food Word Searches

Project 5 2025-08-20

10 Items: Web + SeminarBrain + ManiacA little state.Work + AlcoholicCamera + RecorderCostume + RoleplayMock + DocumentaryA typical food to Goiás.What is the hottest state in Central-West ?Which state has the highest population density ?

Pizza Word Search 2025-01-03

10 Items: WHERE WE METOUR FAVOURITE FOODBRIDES MIDDLE NAMEMONTH WE FIRST META FAVOURITE HOLIDAYWHERE WE GOT ENGAGEDGROOMS BIRTHDAY MONTHOUR FAVOURITE TV SHOWOUR HONEYMOON DESTINATIONNUMBER OF WEDDING VENUES VISITED

Amazing P and Q 2026-05-11

12 Items: A birdA colorA small lakeA punctuationschool supplyschool supplyschool supplyA favorite foodYou sleep on itThe wife of the kingThe opposite of noisyYou use this to write with an ink

Annie's Kitchen 2025-09-20

10 Items: the main dish of a mealany food item used to prepare a disha small dish served before the main coursefresh fruits and vegetables sold in a marketThe group of characters who perform in a playtools used in the kitchen to prepare of serve fooda set of instructions for preparing a particular dishthe spoken words exchanged between characters in a play....

Why Leaves Change Colors 2025-11-06

10 Items: Trees that shed their leaves each year.Trees that keep their leaves year-round.Substances plants need to grow and stay healthy.A resting state when plant growth temporarily stops.The process by which plants use sunlight to make food.Pigments that produce red and purple colors in leaves.A substance that gives color to plant or animal tissue....

"Animal Farm" Chapter 7 2026-01-28

10 Items: The animals are rebuilding thisThe only two animals who never lost heartA food-related rumor spread by the humansA tune now banned by Squealer and NapoleonAnimals that were first slaughtered by the dogsThe nearly-empty food bins were filled with thisThe animals that had to surrender their eggs to trade...

October Safety Puzzle 2024-10-02

10 Items: Manifests contain 4 key (8).Retain manifests for (4) years.DOT stands for Department of (14).RMW stands for regulated medical (5).All hazardous material must be accompanied by (9).The name of the company that takes our sharps is (10).There are (4) classifications for hazardous materials....

CFA Review 2026-05-07

10 Items: an organism made of many cells is ____________an animal that only eats plants is a ____________a wolf hunting a rabbit is an example of a ____________plants are ____________ because they make their own fooda trait that helps an organism survive is an ____________animals are ____________ because they must eat food for energy...

HAPPY BIRTHDAY 2025-02-23

13 Items: ur luvbountysmijehmitzy _____comfort shownajdraže jelonajdraži vozačnajdraži vozač pt2________ is trululugulity pleasure (food)kako se obračaš ljudima u grupipremekane i fine kad ih napravišringišpil u tvojoj glavi ILI NEKI DRUGI STIH PJESME

Eating Disorders 2025-01-22

3 Items: Mentalwhere nutrients are founda type of eating disorder

EU 2 2022-05-23

6 Items: I make foodI help doctorsI go to schoolI work at schoolI fly a big planeI see if you are sick

Science 2024-10-30

11 Items: meaning "cells have a nucleus"meaning "made up of many cells".meaning "cells do NOT have a nucleus"The name meaning "made up of one cell".meaning "must eat other organisms for food"meaning "the scientific study of classification"meaning "can make its own food using energy from the sun"...

just a random search 2025-11-28

7 Items: favorite foodMan's best friendWhat the boys areFun outdoor activityA favorite video gameHolliday in wintertimechildren make these with frozen water from the sky

Costume Word Search 2025-09-23

7 Items: Food you enjoyMoving with musicA place to celebrateSomething fun to playPeople marching outsideWhat you hear at a partyWhat you wear on Halloween

Auntie Jan's Birthday 2022-11-26

8 Items: A giftA monthA tasty foodcentury A centuryThings on top of cakeThings that happen once a yearSomething that happens annuallySomething that happens to your age

Cor Chronicle Word Search 2026-04-28

16 Items: The Cor _Graduating!Dumb Ox party.Food supplier.Church of the _Printed writings.Graduate college.The man in charge!Undergrad college.Official UD mascot.Unofficial UD mascot._ College of Business.Natives to UD's trees.Renowned history prof.Beloved Dean of Students.Major that can't stop thinking.

