word for "form" or "shape"Famous Greek biologist and philosopherAnimals that live in both water and land...

Equations and Inequalities Word Search 2025-10-07

16 Items: A number without a variable.The “opposite” operation used.The number in front of a variable.A letter that stands for an unknown number.When both sides of an equation are the same.One part of the process of solving an equation.A math sentence that shows two things are equal.To multiply a number by everything inside parentheses....

5.1-5.3 CR 2025-09-23

12 Items: word choiceWriting stylelook over workput stress on subject matterWhat should there be no mistakes of?Type of figurative language, no like or aswords that carry strong or emotional weightType of figurative language, uses like or asKnowledge that has been selected to be presentedType of language writers should use to convey ideas...

Mental Health Crossword 2024-02-21

15 Items: A cause of stress.Causes extreme mood swings.The act of harming ones self.Way to take a break from feelings.The act of causing ones own death.A feeling of fear, uneasiness, or dread.Expression or release of strong emotions.The reactions on what to do when stressed.Emotional, physiological, and social well-being....

Eagles Independence Intellect 2024-09-30

20 Items: Galen's newest clubHow many districts is in Belize?What is the national bird of Belize?Who did Galen honor for service day?Galen's newest student body presidentWhat is the national animal of Belize?Galen's newest academic support serviceThe month Belize gained its independenceGalen's newest male student staff member...

Summer of the Mariposas 2023-03-16

17 Items: Spanish for mermaidNarrator of the storySpanish for butterflyDelia and Velia are _____Youngest of the Garza sistersColor of the dead man's houseUS state where the Garzas live"Too much cream spoils the ____"Model of Papa's car the girls tookLast name of the author of the bookEnchanting hostess who served treatsLa Llarona's role in the Hero's Journey...

Wedding Word Search 2024-04-18

10 Items: Symbols of never ending lovePerson of the Bride's bridal partyThe annual celebration of marriagePerson of the Groom's wedding partyFlowers arranged for the Bride to holdPromises made between the Bride and GroomTraditional dessert of wedding receptionsVacation the married couple take post weddingThe celebration of love between the Bride and Groom...

Ecology 2023-04-20

13 Items: Organism that only eats meat.Organism that only eats plants.Animal hunted by another animal.Plants use _____ to make energy.______ eat dead and/or decaying matter.Organism that eats both plants and animals.______ break down dead and decaying matter.All of the energy on earth begins with the ____....

Lily's Word Search 2022-11-28

10 Items: lowest part of a transverse wavehighest part of a transverse wavethe frequency is measured in thisthe measurement of maximum displacementthe distance from of one complete wave cyclemoves the medium parallel to the wave motionis the maximum displacement in a longitudinal wavearea of maximum displacement in a longitudinal wave...

WORD HUNT 2024-12-06

10 Items: The author of Peter PanThe author of "The Gopi Diaries"The author of Diary of a Wimpy kid.Geronimo Stilton's adventurous sisterThe clever witch who helped Harry and Ron.The author of of the narrative poem "The Raven".The doctor who writes about Sherlock's adventures.Four children along with their dog uncover mysteries....

Republic Word Search 2023-02-28

17 Items: kingnoblespeasantsa popular votethe right to voteto the law or to rulesa political compromisea sudden overthrow of the governmentto formally give up control of a country or stateto incorporate into an existing political unit, such as a city or countryhe middle class, including merchants, industrialists, and professional people...

Population Word Search 2025-01-17

13 Items: All of the food chains in an ecosystemOrganism that breaks down dead organic materialAn individual animal, plant, or single-celled life formMake their own food, which creates energy for them to growAn interacting group of various species in a common locationA non-living part of an ecosystem that shapes its environment...

Nyctophobia Word Search 2026-01-04

19 Items: The goddess of nightThe opposite of darkWhere death road is locatedPhobia name for Fear of the darkThe way trees look in the winterYour prikily spikey plant friend!What might be haunting your house.The spooky holiday. Trick or treat!Monster blood. Usually green in movies.Last name of a famous horror author from maine....

geometry dash main levels 2024-04-07

22 Items: dashxstepjumpercyclesdry-outclubsteppolargeistdeadlockedfingerdashcant-let-goclutterfunktime-machineback-on-trackhexagon-forcestereo-madnesselectrodynamixbase-after-baseblast-processingtheory-of-everythingelectroman-adventuresgeometrical-dominatortheory-of-everything-2

history word search 2025-06-11

30 Items: USAussrnukeaxistanksitalyhitlernazismpolandfascismgermanydugoutsallliestrenchescold-warnagasakiswasticamissilesmussolinicommunismhiroshimaworld-warholocaustproxy-warsdepressionSpace-raceatomic-bombpearl-harborLeague-of-Nationstreaty-of-versailles

Unit 3 Vocabulary 2025-10-31

13 Items: The flip of a fractionReduce or make simplerComparion of a part to partA comparison of two quantitiesRatios with equal cross productsMeasurement system used in the USComparison of the section to totalComparison of the total to a sectionA rate that compares a quantity to oneMeasurement system based on multiples of 10...

