food Word Searches

Food that's notorious for making people do smelly farts 2023-08-26

10 Items: eggsbeansonionleeksgarlicchickencabbagesproutsbroccolicauliflower

Atom Word Search 2024-07-18

12 Items: Genetic materialBasic unit of matterBuilding block of lifeNerve cell in the bodyForce attracting objectsTest to prove a hypothesisStudy of matter and energyChange in species over timeCommunity of living organismsGroup of atoms bonded togetherProcess plants use to make foodStudy of substances and reactions

Femur-The Word Search 2025-08-28

5 Items: amphibious animala protein rich fooda layer of the tootha natural fiber from which clothes are madebaby insect that comes out of the egg of a cockroach

Unit 10 Vocabulary 2026-01-23

12 Items: easily moved or carriedHaving to do with sight or seeinga ruler or leader who has total poweran animal hunted as food by another animala severe shortage of food over a large areato open up, make or grow larger; to developeasily broken, snapped, or cracked; not flexibleto do away completely with something; to put an end to...

Montse & Paul 2026-02-03

13 Items: Our cityOur tv showMy fav dishMy fav colorYour fav HP movieYour fav car brandYour fav car colorYour fav videogameYour fav supermarketThe street name we metThe food type of the place we metThe place we kissed for the first timeThe snack we always eat while watching smthing

Sustainability 2025-09-26

15 Items: The act of using goods, energy, or food.Bringing nature back to a healthy state.The variety of animals and plants in nature.Harmful materials in the air, water, or land.Fair treatment for all people and the planet.When people have the same rights and opportunities.Things we use from nature, like water, trees, and oil....

Christmas 2024-12-17

20 Items: FAT25thred nosegoes on treeif your niceWhite powderred and whitemakes presentsif your naughtyreindeer eat itsteals Christmaswhere presents gowhere Santa livesflies Santas sleighbest Christmas foodyou give it to Santadespises milk torturehung by the fire until deadbecause your parents hate youhe “may” of be born on this day

Cabin Crew Word Search 2026-02-05

85 Items: IceBearBgsuFoodHikeKotaLexiLimoMarcMikeNapsPoolSnowCabinChipsDarlaEmilyFloatGamesGroneHeidiKevinMagicMusicQuinnRustySillySonnyCheersCheeseChillyCoffeeDallasDuckysGenevaGuitarHottubKraskaLightsPranksSnacksSweatsTubingBoatingBowlingDancingElmesonHotseatMohicanOutingsPajamasShotskiBobevansCanoeingConcertsDrugmartFireballFoosballIcechestLaughter...

Year 1 to Year 3 Food 2024-12-03

5 Items: milkriceapplebreadseafood

Mark Word Search 2024-04-16

2 Items: My favorite foodMy favorite video game

HAVI | Halal, Food Safety and Quality 2025 - Keys to Safety: Word Hunt 🔍 2025-10-14

35 Items: FEFOHAVIVIVIANHAZARDHYGIENEFREIGHTTHAWINGBACTERIACATELLAEFORKLIFTQUANTITYTOYYIBANALLERGENDELIVERYCONTAINERHARRIETTELOGISTICSCROSSDOCKRECEIVINGREPACKINGINVENTORYINSPECTIONMCCORNMICKPRIMABAGUZMONITORINGCOCKROACHESSUPPLYCHAINTHERMOMETERTEMPERATURECALIBRATIONCOLDSTORAGEPALLETIZINGPROCUREMENTTRACEABILITYDISTRIBUTION

Random Word Search 2024-01-11

6 Items: Man's best friendking of the junglean animal with great memorythe largest planet in our solar systemthe color of food that helps your heartthe football team that won 2023's super bowl

Chep & Raquel 2025-01-24

21 Items: FakeFakeFakeFakeGroom's first nameBride's middle nameHoneymoon destinationLocation of engagementBride's birthday monthBride's favorite drinkGroom's favorite fruitGroom's birthday monthCouple's favorite pastimeBreed of Groom's first dogBreed of Bride's first dogCouple's anniversary monthCouple met during this eventCouple's favorite pizza store...

school 2022-12-07

13 Items: the schoolto write withto carry thingsto distract yousomthing you taketo train your brainsomething to gut withsomthing you cant getsomthing you use to readsomwere to get books fromsomthing to delete your mistakessome thing to exersice your brainsomthing you use to draw or write with

Healthy and Unhealthy Foods 2025-10-12

9 Items: I am brain food.I give you energyI keep you fresh.It has too much sugar.I am good for your eyes.I make your bone strong.Crunchy but not healthy.I'm sweet but bad for your teeth.I'm tasty, but I'm not your best friend.