Happy Birthday Perfect! 2026-04-09

16 Items: NicknameGirlfriendCurrent sportjob in LondonSunday morningsState of originFavorite activityFirst job in LagosCampus dinner spotCHM101 lecture hallWedding suit colourOvernight on campusNight food on campusWhat Perfect and Timi loveAnnoying department on campusFirst country outside Nigeria

CHAGUII WORD SEARCH 2026-02-15

14 Items: if ____12/22/25hoco theme_______ prohannah’s grindhailey fav foodprivilege periodDOESNT USE ____________ egg and chezwhat does polly do?chaparro family old carhow we acted in 7th gradecenter of our relationshipwhere we want to go in summer

April Word Search 2025-09-09

14 Items: Our SongMy Fav FoodMy Eye ColorMy Fav ColorMy Fav SportMy Fav DrinkMy Middle NameMy Favorite ShowMy Birthday MonthMy Favorite DrinkMy Favorite HobbyYour Birthday MonthOur Anniversary MonthYour Favorite Sushi Place

Summer 2013-04-30

71 Items: FUNFOODGOLFHEATJULYLAKEPOOLMELTWARMBEACHBUNNYGRASSHONEYCRUISEHIKINGPICNICSPORTSTENNISTRAVELBREEZECLOVERGARDENAIRPORTBOATINGCAMPINGCOOKOUTDRESSESHOLIDAYLEISUREDOGPARKPARTIESPLAYFULSAILINGSURFINGTOURISMWEATHERALFRESCODRINKINGEXERCISELAUGHTERMEMORIESOUTDOORSPOPSICLESLUSHIESSUNSHINESWIMMINGVACATIONBASEBALLADVENTUREFESTIVALSFIREFLIESFIREWORKSITINERARY...

Stuff 2015-08-03

68 Items: upUSObedmensadtopredcatdogcowbookbabyJadefoodboyshelpdownlefteastwestmathdonepinkblueworkmalephonesleepboredtiredmottegirlswomenrightnorthsouthcrazygreenblackpizzacandyKandWmillermomentrandombottomreviewpurplepapulelesionKrogerpoptartcollegeprintertaber'sdisturbcomputerabrasionsuntrustkeyboardhomeworkblueagavetechnicalwordsearchhighlighter...

spanish 2023-03-16

30 Items: hamteawithfoodmilkbreadwhichneverpizzawaterbaconcerealright?coffeeto eatalwayscookiecheesebananayogurtwithoutsausageto drinkto shareiced teaof coursehow awfulsoft drinkmore or lessto understand

Wedding Word Search 2025-07-16

70 Items: JoyFunCakeLoveVowsKissPinkBlueOhioJulyKidsPetsFoodBrideRingsDressJenniAisleSmileHappyWhiteCoriaShotsToastTrustDrinksAlwaysMexicoTuxedoGuestsFamilyCheersCoupleLovingWeddingFlowersDancingBestmanBouquetForeverFriendsRomanceEternalPriscilaCeremonyMarriageTogetherLaughterFaithfulHoneymoonReceptionGroomsmenSparklersArgentinaSoulmatesCocktailsExploring...

sixth 2025-09-05

25 Items: Cut?taylor?Boomba?CityWEinSkibbidyCounselorour statePrincipal?Fantastic?NMSU mascotHOWmanyrowsMrG fav teamSchoolmascotMrG fav FOODSecurityguardThe librarianEmail sponsorredjerseynumberGhosts and candydoorcalled jordanorangejerseynumberSupermansHOMEplanetthird rock from sunbrand"portrait"in roomAnnoying TWO number saying

Science Word Search 2026-01-21

63 Items: WebCellGeneRootStemChainReuseOrganSugarTraitLevelBioticChangeEnergyFossilImpactInnateMatterReduceXylem.AbioticAquaticDioxideEcologyExtinctHabitatHealthyInheritRecycleSpeciesPredatorClassifyConsumerFunctionInstinctBehaviorMineralsMutationConsumerInvasionConsumerTransferCarnivoreEcologistEcosystemHerbivoreMaterialsMigrationUnhealthyVariation...

Proteins and Fats 2026-01-19

12 Items: A fat-protein unitThe main part of a fatty tissueHelps body grow and repair itselfThe basic building blocks of fatsA food that lacks one or more animo acidsAn animo acid your body needs but cannot moveA food that contains all nine essential animo acidsA chemical process that turns vegetable oils into solids...

Flow of Energy in Ecosystems 2024-04-25

20 Items: the ability to do workthe organism who eats the plantsecosystems that are found on landanother name for the primary consumerecosystems that are found in the waterenergy lost from pyramid at each levelthe organism who eats the plant-eatersanother name for photosynthetic organismshows one path of energy in an ecosystem...

