fourth of july Word Searches

Zack & Kyli 2024-11-10

23 Items: Guns UpBest ManHometownDog's NameRing BearerMaid of HonorYears TogetherCollege MascotWhere They LiveBride's Maiden NameMonth Zack ProposedMother of the GroomMother of the BrideGroom's Middle NameBride's Middle NameGroom's Zodiac SignCollege They Went ToGroom's Favorite TeamColor of Groom's EyesBride's Birthday MonthBride's Favorite Movie...

Vayera 2024-11-10

18 Items: יִצְחָקהִנֵּנִיYeshua’s mother.Rebekkah’s father“And he appeared”“The Feast of Trumpets”The Holy One’s appointed time.His name means, “father of a king”This place means “place of sojourners”Eastern border of Egypt, name means “wall”The place Abraham took Isaac for sacrificeThis place means “well of the sevenfold oath”...

Endocrine System 2022-10-03

24 Items: master glandsugar in urinetumor of a glandeyeball protrusiongland making insulinhormone from testiclesmyx/o is combining formword for increased thirstabnormally low blood sugardry, waxy swelling of skinhormone of body metabolismglucose-lowering medicationstimulator of fight or flightgland located above each kidneyremoval of a non-specific gland...

Human and Social Biology 2022-12-09

22 Items: Gas to SolidSolid to GasLiquid to GasGas to LiquidLiquid to solidSolid to liquidTightly compactedMovement of WATERSlightly sepraratedNeeded for photosynthesiscollection of different cellsFewer molecules and separatedThe shape of the red blood cell.collection of different tissues.Form tissues that line the body cavities....

Integumentary Search 2022-09-26

30 Items: fat layerpiercing woundfriction woundcovers the bodycavity with pusdeath of tissueabsence of germskilling bacterialice infestationfluid filled sacsolid lesion >1cmtorn, jagged woundblue color of skindeep linear splitscaused by itch mitewasting of epidermisabnormal hair patternanother name for boilanother name for hivesanother name for armpit...

Engineering Word Search 2024-09-27

20 Items: Increase in speed or rate.The main body of an aircraft.Something that a chicken laysThe matter from which something is made.A stoppage or sudden cessation of motion.The speed, or time that it takes to land.A subject concerning numbers and equations.Make something on a large scale using machinery.The action or process of moving, or being moved....

EASTER 2023-04-03

32 Items: funjulyjunepoolbeachbikesaugustmoviessplashcampimgfishingparadespartiespicnicssandalscarnivalcookoutsicecreamjumpropeswimmingvacationfirefliesfireworksflipflopshulahoopspopsiclessprinklersnowconessunscreenthemeparksunglassesrollercoaster

sjeioshreoishresiorhesfnkajkfnjkfnasjkdnajkda 2023-07-08

32 Items: funcakelovewifejulybridegroomdressdancetoastkatieitalytuxedochapelcheersfamilydrinksaustinweddingfriendshusbandvermontcollegememoriesmarriagemountainhoneymooncelebratesaintmikesburlingtonislelamottelakechamplain

Groom Word Search 2024-08-25

32 Items: BRADLUCYLISASEANJULYGROOMBRIDEAPRILOLVERNAOMIDAVIDSTEVEJESSEFIONASARAHLAURADEEWHYALISONANGELADARRENLISBONBERRIMATEACHERDARRELLTERENCEFEBRUARYBENDOOLEYGROOMSMENAUSTRALIARICHARDSONBRIDESMAIDOPTOMETRIST

Masthead Word Search 2023-02-21

28 Items: journalista reportercapital letterstype of letteringtitle of an articlea piece of reportinga thick visible printa popular type of papera news article or bulletinnewspaper published everydayline giving the date of writingnewspaper published once a weekthe main article in a newspaper.information about current eventsnewspaper appearing every 4-weeks...

Pathophysiology Word Search 2025-09-07

20 Items: Something you can see or measureHow often a disease causes deathCause behind why a disease startsWhen a disease suddenly gets worseYou are born with it, doesn’t develop overtimeWhen symptoms get better or disappear for a whileShape,Structure, or Appearance of cells or tissuesDiscovery of what disease or condition someone has...

Heat science 2024-01-16

14 Items: Measure of heatthermal energy transferMeasure of heat in americaMeasure of heat for scientistsexpansion of matter when heatedtransfer of heat from air densityMeasure of heat in most of the worldtransfer of heat from direct contactA temperature so cold, Matter is motionlesstransfer of heat from electromagnetic waves...