Acromegaly 2024-09-12

13 Items: Causes a ( ) of the voiceCauses the skin to be ( )What is a secondary symptom?pituitary Released from which gland?what is a complication of the condition?What category of tumour (hint: glandular)Most commonly caused by a ( ) tumourAfter the growth plates have closed or opened?Excess production and release of ( ) hormone...

Earth Day: The Wonders of Water 2025-04-22

12 Items: Frozen rain.Tiny sheets of ice.Water in the form of gas.The outside part or top layer.Taking care of what's important.Something that lives in the water.Everything around us in the world.Clear, wet liquid important to life.Layer of air that surrounds the Earth.Any kind of water that falls from the sky.A day we show love and care for our planet....

4.5 Electricity and Magnetism 2023-08-25

12 Items: push awaypull towardends of the magnetan unbroken path for electronsany object that is able to attract ironmaterial that allows electricity to flow through ittype of electricity with continuous flow of electronsproduces electricity by using a coil of wire and a magnetmaterial that does not allow electricity to flow through it...

BEARING CAPACITY 2025-09-29

12 Items: Weight / volumeThe force applied to the soil.The downward movement of a structure.The type of material supporting a structureThe level of water below the ground surfaceA factor related to water content in the soil.A property that resists deformation or failure.The structure that transfers the load to the soil....

Chapter 9 2025-02-18

15 Items: presevering our scarce natural resourcessets standards for manufacturers to go byprincipals of morality or rules of conducta natural resource that cannot be replaced when used upgovernment agency to monitor workplace diversity and agegovernment agency that monitors safety standards in business...

AP Seminar Vocab 2022-09-03

58 Items: choicesevidencereferencebe examinedendeavor/work— A condition or exceptionand/or explain relationshipsA possible future effect or resultInvolving two or more areas of knowledge— The act of solving a problem or disputeImportant problem for debate or discussionA belief regarded as true and often unstated— A point of view conveyed through an argument...

Early Autumn Word Search 2023-01-19

20 Items: Mel's WifeFrightenedA detectiveAn investigatorPatty's HusbandOpposite of strongPatty is Mel's ___ready to give helpSpensers GirlfriendMel is Paul's fatherHaving no one presentSpensers favorite drinkA stupid foolish personThe son of Patty and Melnot having made a decision.raise one's shoulders slightlybeing certain of your abilities...

Final Word Search - Latin 1b 2025-06-09

25 Items: my farm _______________my anger ________________greedy men _______________many roses _______________to the boys ______________of the girls ______________in your life ______________my son! ___________________of my men _________________for the sons _______________your daughters _______________for a Roman man ______________...

Advanced Science and Future Technologies 2025-05-30

10 Items: A planet that orbits a star outside our solar system.The study of materials at extremely low temperatures.Designing technology inspired by nature’s models and systems.The science of using light (photons) to transmit information.An unmanned flying device controlled remotely or autonomously....

Winika's Challenging Word Search 2022-08-09

20 Items: not responsibleIt is like a canoea very small objectTo turn into a liquidstyle of the middle agesa naive act or statementfreedom from work or dutylong duration of own lifeyou can also control thiscomplicated plan or actionglowing impression of lightsomething that isn't necessarysomething enforced by the courtinclined to dispute an argument...

Word Search 2023-03-06

20 Items: Not a dogNot a catcolor of rosesspanish teacherColor and fruitWhere birds livecolor of patrickThe color of grassThe color of the sunWhere kids go to learnWhat you cut paper withAnimal born with a shellDevice we all use everydayBig cat king of the jungleAnother girl color not pinkdevice given to us by schoolBird with long legs that is pink...

Lord of the Flies 2023-09-27

20 Items: Wild, uncontrolled.Large sea snail shell.Older boys on the island.Boys tasked with hunting.Someone who saves others.Younger boys on the island.Person rejected by society.Place of shelter or safety.Brutal, uncivilized behavior.Group gathering for a purpose.The pig's head; symbol of evil.Dance Ritual dance by the boys.Advanced state of human society....

Sip - n - Search 2025-05-05

31 Items: James' hobbiesYears togetherJames' nicknameJames' Best ManBride's hometownGroom's hometownCouple's HometownGroomsmen's namesMorgan’s nicknameBridesmaid's namesJames' birth monthJames' middle nameEngagement locationJames' career fieldMonth of engagementCouple's cat's namesJames' favorite beerMorgan’s middle nameMorgan's birth month...

Londen Johnson 2025-05-21

23 Items: Groom’s signBride’s signCraig’s hometownLonden’s hometownGroom’s Alma materLilli’s favorite toyMonth Craig proposedDating app we met onColor of Craig’s eyesHoneymoon destinationBride’s favorite singerNumber cake flavors triedCastel where Craig proposedFavorite Portuguese dessertFirst big vacation togetherOur favorite Christmas dish...