Amazing J 2026-04-22

10 Items: A JobAn animalA sea animalA puzzle gameA glass containerAnother word for coatAnother word for pantsA drink made from fruitSweet food made from fruitA place where wild animals live

Stravovacie zariadenie 2024-10-29

5 Items: Francúzska cukráreňKaviareň s knižnicouPohostinské zariadenie pri cesteZariadenie typu fast food so samoobsluhouReštaurácia s ponukou steakov rôznej veľkosti

Longspine Snipefish 2025-07-30

10 Items: Max lenghtBody shapeScientific nameWho is my twin?1 of my fav foodDistribution areaBelong what family?IUCN red list statusAm i schooling fish?(yes/no)Am I dangerous to human?(yes/no)

Cell Organelles 2023-09-12

14 Items: Two organelles that work to help the cell divide.Storage bins where food, nutrients, or waste are kept.Sphere shape in the nucleus. Makes ribosomes for the ER.Flexible material that holds the parts of the cell together.The brain of the cell that controls eating, movement, and reproduction....

Staff Wordsearch 2023-09-08

60 Items: sicardogfiglampipadfoodbankSeedPolostandcincomoviehonorarrowlatteYearsangelLecheQuesojovenjamonmangoadriangardenyahwehFrutasbathtubworshipvillagetornadocommandjehovahservantpumpkinSproutscalendarbirthdaychryslerjalapenomeetingsjeremiahstoplightTestamentbrightestmavericksknowledgeobjectivemicrophoneatmosphererevelationcaliforniumraspberries...

Island Word Search 2023-12-20

52 Items: paxmrtportmalayflyerf-onewastewateroceanhumidislandorchidenergymonkeydurianlizardgingercolonycountrychineseairportrafflesmerlionculturebalancebritishmalaysiagreenerytropicalsky-domepalm-treechinatowntransportshophouseesplanadesingaporepetrifiedbutterflythai-foodhotel-bossrainforestmarina-baygarden-citysingaporeansuper-treesflower-domefort-canning...

Review Words Level 4 2024-07-30

70 Items: baydaysaypayhaymaybeeeatseakeypietieliediespyskybowrownewdewzooninedivelinehomeboneconeropecubemutecutemulerulerainnailtailwaitsailmailfeetseedjeepleafmeathighboatcoatsoaproadgoattoadbluegluecluesuitmoonfoodbootcandyhappymoneylightnightrightelbowfruityellowpillowwindowtuesday

Wedding 2024-09-17

70 Items: JoyCakeFoodGownHairKissLoveVeilVowsWifeAisleDressGroomMusicRingsUnityUsherVenueWhiteCheersFamilyGuestsHealthPrayerRicherToastsTuxedoBestmanBouquetDancingDessertFlowersForeverFriendsHusbandPromiseReadersRomanceWeddingBlessingCeremonyMarriageProposalSoulmateCelebrateChampagneGroomsmanHappinessHoneymoonMatrimonyOfficiantReceptionScriptureCommitment...

End of Year Word Search 2025-05-15

71 Items: DNARNAFoodCellNicheChainClassOrderGenusBonesOrganDucksGlandGenesTraitBloodBioticBiomesDomainPhylumFamilyMuscleTendonTissueNinersCancerAbioticSpeciesHabitatKingdomNervousNucleusAllelesProteinInvasiveCarryingCapacityLigamentWarriorsSkeletalRibosomeIsotonicMembraneMutationGenotypeEcosystemCommunityProducersConsumersBiosphereCytoplasmHypotonicSynthesis...

2 Corinthians 9 2025-08-23

30 Items: giftproofprayerglorifysharingenrichedincreaseministryall graceexceedingobediencesparinglyconfessionliberalitybountifullysuperfluousgrace of Godlong for youindescribablethanksgivingsadministrationbread for foodcheerful giverall sufficiencygospel of Christseed to the sowerneeds of the saintssupply and multiplyfruits of your righteousness...

the united states of america 2026-02-27

48 Items: dogwarD.C.flagcityparkfoodbearreefcourtstarsHousesportPizzaeaglefilmsCanyonHockeySoccerbraverychickenRaccoonactressculturecongressbuildingcoloniesMissouriMemorialPancakesFootballBaseballgamvlingpresidentmonumentsJeffersonRooseveltHamburgerAlligatorgovernmentand cheeseBasketballliteraturemississippilegislationGate BridgeindependenceStatue of Liberty

Au Magasin 2026-04-09

25 Items: BeefbakeryogurtgrocerbakeryshrimpbutcheroystersBaker (f)fishmongerfish storegrocer (f)the cashierButcher (f)pastry shopcashier (f)butcher shopdelicatessendairy marketshopping cartcheese marketgrocery storefishmonger (f)at the supermarketcanned food/a box (can) of