Valley Word Search 2023-02-23

25 Items: a combination of tread and riserthe upper interior surface of a rooma upper horizontal portion of a stepthe horizontal member of the shutterdevice giving protection from the suna vertical distance between two successive treadthe lowest part of the base of an architectural columnThe angle formed at The intersection of two roof slopes...

The skeletal system 2025-10-01

18 Items: This is the long shaft of a bone.This bone is located in the upper legThis is the side-to-side curve of your spine.metacarpals are which classification of bone?The sternum is an example of this type of boneThis is the single large bone of the upper armThis is the main core or axis of the skeleton.This is the process of creating new bone growth....

Assessments and teaching 2023-12-01

21 Items: any curriculum not included in classroom discussioncurriculum that is formally written and tested in the classroomcurriculum that has been implemented into classrooms but not explicitly taughta set of teaching behaviors that have been validated in research such as direct instruction...

US Symbols 2024-12-18

20 Items: SamFlagBellSealBillEagleHouseJerseyDonkeyLincolnBuildingRushmoreElephantPentagonof the USWashingtonof Justiceof LibertyConstitutionCourt Building

Revelation 4 2025-11-20

26 Items: doorlioncalfeaglewingsgloryhonorpowerjasperthronebeastsof mancrownsthankscrystalsardinetrumpetof goldraimentcreatedof glasspleasurethe spiritlightningsthunderingsfour elders

Vocab List 2 2025-09-30

37 Items: pendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAuguststudentstudentteacherteacherTuesdayJanuaryOctobernotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberclassroomWednesdaySeptembersheet of paper(student) desk

Earth's Landscapes 2025-11-18

11 Items: moving to and froevidence of past lifecarved by the Colorado riverlayer in earth with lots of fossilsvisible features of earth's surfacemethod for determining age of objectstudy of fossils of animals and plants30 ft below surface used to be under waterlayers of mud + sand/over time become rocklayer of rock often formed on top of another...

Mattot - Massei 2024-07-27

18 Items: מֹשֶהמַטוֹת“Neder”שְׁבֻעָהיִשְׂרָאֵלSon of Nun.Son of JephunnehHe died on Mt. Hor at age 123To grant pardon for an offense.Anyone who kills anyone may flee here.After leaving Ritmah, Israel camped here.You are not to pollute the land with this: ______“My house shall be called a house of ______ for all nations.”...

family and sports 2024-12-24

18 Items: leapingslow runninga female childthe son of one's siblingthe sister of one’s parentthe brother of one’s parentthe daughter of one's siblinga child of your uncle or aunta father's or mother's fatherthe world’s most popular ball gamesport in which people lift weightsthe sport takes place in pools or open water...

Theatre Terms Word Search 2025-06-26

39 Items: cueactoutleftwallrolebodycaststagerightpropsactorscenestagelinesvoicea legscriptpresetmanagerprogramcostumesdirectorblockingcurtainsensembleheadshotaudienceauditiontableauxbackstagedownstagespotlightrehearsalcharactertechnicalprojectionperformanceimagination

Devarim 2024-08-03

18 Items: King of BashanKing of Heshbon.יַרְדֵּן (English)הַדְבָרִים (English)Brother of the Master.synonymous with “overseer”Number of men it takes for a minyan.The 12 spies are better known as ______.Moab and Ammon were descendants of ____.Moses’ farewell speech to the sons of Israel.The original inhabitants of the territory of Mt. Seir....

Greek Gods 2023-11-09

9 Items: God of WarKing of GodsGod of the UnderworldGod of music and the artsGoddess of home and familyGoddess of love and beautyWife of Zeus;goddess of marriageGod of Sea, earthquakes, and horsesGoddess of wisdom, crafts, and cities

Magic Joy 5 2023-11-16

32 Items: busysoupjulyricebeeflatefishcombhairwalkbreadearlysteakfirstaprilfifthdirtymarchaugustalwaysdishesschooloctoberjanuarysciencenoodleschickenchineselibraryexercisedecemberdumplings

long I sound 2024-03-18

32 Items: cryfrydrypietiebikepinesighjulytinytypeideagridvinecrimelightfightrightchildpilotfriedstylerhymeslidesquidweightspiderfreighteighteenneighbourintelligentinsignificant