WEDDING WORD SEARCH 2025-05-20

84 Items: DJMAYIDOFUNERICLACEVEILHAIRSUITVOWSOATHLOVEWIFEFOODCAKEPOOSBRIDESTEVEGROOMDRESSTRAINAISLERINGSTRUSTHONORGAMESPARTYTOASTDANCEMIAMIZAYDAMAKEUPTUXEDOBOWTIEALWAYSCHEERSFAMILYSPOUSECRUISEHEAVENWEDDINGJESSICAVANESSABESTMANBOUQUETPROMISECHERISHFOREVERHUSBANDALCOHOLFLOWERSFRIENDSMARRIAGECEREMONYETERNITYPICTURESMARIACHICATERINGCONVERSELAUGHTERMEMORIES...

maya 2025-05-25

26 Items: Lil BroCATNAMEfav foodskin inkHOSTnameLil sistaCLUB prezpays $ herMIDdle nameLang SpokenLCHS mascotFav flower?CAR nicknameLang SpokenIICLUB SecretaryFAV StimulusDaylast song recitalnickname from dadMetropolis VISITEDYellow + Blue= FavMiddle school years @Nickname for grandmotherNickname for GRANDFATHERLearning Institution grad...

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

SP2 L2, Comparaciones y Verbos 2024-01-03

25 Items: bestsnackworstto dieas...asto tasteto servelike; asto choosemore...thanless...thanto recommendthe most (m)the most (f)the best (m)the best (f)to taste likethe worst (m)the worst (f)to order (food)the youngest (m)the youngest (f)as much/many...asmore than (number)fewer than (number)

Thanksgiving 2025-10-10

86 Items: HamPieRestFoodOvenMilkSnowColdMealMeatHomeFullTastyBeansSleepCreamSugarJuiceGamesJokesHappyBreadGravyRoastRollsSauceFeastFamilyTurkeyMoviesTravelParadeNapkinDishesPlatesLeavesApplesPrayerAutumnDinnerSquashEatingCorncobOrangesCookingHolidayKitchenPopcornCookiesFriendsGibletsHarvestTogetherStuffingFootballPotatoesThankfulPilgrimsShoppingCrockpot...

All About Mr. Ross 2025-08-22

18 Items: My CollegeMy Son's NameMy Food AllergyMy Hidden TalentMy Favorite ColorMy Childhood FearMy Daughter's NameMy Favorite SeasonMy Hogwart's HouseMy College ActivityMy Favorite DessertMy Favorite Thing on TVMy Favorite Sport's TeamMy Favorite Game to PlayMy Favorite Kind of BookMy Favorite Sport to PlayMy Favorite Thing To Drink...

Penny Word Search 2025-12-18

18 Items: BabyOne cent coinA sweet treatEating outsideSinging snowmanAttractive metalSnakes and lizardsAntonym of outsideSmall hopping animalNot pay attention toBlood-sucking monsterRun away and get freeAnother word for a bugBreakfast food with syrupSmile to show this feelingSmall hopping animal, again!Sport with a fuzzy, yellow ball...

E2 C1 2024-09-04

30 Items: foodweekmusicMondayFridaySundayTuesdayto makeusuallyweekendThursdaySaturdaytomorroweverydayWednesdayyesterdaylast yearI'm sorrylast, pastuntil(time)from (time)this, comingThat's rightto play gamesto take a walk좋아요! All good!to listen, to hearto surf the internet요일이에요? What day is it?요일 what day of the week

Ꮷꮃꮝꭹ Word Search 2025-06-06

38 Items: potpanjaricetealidforkfoodbowlknifestovetongsflamemixerplatespoonshelfchairwaterembersfridgedrinkscoffeeladderspatulacup/mugcabinetcounterfreezerdrawersglass/cuptrash bagkitchen sinksliced breadcutting boardᎦᏟᏗ trash canᎦᏍᎩᎶ kitchen tablesmall ladder/step ladder

Christmas 2025 2025-12-24

84 Items: BenIkeDreChadWillTitoLukeFarmcowsBlueGarybowsfoodpiescornEmilyAidenHayesMilouPoppyBriarLillysantagiftsTexascandyMusicchipsLaurenAudreyNonnieLouLouLaineyGarnerRuthieAmandaLouannaggiesEggnogribbonfamilysweetscheeseLoreleiGrandadBarbarabrisketfriendsnotcoldtugowarornamentstockingnewyearsDecemberdessertsdiamondgsweetteanoturkeyUncledrewChristmas...