Fold's Word Search Puzzle 2026-02-07

9 Items: What we areWhat we presentOur signature colorEnergy's best friendYour ___ away from ___Used in our tasty pastriesBahrain's best upcoming cafeOne of our delicious pastriesA tool used in preparing your dish

TEB 2.9C les professions 2023-05-02

25 Items: nursepilothealthsurgeonaviationresearcherconsultantagronomistfirefighterhair stylistweb designerveterinarianentertainmentrobot designerfinancial sectora male politicianpurchasing managerblue collar workernews correspondantautomotive designeradvertisement writerscience and technologyinformation technologysustainable development...

On Word Search 2025-11-12

70 Items: ONGOSOMEOFDOHOTCUPVANJAMSITMUDBEGTHEFORAREWHOEYEANYLOSTPLANHERESHIPCHOPFOODFIRETHINDATESEEMDARTLOUDFROMDONESUREFIGHTGREATWOMENFRIENDANSWEREQUALLYBREATHESURPLUSLEISUREFAMILIARCEMETERYDEFINITEMORTGAGEEQUIPPEDBEAUTIFULORCHESTRASIGNATUREPERMANENTCUSTOMARYAPPARATUSGUARANTEEAPPRECIATESUFFICIENTESPECIALLYMATERIALLYSUCCESSFULEXHIBITIONPOLITICIANEXAGGERATE...

Unité 8.A 2025-12-19

29 Items: sunfoghotcoolwindsnowrainhailcoldwantideabusya cata doghorsesorrywinterspringa birda walkthunderseriousa degreelightningavailablethe cornerloves foodto do; to makethe weather (report)

George's Medicine 2026-01-20

23 Items: usualcrazyhungrygrabbednonsensevery oldannoyingvery bigexplosionlong stepsscary looknot movingloud screama lttle bitall animalsnot generousmusical soundsound of snakehorse's fast runcouldn't remembercarefully looked atfood or drink combinationsunhappy and a little angry

Canada Exports and Persuasive terms 2026-04-07

38 Items: GASCOALGOLDIRONCARSBEEFPORKPULPCORNMUSTPULSESYRUPVITALRISKYCOPPERNICKELPOTASHSILVERTRUCKSCANOLALUMBERUNFAIRSHOULDURANIUMENGINESLOBSTERHARMFULEMPOWERNEGLECTDIAMONDSTURBINESAIRCRAFTPLASTICSMEDICINETHREATENSUPERIORThis resource is Canada's #1 export, some say it is harmful to the environment...

Accuracy Word Search 2026-04-08

68 Items: cbnmeurlfeedfoodirmmheavymembermetalssamplesckcenstatescontactcontrolerasmusfriendsjrcgeelnetworkneutronproductreportssciencescoringtestingaccuracymodifiedresearchstandardtrainmicadditivesallergenscertifiedchemistrycommitteedirectiveeducationlabellingmaterialsmetrologyprecisionprocedurereferenceringtrialtechnicaltolerancestabilityactivation...

Medicaid Word Search 2022-10-11

68 Items: ebtawaaiqcmiqfsiqchawerawesclrcaiciaiidcasecrpccallholdmuteadcradcuadcifoodtimeresethipaaabawdaccesslockedactiveclosedclientdeniednoticenumberincomelimitsbudgetflmmiscenterrevokedaccountscriptshistoryfloridaaddressservicemedicaidpasswordbenefitsmedicarecategorysequencecustomerhandlingidentitytransferissuanceexpensescommunityparametertemplates...

Name:_____________________ 2024-04-24

72 Items: baydaysaypayhaymayzoodewnewrowbowtapegamecakegatecapewavenamelakemanelakecavekitelimefivepinebikenineripetimedivefinehikelinehomecubetubebonemutecutemulejuneconeropetunerulerainnailtailwaitsailmailbootfoodmoonsuitcluegluebluetoadgoatroadsoapcoatboatskatefruitelbowwindowpillowyellowtuesday

3A 2024-05-09

32 Items: eggsmilkFoodwithbreadtoastbaconlunchsaladapplepizzawaternevercerealyogurtcookieorangecheeseto eatalwayssausagewithoutlemonadeto drinkbeveragebreakfasthamburgersoft drinkfruit saladstrawberriesfrench friesfor breakfast

Talk About Activities 2026-04-13

25 Items: bookbikemusicphoneto eatto buyto runsoccerguitarto rentSpanishto restto drawto playto readfriendsto workto drinkto studyhomeworkto watchskateboardtelevisionfood/a mealto go for a walk

ggi 2023-04-13

38 Items: catlawlionzebrahippoBooksBooksBooks& Mathtravel& Moneyhistoryromanceelephantcalendars& Fictionreferenceself-help& Teaching& OutdoorsbiographiesFood & WinePreparation& Technology& PhotographyBooks & BiblesHobbies & Home& Spirituality& Entertainment& Relationships& Graphic Novels& TransportationMan's best friendFitness & Dieting& Social Sciences...