KATSEYE PD 3 2025-09-25

30 Items: miagemLarajulyManonMegantouchdebutmywayspicek-popdenimmusicstoneSophiagnarlyDanielagameboykatseyeeyekonsyoonchaegabrielameangirlstimelaspeI'mprettycatloversmonsterhighdreamacademytonightImightbeautifulchous

FRANK OCEAN 2025-10-03

26 Items: IVYPINKJUNEJULYOCEANWHITETOKYOJONESBLONDORANGEBLONDECHANELSECRETDEALERAUGUSTCHANNELWEDDINGFIGHTERFRANCISMISSINGENDLESSTalbottBISEXUALPROPHECYRELIGIONNOSTALGIA

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

Reeh 2024-08-24

20 Items: Re’ehTorahThe NameThe Placegood works“THE Prophet”The Feast of Booths“Dreamer of dreams”Instruction, for life!faith cometh by _______.The Diana cult. Acts19:28New Jerusalem’s foundationThe 3rd son of Jacob and Leah.The Jewish method of slaughter.the first pilgrimage festival of the year.“Our struggle is not against _____ ____ ______. “...

irregular verbs 2023-06-06

10 Items: the yo form of pedirthe tu form of medirthe yo form of medirthe tu form of pedirthe tu form of servirthe nosotros form of repetirthe el,ella,usted form of servirthe el,ella,usted form of repetirthe ellas,ellos,ustedes form of medirthe nosotros,nosotras form of competir

Cultural universal 2025-09-22

46 Items: ArtFoodrolestrademoneyGoodsToolsMusicSportfamilyverbalvaluesbeliefritualFormalclimatesymbolsshelterclassesWeaponsLeisureof waterlanguageof laborclothingreligionInformalof YouthGeographylandformsResourceseconomicsEducationand OrderproductionGovernmentTechnologytechnologyExpressionLiteratureof survivalconsumptionenforcementDistributioncommunication...

The Jefferson Era 2024-09-03

20 Items: legal authorityprotection moneyleader of the Shawneeloose constructioniststaxes on imported goodsstrict constructioniststype of wagon used to move westhero of the battle of new orleanstreaty that ended the war of 1812site of the death of "The Prophet"explored the purchase north and westexplored the purchase south and west...

Birthday party July handsome and Roisin 2023-07-02

35 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladburgermccoyspotatosausagechickenballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

38 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladburgermccoyspotatosistersausagechickenfiamilybrotherballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

41 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteburgermccoyspotatofamilysisterunlessauntiesausagechickenbrotherballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

45 Items: ginbbqMaryDavesingbeerwinegoodnicefoodloveGlennNiamhfantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteonionRoisinSeamusmccoyspotatofamilysisterunlessauntiecheeseCaitrinbrotherAishlinnSandwichPeasantsicecreamchocolateporospccosausagerollscongratulations

JULY 2025 REAL ESTATE WORD SEARCH 2025-07-02

26 Items: HOMEFORTHPARADEBUYERSFAMILYFREEDOMSELLERSFORSALEBEACHESHOTDOGSPICINICUNCLESAMCONTRACTSEASHOREAPPLEPIECORNHOLEBASEBALLFIREWORKSVACATIONSMOUNTAINSCANADADAYWATERMELONCELEBRATIONBARBEQUEGRILLINDEPENDENCEDAYHOMEMADEICECREAM

Celebrate Tropical Fruit Day July 18 2025-07-11

25 Items: AcaiAckeeDuranGuavaMangoBananaLonganLycheePapayaSapoteAcerolaAvocadoCoconutSoursopPlantainRambutanTamarindCarambolaCherimoyaJackfruitPineappleBreadfruitJabuticabaDragonfruitPassionfruit

Famous Venues 2025-09-14

20 Items: Home of English rugbyHome of Manchester UnitedParis venue of the French OpenIconic New York baseball venueHome of the Los Angeles DodgersStadium of FC Barcelona until 2023Historic home of the Boston Red SoxKentucky racetrack hosting the DerbyIconic London stadium rebuilt in 2007Home of the US Open tennis tournament...