Vocab List 3A 2023-12-05

32 Items: TeaMilkWithWaterNeverRightCheeseCoffeeTo EatAlwaysI LoveI LikeWithoutLemonadeIced TeaTo DrinkTo ShareEverydayYou LoveYou LikeOf CourseHow AwfulSoft DrinkFood, MealApple JuiceWhich, WhatOrange JuiceMore or LessTo UnderstandVegetable SoupDrink, BeverageHam And Cheese Sandwich

Day of the Dead Spanish Vocabulary 2025-11-10

31 Items: tombmaskarchsaltfoodangelbibleskullcrossaltarwaterfruitflowerscandlesincensemarigoldskeletonofferingdead breadsugar skullsspirit guidespicture/photoflower petalsday of the deadcoffin or casketwhimsical skeletondecorated cut papermonarch butterfliescemetery or graveyardface of day of the deadday of the little angels

ie Wordsearch 2025-07-23

10 Items: I am potato fried.The bird ______ with wings.The _________ are like a cop.She _________ her shoe laces.The baby ___________ for food.He ________ the new ice cream.The apple _________ was sweet.You roll this in ludo to play.The clothes outside are _______?What happens when you put nuggets in hot oil?

Unit 2 Week 1 Vocabulary Review 2025-09-29

10 Items: very easily brokenset of connected thingscategorized or grouped withget, take, or obtain (have)shape or outline of something;enough for a particular purposesomeone or something that protectsan animal hunted by others for foodshort, stiff hair of an animal or plantstay alive; live through a dangerous events

Matthew's Suffix wordsearch 2025-10-07

10 Items: Someone who makes food.People who shear sheep.People who support someone.Someone who hikes on trails.Someone who tortures people.A type of common eating fish.Someone who runs a Management.Someone who kills lots of people.An entertainer in a medieval king's courtA Christmas ornament used to break nut shells.

My love <3 2026-01-29

10 Items: An artist you likeFirst amusement parkMy favorite fast foodFirst movie we watchedYour favorite game to playWhere we had our first kissSomething I always ask to doThe game we always play togetherThe amount of kids you really wantSomething you're always eating on ft

5th day halool 2025-04-29

6 Items: food type you lovea city gathered youattribute in her ( she always help you)nice place you’ve been to together in jordansomething you learned together during university (work)relationship for years - (sisterhood/ work colleagues/ .. etc.)

Search the words related to food 2022-12-20

5 Items: fishricesoupmilkdates

trs23 ver2 u9 2022-11-04

8 Items: baby cata big plantput ice cream in itwhen your body feels badsmall amount of food to eatit's green and lives near waterlives in the ground, birds eat itwhat we say when a question is easy to answer

Halloween/Fall Word Search 2025-09-24

7 Items: white/clear scary creaturea part of the body, a bonenature thing that's on treesActivity you do on Halloweenholiday where you get to dress upfood item commonly flavored in fall drinksBird commonly associated with fall/Halloween

Connect Word Search 2025-09-09

10 Items: Too much energyAll the same kindAn exaggerated statementTo join two things togetherCommunicating without wordsMade of different parts or kindsWriting that is true, not made upOrganism that eats others for foodPerson who leads an orchestra or trainWords that sound alike but mean different things

Autumn Word Search 2025-11-24

11 Items: YummyFalls off treesAnother word for AutumnThe 11th month of the yearA sauce that goes on turkeyPopular Thanksgiving side dishMost popular food for ThanksgivingMost popular dessert for ThanksgivingHoliday where you express your gratitudeDecoration for holloween, also a pie ingredientType of nuts most commonly associated with Autumn

Valentine's Puzzle 2026-01-24

10 Items: Your favorite foodYour favorite drinkWhat do I call you?Your favorite animalYour favorite flowerYou love these with buldakA place where you fought a warA place we shared many glances everydayYour answer to "Will you be my Valentine"The month we first met in the train tracks