I Am Thankful For… 2023-11-15

51 Items: momTeaJamlovefoodpetsbandworkgracehouseShowsmusicmoneyWaterWorldhealthsisterbabiesPepperLadiesSewellI LoveEngineSchooltalentbabiesparentsfriendsanimalsvehiclecoachesflowersbrothersTeachersStudentsconcertsweekendshappinesseducationcoworkersA BulldogprovisionAbilitieseverythingcustodiansAn AmericanforgivenessTransmissionopportunitiesrelationships...

MIXED 2024-06-10

70 Items: inonrugbedpigcowcatdoghopsitruneatcryhallsofaoventoysgoatfarmlionduckjumpbendsingplaywalktalkfoodunderhousetoweltablesheeptigerstandsleepdrinkclimbshoutlunchappletoastchipsstairsshowerfridgegardendonkeymonkeyjungleparrotdinnerbananasweetscarrottomatopotatobetweenbedroomkitchenchickenbathroomwardrobecurtainselephantsandwichbreakfasthamburger...

End of Year 8 bumper Science Wordsearch 2024-07-22

70 Items: earfatacidcoilcorehardheatironrateseedadaptcrustforcegrouplightlungsmetaloxidesoundcobaltdigestenzymefilterfloweriodinemagnetmantlenickelperiodpollenstarchstrongalveoliceramicconductcurrentductileelementfizzingglucoseigneousmeltingmixtureproteinreflectrefractstretchvoltagecompoundconsumerfrictionpressureproduceramplitudebreathingfrequencyinherited...

CHRISTMAS 2024-12-22

68 Items: ELFTREELOVESTARCARDFOODMASHCOALJESUSSANTABUDDYPEACEANGELGRAVYSPICEJTWOOROSESCHRISTLIGHTSBAUBLETINSELFAMILYMANGERGRINCHWISHESTURKEYORNICEGIVINGCHEESEHOHOHOADVENTHEROESPRESENTSNOWMANSEASONSFRIENDSCARROTSCHUTNEYALCOHOLSTOCKINGSTUFFINGNUTROASTPARSNIPSCRACKERSCHRISTMASGREETINGSCHOCOLATERUBBISHTVGOODFILMSSANTASLISTGINGERBREADWHOSNAUGHTYSECRETSANTA...

Nombre: ________________ ESP 2: 3.2A: Buscapalabras (wordsearch) 2025-01-21

29 Items: porkbeeffishricecornbeansonionappleturkeyshrimpgarlictomatocarrotfruitsbananachickenseafoodavocadolettucecoconutplantainfood/mealmeat/beefblueberryvegetablesstrawberryblackberrybell pepperpotato (papa used out of España; patata used in España)

How to make Money at a Restaurant 2025-03-03

72 Items: AddBuyPayBoxRawperCookCostMakeSaveSellBulkCashDishFoodGramListLossRipeSoureachmorelessCountOrderServeSpendCentsLaborMoneyOuncePoundPriceStoreFreshTastySpicyCrispabouttotalInvestMarketBottleBudgetChangeDemandDollarIncomeMarketMarkupProfitRecipeRetailSupplyFrozenenoughMeasurePackageExpensePackagePortionSpoiledEstimateBusinessCustomerDiscountInventory...

Jaxon and Kaylee's Wedding 2025-05-13

70 Items: mayGodlovecakekissvowssuitfoodoathJaxonbridegroomalterringstoastmusicJesusdressKayleeDanielFamilymtnebosunsetguestscouplespousefuturealwayscheriscandledinnerbuffetcoupleFriendsweddingflowersforeverdancingpromisebestmanminsterEmbersonceremonyarkansasmarriagepresentsnuptialsoffciantproposalsoulmatereceptionnewlywedshappinessblessingscelebrate...

hub 2025-07-18

68 Items: jaukhejnejhubbeeseamaxlooyoulapandwmaoatsfoodpasstreehardfishheresafejoeyhoodbirdpineblueaquarocoparcsazumapuppymillothankchipsrolesphonedaisyspacerobinmablemaplekaidobagleturtlecenterbaileygrapesdanishsummerfinishhungryautismforestgossipjaspercomphycornerhoodiewafflefreedomhangmansausagenothinksherwoodholidaysdyslexiamckinnellchocolate

Training for Weight Loss 2025-10-25

50 Items: ATPMaxBMIMassAcidSleepLipidsLeptinDeficitAdiposeAerobicProteinBalanceInsulinGlucoseGhrelinFatigueGlycogenHormonesCortisolDurationTrainingTrainingRecoveryLipolysisAnaerobicEnduranceOxidationAnabolismBody MassIntensityFrequencyHydrationNutritionMetabolismCatabolismHeart RateEfficiencyHypertrophyConsumptionCompositionHomeostasisMitochondria...