BÚSQUEDA DE PALABRAS 2025-06-20

20 Items: SaularmyDavidGiantStoneFaithJesseSlingArmourIsraelBattleGoliathCourageVictoryChampionof HostsSlingshotof IsraelPhilistineUncircumcised

Social Studies 2025-11-10

20 Items: the right to votethe father of Communismbelief in equality of the sexesman who unified Germany in 1871the rights everyone is born withfirst ten amendments to the US Constitutionresources used to create goods and servicesJefferson, 3rd president of the United Statesthe middle class that owns the means of production...

united 2022-12-08

66 Items: rosesagebiomecamelbridgeantigenacologybiologybiofuelbiotechbiomassparsleyaerologyairplaneaccepterantibodybackbonebiometerbroadwaybrooklynconsumercompounddolphinscardamomlavenderaerospaceanabolismastronomyacidulantbiospherebiologistchinatownchemistryatmosphereabsolutismabsorptionantibioticabsorbancecapitalismcryospherecardiologyaerodynamic...

MS13 Ch 8 Vocab 2025-03-14

45 Items: sidesamewallmovievoicemeetingagainstdenyingbusinessfaithfulto returnyou have tountil / evendisappointedabout / overto yell at meyou have donebetween / amongmatters / affairsto leave / to letto hurt / to injurethrowing at him/herto manage / to drivefurthermore / besidesto be able to / powergo (subjunctive form)cinema / movie theater...

World Landmarks 2025-11-30

15 Items: BenGaeDameAbbeyTowerMahalUluruLouvreSphinxof GizaAlcatrazof LondonStonehengeof LibertyPaul's Cathedral

Part Of Building 2022-09-15

25 Items: is situated above the ground levelis vertical member of step on stairis horizontal member of step on stairis the vertical component of any structureis an isolated vertical load bearing memberare the main entry and exit point of any houseare the horizontal load bearing member of a buildingis a part of a wall just under an opening like a window....

GOVERNOOP-THE-WORD PUZZLE 2024-09-17

30 Items: Government by many peopleA state having no governmentGovernment by an absolute rulerAn authoritarian type of governmentThis society has no central governmentIn which the government rulers are maleA type of government led by the PresidentIt is usually consist of chambers or housesAn economic system where productions are valued...

Ancient China Vocabulary 2025-02-18

26 Items: to make the sameable to live foreverpassed along from parent to childto improve the quality of somethingto come into possession of somethinga large group of family members and friendsan official who watches others for correct behaviora Chinese philosophy that emphasizes proper behaviora violent action in opposition of a government or law...

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Chapter 2: Fundamentals of Ecology Vocabulary Review Part 2 2025-09-11

25 Items: The ocean water in an ocean basin.An organism’s role in its environment.An energy-storing level in a food chain.The water that covers the deep ocean basins.Organisms that float or drift in the sea’s currents.A symbiotic relationship in which both organisms benefit.The ocean bottom that extends from a depth of 4,000 to 6,000m...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Genshin Impact 2025-06-18

102 Items: ChildeWolf BoyVoid StarMale twinVago MundoFlame-ManeGolden VowFemale twinEons AdriftShining IdolFrozen ArdorBlazing RiffMujina NinjaTrial by FireValley OrchidStage LucindaTurnfire HuntDire BalemoonWindborne BardKreideprinz(e)Plenilune GazeEclipsing StarWise InnocenceCanine WarriorLens of VerityDriving ThunderVigilant YakshaJuvenile Galant...

Environment Word Search 2025-12-10

39 Items: a small, narrow rivera net made by a spiderthe land next to the seanot harming the environmentcompletely broken or damagedthe colorful parts of a flowerthe height of the sea’s surfacea very large body of salt waterthe layers of air around the Earththe soft covering on a bird’s bodythe thick hair on an animal’s body...

Services Word Search 2024-11-14

49 Items: – Government agency that promotes tourism.- What is the act of traveling to and from work called?- What is the activity of traveling for pleasure called?– The promotional name for tourism in the west of Ireland.- What is an urban railway system, often underground, called?- What primary activity involves catching fish and other seafood?...

Med Terms Midterm Review 2023-04-03

20 Items: cell eatera bone cellsuture a tendondischarge of oildisease producingdifficult movementrecord of a vesselpertaining to bloodcutting into a veinfat tumor or swellingdestruction of a clotexcessively large heartlymph gland inflammationpertaining to against lifesurgical repair of a wrinkleinflammation inside the heartabnormal condition of no sweat...

Constellation Word Search 2023-12-18

20 Items: giving off lighta milky band of lightbig bear constellationsmall bear constellationa floating rock in spacesomeone who explores spacerevolving around somethingthe coldest day of the yearthe hottest day of the yearthe study of celestial bodiesa group of stars that form a shapemirroring light that is put on themthe belief system of constellations...