Eukaryote Word Search 2025-03-24

14 Items: organisms made up of many cellsorganisms made of only one cellTiny, hairlike parts that help a protist move.Paramecium is a unicellular ciliated protozoan.A long, hairlike part that protists use to move.protist that moves by a flagellum, known for its eyespot.A cell that contains a nucleus and membrane bound organelles...

feqn fkjq 2025-04-11

2 Items: "caught.""mystery", "abuse", "blackmail", "food", "youtube", "awareness", "tzuyang", "reality"

The Main Shops 2023-05-27

7 Items: Where you store your FPDKeeping those pups cleanIf your dog is hungry, shop hereShopping for some training areas?Pick up the collars and leashes hereThe better alternative to your shoesOnly available if you’re past level 20

7th grade Landon 2024-05-15

15 Items: waterenergypumps bloodbone in forearmfights infectionmakes plants greenholds the cells dnahow plants make food4 sections in the heartwhen water turns into a gasmakes up most of the atmospherelooks like cotton candy in the skythin walls that blood travels throughdeoxygenated blood travels through thistakes one minute to travel through the body

Date Day 2025-09-08

15 Items: Winter sportFemale cowboyComes after 6Favorite FoodOur youngest dogWhat do horses eatMonth you were bornFavorite summer sportMonth of our first dateTip of Baxter's tail is..Where are we going SaturdayLive music with lots of peopleIf you have no heart, you are..Years we've been together in JanuaryWhere is football played in Edmonton

Drag Word Search 2024-09-27

11 Items: ENERGYWHAT WE ARE STUDYINGDRAG IS INCREASED BY AWHAT A PARACHUTE INCREASESSIMPLE AND COMPLEX __________A TASTY FOOD THAT BREAKS EASILYA SYSTEM OF PARTS WORKING TOGETHERKNOWLEDGE USED TO ASSIST EVERYDAY LIFEA TYPE OF ENGINEERING THAT REQUIRES GEARSA TYPE OF ENGINEERING THAT REQUIRES WIRESA TYPE OF ENGINEERING THAT REQUIRES BUILDINGS

Nutrition Unit 2024-12-16

11 Items: our fatsLack of Ironunsaturated fats -> saturatedthe starches and sugars in foodsticks to walls of arteries (bad)Indigestible complex carbohydratesAbsorbed, Transported, and Stored in FatSolid @ room temperature; risk of diseasesubstances from environment body cant makeDissolved in water and aren't stored in body...

How well do you know us? 2025-10-20

12 Items: Melvin's CCA in JCJiamin’s favourite foodJiamin's favourite colourJiamin’s Major in UniversityLocation of their first datePre-wedding photoshoot countryAnime that Melvin still watchesMelvin's most listened Chinese singerJiamin attends these classes regularlyJiamin’s dream destination in AustraliaCountry that they went canyoneering together...

A Word Search 2025-09-19

5 Items: move your body with musicyou can listen to and enjoy.food outside in a park or garden.look at words in a book or story.sport with a bat, a ball, and bases.

LOS QUEHACERES SOPA DE LETRAS 2024-02-29

17 Items: to cookto dustto vacuumto mow the lawnto make the bedto set the tableto do the laundryto sweep the floorto wash the dishesto clean the houseto clear the tableto iron the clothesto prepare the foodto take the trash outto dust the furnitureto get something dirtyto neaten; to straighten up

Bed Word Search 2025-06-26

12 Items: The object where you sleep.An object where you can see yourself.The part of a house that you step on.An object that you use to iluminate darkness.A place where you can stand up and wash yourself.An object where you put your food to preserve it.The place of the house where you can cook your food....

Sustainable Development Goals 2025-11-05

17 Items: People should have good jobs and fair pay.Protect the Earth by fighting climate change.Protect forests, animals, and plants on land.All people should have healthy food every day.Use and reuse things carefully to reduce waste.Keep the seas clean and protect marine animals.Everyone should have clean water and safe toilets....