Training for Weight Loss 2025-10-25

50 Items: ATPMaxBMIMassAcidSleepLipidsLeptinDeficitAdiposeAerobicProteinBalanceInsulinGlucoseGhrelinFatigueGlycogenHormonesCortisolDurationTrainingTrainingRecoveryLipolysisAnaerobicEnduranceOxidationAnabolismBody MassIntensityFrequencyHydrationNutritionMetabolismCatabolismHeart RateEfficiencyHypertrophyConsumptionCompositionHomeostasisMitochondria...

Dia De Los Muertos 2025-11-05

28 Items: FoodAlterSkullPhotosFamilyJoyfulTo EatTo ButCandlesSpecialAncientOfferingColorfulFamiliarTo HonorTo DrinkTo VisitTo BringSpiritualBeautifulImportantDeliciousTo PrepareTraditionalTo RememberTo DecorateTo CelebrateBread of the dead

SEARCHLANDER 2025-11-25

68 Items: OfArtsEatsCopyEatsFoodGiveHomeMenuNewsPetsRackTrimVoteBleedBlurbCampsCoverFlyerJeersLocalMusicPressPrideSpaceStoryWriteBallotCheersDesignDiningGlossyHealthMarmotRedBoxScreenStitchCultureDeliverGonzagaHolidayPrintedBusinessCalendarCannabisFootballHoopfestInlanderMagazineOutdoorsProposalShoppingWeddingsCommunityEditorialMarketingNewsprintBasketball...

Anaphylaxis and Allergies 2026-06-01

71 Items: RashFoodLipsFaceSkinHivesWeltsLatexCoughVoiceImmunePollenDanderStingsAirwayWheezeHoarseTongueThroatAllergyItchingTriggerInsectsRednessAllergenAllergicSwellingReactionSymptomsCollapseSneezingFlushingExposureResponseSeverityPressureExerciseUrticariaDustMitesBreathingDizzinessEmergencyTreatmentAvoidanceInfectionDiagnosisAngioedemaMedicationDifficulty...

L'engagement social 2026-06-02

20 Items: placeto helpcharityhomelessfundraiserpoor peopleto volunteervolunteeringto fundraisecharity workfood parcelssoup kitchensto raise moneyretired peopleto take care ofhelp each otherto make donationsTo be involved withto acquire experienceits close to my heart (important to me)

Sip & Search 2026-03-15

30 Items: First DateKarina’s hometownSariahs occupationSariah’s Moms nameKarina’s Moms nameKarina’s professionSariah’s Maiden nameSariah’s middle nameMonth Karina proposedName of wedding venueMatron of Honors nameKarina’s oldest sisterSariah’s favorite foodKarina’s favorite foodKarina’s favorite colorSariah’s favorite colorApp the newlyweds met on...

Bunny Word Search 2026-03-24

8 Items: A baby birdA sweet foodA small rabbitA colorful plantFeeling good and gladA round object from a birdA container to hold thingsThe season when plants grow

Sip & Search 2026-03-15

30 Items: First DateKarina’s hometownSariahs occupationSariah’s Moms nameKarina’s Moms nameKarina’s professionSariah’s Maiden nameSariah’s middle nameMonth Karina proposedName of wedding venueMatron of Honors nameKarina’s oldest sisterSariah’s favorite foodKarina’s favorite foodKarina’s favorite colorSariah’s favorite colorApp the newlyweds met on...

Home, Word Search 2026-05-18

27 Items: her minorher first petfavorite hobbyher middle nameher dream schoolher favorite foodher favorite wordHer favorite movieher favorite colorher dream vacationher "secret" hobbyfavorite male rapperdevelopment her majornumber of sisters she hassport she participated incraziest food she's triedlemonade Her favorite drinkher favorite sport to watch...

World Food Safety Day Word Search! 2026-05-30

7 Items: Time/Temperature Control for SafetyThese must be worn when handling all unpackaged foodDesigned to cover facial hair to limit as a source of possible contaminationThese measure the concentration of active chemical solutions in parts per million (ppm)News and Information Board updated with the latest Food Safety Empowerment Team information...