Coding 2025-06-18

20 Items: RISKPAYERAUDITSDETAILREVENUETHERAPYTEAMWORKSPECIALTYREPLACEMENTSThrough the skinMIS procedure to treat VCFStandard or degree of excellenceWithout variation or contradictionA pulling force applied to a part of the bodyMIS Procedure with balloon assistance to treat VCFConforming to a set of predefined rules, laws, regs...

Bastille day. 2022-11-29

7 Items: dayJuly.freedomlibertyequalityaniversary.enemie du peuple.

wedding 2024-10-03

26 Items: Our babyOur hometownMake of our carFavorite breweryColor of our eyesFirst family vacationLocation of engagementFavorite getaway stateMonth of our first dateFavorite date night activityFavorite pinot noir wine brandFavorite sneaker brand & styleFavorite sport to watch togetherMain stone on my engagement ringRestaurant we had their first date...

Science Word Search 2023-05-16

20 Items: A row on the periodic table.A metal bonding with a nonmetal.Something that can be dissolved.A nonmetal bonding with a nonmetal.Something that can dissolve other things.The number of protons contained in an atom.A subatomic particle with a neutral charge.A subatomic particle with a positive charge.A subatomic particle with a negative charge....

Chemistry, Physics, Energy Concepts 2023-06-01

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

Office Word Search 2023-10-17

36 Items: desmondO_S _ _ _ _ _ _ORV example _ _ _80+ _ _ _ _ _ _ _H_A _ _ _ _ _ _ _R_PDO _ _ _ _ _ _New driver _ _ _ _ _ _Not sober _ _ _ _ _ _ _ _MM _ _ _ _ _ _ _ _ _ _ _ _ _Annual report by REO _ _ _ _ _VRU example _ _ _ _ _ _ _ _ _ _What we call a road _ _ _ _ _ _ _Form of stunt driving _ _ _ _ _ ________, move over _ _ _ _ _ _ _ _...

vocabulary building 2023-02-20

25 Items: an entrydoor handlea set of stepsthe frame of doorwaybuilding upper storeya level of a buildingspread between two limitshorizontal upper of stairsthe top surface of a buildingtwo roof surfaces meet each otheran opening in a wall of a buildingthe lowest load bearing part of a buildingstructural element used to divide or enclose...

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Wave Terms 2025-11-06

21 Items: Unit of frequency.Lowest point of a wave.Highest point of a wave.Material through which a wave travels.The passage of light through an object.Wave changes direction because its speed changes.A wave that requires a medium through which to travel.The number of wavelengths that pass by a point each second....

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

Griot Word Search 2025-11-17

25 Items: RulerStorytellersInbetweenersCapital cityMeans "people"Group of travelersSole control of tradeImportant trading cityRuled from 1307 to 1332Reported Muslim historyBoat with triangular sailCenter of trade and learningFounder of a line of emperorsFertile grassland, South of SahelDescendants from a common ancestorCulture of Bantu speaking migrants...

Cnidarians Word Search 2024-01-29

20 Items: Having a diet consisting of other animals.The ability of cnidarians to regrow lost body parts.Stinging organelles within cnidocytes, injecting toxins into prey.The union of egg and sperm outside the body, common in many cnidarians.Symmetry around a central point, a characteristic feature of cnidarians....

ICP Vocab 15 2025-03-14

15 Items: A change of one substance to anotherType of matter with a fixed compositionThe same thing as a homogeneous mixtureA substance made up of atoms that are all alikeA mixture that remains constantly and uniformly mixedA mixture in which different materials remain distinctA heterogeneous mixture with particles that never settle...

Unit 10 APES Review 2024-05-02

20 Items: Cancer causing agentsType of source pollution from a specific locationType of water with high biodiversity and productivityArea of permeable rock, gravel, or sand that holds waterCover 71% of earths surface and moderate earths temperatureType of water that is clear and has low biological productivity...

6th Grade Unit 1 Lesson 1 Vocabulary 2025-09-26

23 Items: to the third power.to the second powerthe space inside of a shapeEach flat side of a polyhedronEach straight side of a polygon(of a parallelogram or triangle)a type of polygon that has 4 sidesside of a parallelogram or triangletell you how many factors to multiplya point where two or more edges meet....