Blue Word Search 2024-06-16

15 Items: love languagehow many kidsfavorite foodfavorite colormy biggest fearapology languagehow to keep trustmy five year planfavorite dead yearmy favorite part about youmy favorite memory with youhow can you better support mehow have you benefited my lifemy idea of a successful relationshipmy one non-breakable relationship rule for you

lugares do mundo 2024-08-06

15 Items: tem camalá pro suluma moeda aigrosso é grossotem em um anime aiproduto de limpezaum lugar de são paulonome de data especialuma cidade de portugalcomida com batata palhafast food com nome de pessoaestadio maneramente desconhecidodos laranjais um parque bem legalnacionalidade de um jogador conhecidode pelotras yime da serie não vou falar

Chapter 8 The Flow of Food Preparation 2026-01-30

6 Items: cookingStorageVariableslackingMicrowaveSmallbatches

Trust God Instead of Complaining 2026-01-30

18 Items: catlionzebrahippoelephantMan's best friendGod’s chosen leaderDoing what God saysFood God sent from heavenWhat Moses struck in angerWhat God gave from the rockThankful for what God givesWaiting without complainingWhat God does for His peopleThe one we should always trustRelying on God instead of worryingBirds God provided for the people to eat...

Roblox Games Word Search 2024-02-26

30 Items: FPSTrainsR6 FPSMysteryFood SimSurvivalGraffiti... CreedBig HandsSpeed SimBig Hero 6Voice ChatRepetitionBad TeacherGun CampersRoblox MeccaStrength SimKill ZombiesFootball TeamClick to RaceTown Role-playUnlimited AmmoTable RouletteHere "Eye" ComeRoblox FortniteTown in WisconsinFairy Tale School25 Robux to AccessRoblox Phasmophobia...

Ashly OO 2024-05-09

20 Items: Tom’s eye colorTom’s star signAshley’s eye colorAshley’s star signFavorite gas stationTom’s favorite candyTom’s Favorite ColorTom’s favorite movieCouple's work industryAshley’s favorite candyAshley’s favorite ColorAshley’s favorite MovieTom’s favorite sports teamCouple's favorite TV seriesCouple's favorite board gameCouple's favorite restaurant...

Cat Word Search 2025-04-23

93 Items: meonupcatcardogyouourboymanmenmapdrywetbigredonetwosixprogodlionleftrocktheythemleftgirlballlockwordreadwallfoodbluegraydarkpinkgoldtimefoursickfarmnoobnosedumbcuteuglycarlshoedoorzebrahippohouserightclosewhiteblacktabelrightwomenwatermousecabelcleandirtyworldwritetoolsfloorphonelargebrownlightgreencrazyclockthreefriendbottomengineyellowpurple...

Wortsuchsel 7.2 2025-05-11

33 Items: sourfiberveganmousesaltysweetscreenbitteruniqueheartycrispydreamyProteinProteincrunchyto typearomaticgluten freeplant-basedunsweetenedto downloadlactose freelow in sugarsuitable forhigh in fiberhigh in proteinfood intolerancetender, delicatesource of proteintempting, enticingfine, fancy, refinedexquisite, magnificentto have a high ____content

INTRO and UNIT 1 OCTOBER 2025-10-08

20 Items: ViajeCollarEsquinaPulseraNubladoRotonda.PendientesParque infantilHacer ejercicioEn el extranjero.Plaza mayor (two words).A place where money is kept.You use it to cross a river.Hacer turismo / ver monumentosA place where products are made.The room where you have a shower.Patinaje sobre hielo (two words).To go for a walk in the mountains....

THANKSGIVING 2025-11-03

89 Items: FUNJAMTEDCODYCORNCOZYEMMAFALLFOODLOVENAPSOVENPIESSALTGAMESGRAVYHAPPYLAUGHPATTIPECANPEPSIROLLSSALADSALADSMILESTOVEWINDYAPPLESAPRONSAUTUMNBAKINGBUTTERCARSONCOLTERDINNERDRINKSEATINGFAMILYGOBBLELEAVESPARADEPEPPERSPICESTRAVELTURKEYWADDLEAMERICACARROTSCOOKINGDESSERTENGLANDFRIENDSGOBLETSNAPKINSNATIVESPUMPKINSQUANTOSTUFFEDCHERISSEFATPANTSFOOTBALLGRATEFUL...

The Hardest Burkina Faso Word Search In The World! 2025-11-21

88 Items: AidAidAridFoodWASHHandDamsNGOsHopeWellsPeacechangeHealthGenderUNICEFM.S.F.AccessPolicyFutureGlobalCrisisActionDroughtPovertyWeatherDiseaseCholeraTyphoidHygieneFundingStorageJusticeUrgencyScarcityRainfallConflictSurvivalAdvocacyDrillingSecurityCapacityTrainingProgressMortalityLivestockMigrationEducationSufferingResponsesTreatmentCommunityEmergency...