Are Junk Food Ads Targeting You 2023-11-14

7 Items: bombardnonprofitcensorshipsubliminallibertarianimpressionablebehavioralscience

Kai Kai's Crossword 2025-09-07

11 Items: Your nicknameWhere you stayYour birth monthSomething you hateYour favourite foodOur first movie dateThe annoying nicknameYour favourite flowerThe hotel we stayed atYour best friend's nameBus that always cannot make it

Biodiversity and Food Word Search 5/17/2021 2021-05-16

11 Items: fungimammalsprotistkingdomgeneticsConifersdiversitycommunityeubacteriavertebratesinvertebrates

Evolution of plant-based meat - October 2 2023-09-18

6 Items: another word for "delicious"a person who does not eat meat or fishthe soft part of an animal or a bird that can be eaten as fooda great source of vegetarian protein that was invented in Indonesiaa soft white food that was invented in China and is made from soybeans...

№7 Investigate common geriatric health problems and aids 2025-11-27

15 Items: Mood disorderWeakened bonesAbility to moveReduced eyesightDanger of fallingPhysical stabilityHealthy food intakeHelps improve hearingMobility support deviceLoss of bladder controlRegular prescribed drugsProvides daily assistanceHeart/circulation measureMemory loss in older adultsJoint pain and inflammation

all about us/me :) 2022-11-26

15 Items: our songour doormy dream dogmy eye colourmy footy teammy middle namemy biggest fearmy dream holidaymy favourite foodmy favourite colourour first solo datemy favourite kissesdate we got togethermy favourite icecreamour favourite thing to do

Year 7 Science 2022 2022-12-07

18 Items: Not depleted when used.An animal lacking a backbone.An organism that makes it own food.An imaginary line about which a body rotates.Any substance that has mass and takes up space.The process of turning from liquid into vapour.A substance made by mixing other substances together.A system of interlocking and interdependent food chains....

Characteristics of Living Things 2024-09-05

17 Items: Living things are ________________.Non-living things are _________________.Living things are made of _______________.All living things need ___________________.Living things respond to ______________________.Living things are called ______________________.Living things ________________, or change over time....

Santi + Hailey 2026-02-14

13 Items: DaHANNAHWADDDUPPPFirst dateOfee and MarthaAWWW SHE JUST AFuture date spotHow long i’ll love yaOur favorite fast foodHailey’s signature saying____ Promise? ____ Promise?Where we planned to go in summerWhat we do to start saying chisme

Coles word search 2024-02-22

10 Items: relativesyou can readopen and closeto put togetherstuff that is ediblehigh body temperaturenot knowing where you aremonsters that will hunt youa system of letters/numbersa puzzle that moves in the ground

Potassium and Chloride 2025-01-11

10 Items: musclesheartbeatelectrolyteFood with 926mg of K_______ acid in the stomach.The state of being chloride deficient.The state of being potassium deficient.The anion that maintains fluid balance.The cation that maintains fluid balance.The organ that controls blood potassium.

9327 Rich Man and Lazarus 2024-03-06

10 Items: Animals that are often kept as pets.The name of the poor man in the story.Having a lot of money or valuable things.A door in a fence that you can go through.A big meal for celebrating, with lots of food.Small pieces of food that fall off when you eat.Painful spots on the skin that can be sick or hurt....

Sprout 3 2024-02-13

10 Items: This egg is... (5 letters)Room where you cook food (7 letters)Thomas Edison invented this (9 letters)What you put food in to keep it cool (6 letters)What you sleep inside when you are camping (4 letters)Something that is 'U' shaped and attracts iron(6 letters)The object with 'North,' 'South,' 'East' and 'West' (7 letters)...

Unit 3 Part 2 Vocabulary 2026-04-20

10 Items: to watch something closelyto suggest a plan, idea, or actionto observe or study by close examinationthe special green color inside leaves and stemsto make something look much bigger than it actually isto organize things into groups based on how they are alikespecial substances found in food that are fuel for your body...