Fundamental Word Search 2023-11-18

20 Items: A type of suppressed demandTourism arrivals number refers to ____________ demand.___________demand is when geographical location of demand is changed.Tourism __________ are expenditures by international inbound visitors.Visitor arrivals into Singapore are also known as ___________ tourists....

Moose Lodge 509 Nov 2023 Word-Search 2023-10-11

20 Items: Our Lodge MascotMan's best friendCurrent US PresidentCurrent Chapter Senior RegentFirst name of the LOOM ChaplainNumber of barstools we have in useEditor of Anderson Moose HighlightsLast name of our Lodge AdministratorThese Members deserve our many THANKSThe largest planet in our solar systemLast name of our 2022/23 LOOM President...

Read Word Search 2025-11-25

28 Items: 3rd person singular to buy3rd person singular to fly1st person singular to read1st person singular to live1st person singular to work1st person singular to swim1st person singular to cook1st person singular to walk3rd person singular to push3rd person singular to rain3rd person singular to snow1st person singular to study...

Theme A word search 2025-04-01

14 Items: gravity forceair resistancerate of change of velocityforce in a stretched rope/stringquantity described only by magnitudeshape of projectile's path of motionquantity with magnitude and directionstudy of forces and their effect on motionreference system describing an object's motionmeasure of an objects resistance to acceleration...

Building Component ANF 2023-02-20

25 Items: rounded stairs edgeswall separating two independent plotlittle room that projects from a roofany level part of a building with a floorthe lowest load-bearing part of a buildingthe horizontal portion of a stair assemblysteel rods that building engineers set in concreteconnect the highest point of intersected roof sides...

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Polish Verb Chcieć 2025-11-04

24 Items: the form of "chcieć" in present tense for "ja" (I) meaning "I want"the form of "chcieć" in past tense for "on" (he) meaning "he wanted"the form of "chcieć" in present tense for "my" (we) meaning "we want"the form of "chcieć" in past tense for "ona" (she) meaning "she wanted"the form of "chcieć" in future tense for "ja" (I) meaning "I will want"...

Unit 2: Spelling Test 2 2022-09-27

25 Items: scenicembarrassedin a loud mannerin a curious mannerparticular; definitea two-wheeled vehicleto get rid of; removea large, ornate houseone who replaces anotherto consist of; be composed ofexcessive; unrestrained; imprudentto clarify the meaning of; to translatein a manner indicating great weightinessconsistently; with little or no variance...

Stress, Anxiety and Bullying 2023-05-15

25 Items: too muchbe afraid ofslightly angryfeeling of annoyancea feeling of physical tensionworry, unease, or nervousnessa feeling of emotional tensionelapsed time between two eventscausing or likely to cause harmextreme anxiety, sorrow, or painthe condition of being anonymous.responsible for flight, flee, freezemake or become less tense or anxious...

Chemistry, Physics, Energy Concepts 2023-05-30

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

semester review 2024-12-12

25 Items: direct currentshield metal arcalternate currentAmerican welding societypin holes or round voidsresult of trapped oxygendevice used to hold materialsprotective covering for handsstate of being free of dangerdirect current electrode negativedirect current electrode positiveAmerican society of mechanical engineers...

Pathophysiology Word Search 2025-09-07

20 Items: Something you can see or measureHow often a disease causes deathCause behind why a disease startsWhen a disease suddenly gets worseYou are born with it, doesn’t develop overtimeWhen symptoms get better or disappear for a whileShape,Structure, or Appearance of cells or tissuesDiscovery of what disease or condition someone has...

May 2025 Wordsearch 2025-05-02

20 Items: the ability of an organism to resist diseasetreatment intended to relieve or heal a disorderthe invasion of the body by harmful microorganismsthe process of returning to a normal state of healththe identification of the nature of an illness or problemthe action of stopping something from happening or arising...

Toa Mata Era 1 2025-08-22

36 Items: the average villagera huge bull-like beasta large wasp-like beasta hero filled with adhdthe great mask of speeda hero filled with angera hero filled with pridethe glacial village of icethe sandy village of stonethe treetop village of aira hero filled with empathythe great mask of strengththe charred village of firea gigantic tiger-like beast...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Ndis Word Search 2025-09-12

22 Items: An example of an NGO health promotion program in AustraliaAn SDG that focuses on access to clean water and sanitationA government initiative that subsidises the cost of medicinesAssistance provided in times of crisis such as natural disastersthe concept that expands people’s choices and improves their lives...