Big Soo Word Search 2026-01-25

89 Items: FUNTMAEATKFCIVYROBMACLIVFOODBOGOGOLFFREEDEALPLAYKINGSUZYLOCALVALUESHAREBONUSKRAFTBRYANANGIERILEYDARINBIGSOOWENDYSREDEEMCOUPONIMPACTSUBWAYDININGBUDGETRETAILTHRIFTGETNGOJAYDENSAVINGSCHARITYCARWASHVENDORSAUSTADSDOWNTOWNBARGAINSSAVERSOOCINNABONSERVICESBOUTIQUEGIVEBACKMINERVASPIZZAINNSHOPPINGBENIFITSVALHALLADUTCHESSROLLINPINFALLSPARKLEWISDRUGBROOKINGS...

My House 2026-03-01

12 Items: An instrument used to measure and show the time.A device used to talk to people who are far away.An electrical device that blows hot air to dry hair.A motorized appliance used for cleaning clothes and linens.An electrical device that sucks up dust and dirt from floors.A small appliance that browns slices of bread using radiant heat....

Michelle and Dominic 2024-09-30

36 Items: Who is olderBride’s eye colorGroom’s eye colorWho is the best manBride’s birth monthGroom’s birth monthGroom’s middle nameBride’s middle nameGroom’s favorite foodBride’s favorite foodBride’s favorite movieGroom’s favorite movieBride’s favorite actorBride's favorite colorGroom’s favorite colorGroom’s drink of choiceBride’s drink of choice...

Wake Word Search 2025-07-29

8 Items: to put on clothesto chew and swallow foodto put things into a bagto move by using your feetto clean your teeth or hairto rest with your eyes closedto stop sleeping and open your eyesto use water to make something clean

MI 2024-09-20

5 Items: Notify the nurse _____Do not give the person _____ or LiquidPatients describe MI's as a "sense of ____"A heart attack occurs when blood vessels are _____A Myocardial Infarction is also known as a _____ _____.

Writing 1 2022-11-01

21 Items: lay eggssays meowsays woofgives woolmakes milkuses a saddlesells you foodsells you foodhas a curly tailroars with a maneworks on the farmworks in a schoolis a famous pokemonlives in a pineapplewiggles on the groundmakes you feel betterhas feathers and fliesdrives a big red engineprotects your neighborhoodtakes care of you in hospital...

Anything 2023-05-01

90 Items: nobadputnotlothimcarnewmenratwhatnavybluedealleftshotkissnopehavebeencookbearfoodfacttimetextsoftcoolkidsrankkickcurbtreebabycribdarecashholegivekitehighshingirltherepeaceworldnightjuicerightchiefgrosssadlyblasthousemoneypitchfloorshifttodaycoffeecamerapleasechoicegigglediscusrecordsaddlebottomalwayscottoninlinepayinghandlebrokenscreamschoolcorrect...

Jennifer and David 2024-01-21

20 Items: Where they metDavid’s Best ManJen’s first wordDavid’s middle nameJen’s favorite colorJen’s birthday monthJen’s favorite flowerJen’s Matron of HonorDavid’s favorite foodWhere they got engagedDavid’s birthday monthDavid’s favorite colorJen’s first pet’s nameDavid’s favorite candyJen’s favorite dessertDavid’s favorite drinkDavid’s favorite animal...

WEDDING 2024-02-01

90 Items: joytiebeercakefoodjeepkisslovesuitveilvowswifewineblissbridedancedressgroommusicringstacostoastunionunityvenuecheersfamilyhikingpippinvikingbestmanbouquetcampingcandlescherishcookingcrochetdiamondflowersforeverfriendshibachihusbandpackerspromiseraleighromancetolkienweddingceremonycolumbiaeternitygreenbaylaughtermarriagemarylandmemoriessoulmate...

For Us, Living essentials 2025-05-14

98 Items: BedcarmopTeahomefoodpotspanssofaSoapFansragscombmugscoattapepensgluewaterstovebowlstablebroombrushRazorPhoneBroomknifebowlswhiskladleForksShoesleashPlatesbedingvacuumSafetyvacuumspoonsKettlePantrycoffeegloveshammerTreatspettagCollarpetbedsheltershampoodrawersComfortheatersCookingspatulaGlassesToasterBlenderpetFoodHarnesspetToysDishsoapbodywash...