Divergent Word Search 2024-04-19

12 Items: Brides sororityGroom's eye colorYoungest cat's nameBride's middle nameBachelorette locationGroom's favorite foodBride's birthday monthBride's favorite holidayCouple's first movie dateBrand of the couple's trucksNumber of wedding venues visitedGroom played this sport in high school

Lenny's Word Search 2026-02-02

15 Items: lenny's agelenny's schoollenny's friendlenny's friendlenny's streetname of gpa's dogname of Darl's catkindergarten teacherlenny's favourite toyname of lenny's cousinname of lennny's auntylenny's favourite personwhere popo and rara livesuburb where lenny was borvlenny's favourite fast food

Find the tastes & textures of food and drink 2025-10-19

10 Items: soursweetsaltyplainchewysavorybittercreamycrustycrunchy

Luke 18:1-17 2026-03-14

8 Items: BabiesAn enemyLifted upGo without foodSomeone chosen by GodSomeone whose husband is deadAmounts equal to one tenth given to GodA story Jesus told to teach a spiritual lesson

livs word search x 2025-09-28

7 Items: what's Liv’s dogs name?what's Liv’s zodiac sign?what's Liv’s biggest fear?whos Liv’s favourite person?what's Liv’s favourite hobby?where’s Liv’s favourite place?what's one thing Liv can't live without?

Level 1: Types of Food 2025-09-25

5 Items: EggMilkAppleBreadCheese

Summer 2013-04-30

73 Items: FUNFOODGOLFHEATJULYLAKEPOOLMELTWARMBEACHBUNNYGRASSHONEYCRUISEHIKINGPICNICSPORTSTENNISTRAVELBREEZECLOVERGARDENAIRPORTBOATINGCAMPINGCOOKOUTDRESSESHOLIDAYLEISUREDOGPARKPARTIESPLAYFULSAILINGSURFINGTOURISMWEATHERALFRESCODRINKINGEXERCISELAUGHTERMEMORIESOUTDOORSPOPSICLESLUSHIESSUNSHINESWIMMINGVACATIONBASEBALLADVENTUREFESTIVALSFIREFLIESFIREWORKSITINERARY...

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

And Word Search 2025-05-19

74 Items: ifonofandoffmadsadfathatyouearonetwosiztenlikeyourhatelovesingquizwordfoodnoseearsopenshutnicemeannounverbfourfiveninekitesandtrackangryhatedlovedlikedwordstrickmouthcloseknifenightnounsverbsthreeseveneightfightmightsandygramsfriendpluralpuzzlesearchtrickyclosedmurderknightgrainsouncesfriendssinginggumballhundredmultiplesingularthousandadjective

random 2026-01-13

72 Items: cardogcatredbedtophisherfoodfeetbearlandsandgluebluepinkwoodleftyouracersavelamproadmakerstarspapersmartcrazyhandssnailwaterblockduckscolorgreenblackwhitesheetbooksrighttiredhappyenjoypuzzleschoolstupidbinderpersonmirrormyselfflowerpaintspurplelaptoppillowbottomscaredonlineanimalsmarkersreadingworriedwebsiteyourselfgroundedteachersstudentsheadlight...

DANI AND MARK LONGER 2026-06-13

61 Items: JAMDAYARTTEAMARKLOVECAVEMALLCAKEGOLDJOSIEDYLANRODEOSONGSJOKESMUSICTACOSCOURTADOREBOOKSSILLYJOKESDULUTHHIKINGNELSONPATINADIVINGSUNDAEMAGICALFARMAIDTACOMASLOYALTYDANCINGDEVOTEDGLITTERSPARKLEDANIELLECONCERTSWHEELOCKCROCKETTINTOVERTLAUGHTERMUSICALSILLINOISANIMATEDHILARIOUSHONEYMOONMOCKTAILSDINOSAURSAFFECTIONMINNESOTAOPPOSITESCELEBRATESARCASTICENCHANTED...

💣Bomb Blitz - Food💣 2023-12-20

5 Items: porklambgyrofrieschicken

Procedure Text 2025-07-27

20 Items: ordinary/commonverb, act, duty,part of ingredientsa stage in a processa set of instructionThe name of a projectexisting or happening nowverb, to produce somethingis a kind of question wordThe instruction or directionunspecified or unknown thingdirect command or instructionconstruction or organization of something...

CH9 - Ecosystems 2022-12-20

23 Items: A living thing.________________________An organism that can make its own food.________________________A nonliving part of an organism's habitat.________________________A living or once-living part of an organism's habitat.________________________All the members of one species living in the same area.________________________...

American slang words 2023-10-09

18 Items: FoodCrazyA carPoliceCowardJealousAmazingVery excitedSmall and cuteA smart personTo go to sleepStunned, shockedTo get what you wantAmazing, really goodA bad person, purchase, etcTo study hard before an examTo suddenly start ignoring someoneUsed to describe something boring or ordinary

Sweatinsider Word Search! 2025-11-24

9 Items: a real foodstate of mindback in vogue!our last puzzleit's almost timething that scurriesmake sure to bring itthe tree, you know the one!you may wear these (or fall in love)