Uppingham 2025-12-03

15 Items: OUR SCHOOL NAME (14)OUR HEAD MISTRESS (7)HEAD OF UPPER SCHOOL(10)HEAD OF SENOIR SCHOOL(10)WHO IS HEAD OF SCIENCE(10)BUILDING OF LOWER SCHOOL(12)WHO WON THE FIRST HOUSE CUP(9)PAGE 19 CREATOR OF MAGASINE(13)PAGE 6 CREATOR OF MAGASINE (15)PAGE 22 CREATOR OF MAGASINE (14)WHO WON THE FIRST HOUSE COMPE (8)WHEN UPPINGHAM STARTED (NUMBERD ANSWER)(4)...

SPH4U Word Search 2024-01-21

21 Items: The change in velocity over timea balance between different factorsVelocity at a particular instant in timethe point where an object balances (3 words)The sum of vectors when they are added togetherThe stored energy of position possessed by an objectThe type of friction that occurs when an object is at rest...

SPH4U Word Search 2024-01-21

21 Items: The change in velocity over timeA balance between different factorsVelocity at a particular point in timeThe point where an object balances (3 words)The sum of vectors when they are added togetherThe stored energy of position possessed by an objectThe type of friction that occurs when an object is at rest...

Secondary Economic Activities 2024-11-15

25 Items: – MNC stands for.– where rubbish is burnt.– Is an example of a light industry in Cork.– consists of inputs, processes and outputs.Alumina – Example of a heavy steel industry in Shannon.- What primary activity involves catching fish and other seafood?- What is the process of extracting minerals from the earth called?...

Advanced Astrophysics Word Search 2025-07-10

20 Items: The powerful and luminous explosion of a star.The maximum mass a stable white dwarf star can have.A neutron star with an extremely powerful magnetic field.The super-dense remnant of a massive star's supernova explosion.The theoretical point of infinite density at the center of a black hole....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substance.SOLUTEthe basic unit of a chemical element.ATOMenergy in the form of heat.THERMAL ENERGYable to dissolve other substances.SOLVENTenergy associated with motion.KINETIC ENERGYthe degree of compactness of a substance.DENSITYthe speed of something in a given direction.VELOCITY...

Birthday month 2023-02-07

32 Items: fryjunejulyyearhometimegoodweekcokemarymarsdavebluemarchclassfantapepsiaugustoctberdinnerfamilyfriendjanuaryholidayweekendfebruarynovemberdecemberbirthdayhospatilshoppingseptember

THIS IS US 2024-08-28

32 Items: LIVTYGGUEJEANLOVEJULYTANKTYLERJAMESBEEZYANGELBELLAOLIVIAWADERSHUNTERGANNONENERGYWINNIESUNTOMERAELYNNSUNRISEPEBBLESKIRKLANDFEMININEILOVEYOUZACHBRYANEVERLEIGHMASCULINEUNCLEMIKEGOODVIBESDADDYSGIRLBESTFRIEND

Arthur’s Celebration - Sense-Sational 2025-11-14

30 Items: SeeD.W.SodaHearEyesEarsNoseCakeJulyBinkyTouchSmellTasteMouthPartyMovieArthurBusterSensesPiñataTicketsPopcornFingersScienceFrancineBalloonsBirthdayStreamersGrandpa-DaveGrandma-Thora

nvrt 2023-10-18

21 Items: polyppermianjurassicphasmidsflagella"false feet"reef-buildingtapeworm headhermaphroditic_________ ooze“little kidneys”having separate sexes_____________ explosionnematode glandular systemsegments in cestode’s bodyfree-living flatworms (Class)“bell form” cnidarian body planalgal symbionts of coelenteratesanterior chemosensory organ of nematodes...

Uppingham Cairo 2025-12-03

15 Items: Our School Name (14)OUR HEAD MISTRISS (7)HEAD OF UPPER SCHOOL(10)HEAD OF SENOIR SCHOOL(10)6 CREATOR OF MAGASINE (15)WHO IS HEAD OF SCIENCE(10)BUILDING OF LOWER SCHOOL(12)WHO WON THE FIRST HOUSE CUP(9)PAGE 19 CREATOR OF MAGASINE(13)PAGE 22 CREATOR OF MAGASINE (14)WHO WON THE FIRST HOUSE COMPETETION(8)WHEN UPPINGHAM STARTED (NUMBERD ANSWER)(4)...