Pobre Ana Ch 1 Vocab 2025-09-04

31 Items: newcookfoodmeatpoorbrownapplemoneynevershirtblondshoesI wantalwaysclotheshelp meto savebeautifula attendss/he takess/he wearss/he laughsfor permissionsuelo the floorshopping centercomas don't eat!pongas Don't put!s/he asks him/hers/he tells him/hers/he gives to him/hers/he gets good grades

Reindeer Games 2025-11-13

95 Items: FunLizAmyBriCDOJoyRedBowTreeSnowFoodMaryGabiZoeyToysColdNoelGoldMilkStarSantaBellsCocoaElvesAngieEvansCarlyHaleyMusicCometCupidVixenMerryAngelPeaceHollyFrostScarfCheerGreenCandyPeaceMusicCarolsLightsDebbieAnkitaWrightCamperTeresaAleenaJoanneBrookeSophieWreathWinterClauseSleighTinselGlovesRibbonCandleEggnogSeasonJaime'eBethanyYasmineLynanneGarland...

Jacob Dretler's Word Search 2015-02-07

93 Items: WeBeItIsAsAmOhTvGoAxUpCanBagMomDadVanCarAntFanHamCatDogHenTheAndDanFigZooHatBenTabWonFoxPotBeeFinRugOffforManLetSadMadWillSockFishWhenSnowSandDuckSackBedsSledWereLegoiPadDirtCrowRockShipDiveShowThatFlatfastFoodRaceEvenLionMadeQuillQuiltTruckAppleStingStickQuackCraneWaterMagicOceanHandyNeedssmilePowerQuestEagleStinkyElevenAlwaysHeroesCarefulGorilla

Daniel & Sylvia 2025-01-26

24 Items: Years togetherPlace they metCouple's hotspotCity they live inWedding officiantDaniel's new hobbyCouple's Dog's nameDaniel's middle nameMaid of Honor's nameSylvia's birth monthMonth Daniel proposedHoneymoon destinationSylvia's middle namesWhere they got engagedSylvia's favorite foodSylvia's favorite drinkCouple's favorite store...

Everyone 2025-02-06

78 Items: OutLeoDewTeaCatsCruzFoodHussKyloYorkNoahCityRicoRustAnimeBooksCyaraGirlsMovieHuskyLibraMoneyPeachPerrySpaceSwiftGamesYoshiAugustBleachBowserCheeseCoffeeCopperCraftsCryptoSlayerHealthLasersIslandMurderPurpleStitchSummerTravelWhalesBitcoinDragonsDrawingOctoberPuzzlesReadingRebeccaRoxanneRunningTibblesAndersonBlanketsBrooklynColombiaColoringDecember...

Spanish Vocab 2025-11-18

31 Items: TombMaskArchSaltFoodAngelBibleSkullCrossAltarWaterFruitFlowersIncenseMarigoldSkeletonOfferingDead BreadSpirit GuidesFlower petalsDay of the deadCoffin or CasketPicture or PhotoVelas or CandelasWhimsical SkeletonCemetary/GraveyardDecorated Cut PaperMonarch ButterfliesDay of Little AngelsFace of Day of the DeadCalavera de Azúcar or Alfeñique

Sheffield Word Search 2025-06-10

28 Items: Amelia’s ageThe Groom’s sisterThe Bride’s brotherThe Bride’s maiden nameThe month they first metThe name of the best manAmelia’s favourite singerFather of the Grooms nameFather of the Brides nameThe Bride’s favourite foodThe Groom’s favourite foodThe Groom’s birthday monthMother of the Groom’s nameMother of the Bride’s name...

Egypt Final Exam : Review Word Search 2026-01-07

20 Items: Long moving water(河流)Sea east of Egypt(红海)Sea north of Egypt(地中海)Extra goods or food(剩余物资)The exchange of goods(贸易)Plants grown for food(农作物)Farm animals like cows(牲畜)Bringing water to farmland(灌溉)Very good soil left by floods(淤泥)A country along the Nile River(埃及)Waterway connecting two seas(苏伊士运河)When a river overflows its banks(洪水)...

T.LE WORD SEARCH 2025-02-02

25 Items: Used To Open CansUsed To Combine IngredientsUsed to Hold foods in placeUsed to separate liquid from solidA long flexible blade with a rounded endGrating cheese meat and other ingredientsComes in various lengthss of 6,8,10, and 12Used To Slice Food More evenly and uniformlyUsed to measure small quantities of ingredients...

Crewe 2025-11-17

13 Items: (The town itself)(The local hospital)(Social and food Hub)(The county Crewe is in)(The main green space/park)(The era when Crewe boomed)(Crewe's main claim to fame)(The luxury car manufacturer)(A key product of Crewe Works)(The large, famous railway hub)(The historic Edwardian theatre)(The historic neighbouring town)...

Spanish Vocab 7 2024-11-21

41 Items: HamTeaEggsMilkWithBreadToastBaconLunchSaladApplePizzaWaterNeverCerealBananaYogurtCookieOrangeCheeseCoffeeTo EatAlwaysRight?SausageHot DogWithoutLemonadeTo DrinkBreakfastHamburgerHow awfulSoft DrinkFood, MealFruit SaladStrawberriesFrench FriesWhich? What?More or LessTo understandDrink/Beverage

Holidays 2025-10-14

90 Items: HamOilNiaSnowFoodTreePineStarHolyCoatColdToysHopeSongsMusicCarolHollyAngelIcingFaithScarfElvesEightUjimaImaniSevenDanceFrozenLightsColorsFrostySeasonWinterChillyEggnogWreathTurkeyFamilyChurchPrayerMoviesSleighSkiingBeanieGlovesGrinchRibbonLatkesUmojiaKinaraUjamaaKuumbaCookiesKwanzaaRudolphMiraclePajamasDreidelIciclesSnowmanSparkleMenorahCandles...

Spanish Vocab 2025-11-15

34 Items: tombMaskArchSaltfoodangleBibleSkullCrossAlterwaterfruitCoffinFlowerscandlescandlesIncenseIncenseskeletoncemeteryOfferingMarigoldsGave yardDead BreadSugar skullSugar Skullspirit GuidesFlower petalsDay of the deadWhimsical skeletonDecorated cut PaperMonarch butterfliesFace of Day of the DeadDays of the little angels

Spanish Vocab 2025-11-20

31 Items: TombMaskArchSaltFoodAngelBibleSkullCrossAltarWaterFruitFlowersIncenseMarigoldSkeletonOfferingDead BreadSpirit GuidesFlower petalsDay of the deadCoffin or CasketPicture or PhotoVelas or CandelasWhimsical SkeletonCemetary/GraveyardDecorated Cut PaperMonarch ButterfliesDay of Little AngelsFace of Day of the DeadCalavera de Azúcar or Alfeñique

Desayuno Word Search 2026-02-19

37 Items: EggHamNowFoodMilkSoupHow?Why?Who?LunchDrinkBreadAppleWhat?otherDinnerCoffeeCerealYogurtCheeseBananaGrapesWhich?To sellTo shareSandwichHorribleBreakfastHamburgerNutritiousOrange juiceIt's importantTo feel like...To be hungry...To be thirsty...For, in order totasty, delicious

Calvin and Maya 2024-09-02

20 Items: Maya’s favorite hobbyCalvin’s favorite hobbyMaya’s favorite food that Calvin cooksCalvin’s favorite baked good Maya makesCalvin and Maya’s next travel destinationMonth of the year that Calvin and Maya metRoom in BHS where Calvin and Maya first metCalvin and Maya’s favorite local restaurantCalvin and Maya’s favorite food to eat together...

Writing 1 2022-11-01

21 Items: lay eggssays meowsays woofgives woolmakes milkuses a saddlesells you foodsells you foodhas a curly tailroars with a maneworks on the farmworks in a schoolis a famous pokemonlives in a pineapplewiggles on the groundmakes you feel betterhas feathers and fliesdrives a big red engineprotects your neighborhoodtakes care of you in hospital...

Happy Word Search 2023-12-26

90 Items: infunseacarjoyartrunhugnewfitgymbigoutflytryyeskissfasthardworkcalmlionfoodtripringcakegiftroarcashkingjokedatemintyearnicesingtaskbeerkeephappyhousebeachluckygreatgrandmoneyrelaxpeacetrustsmartdanceheelsqueencrownlaughsleepsuperloverwaveswrongagiletraveldesignstrongjoyfulmightyleaderfamilyjunglehealthyromanceplayfulamusingloyaltyfreedomjourney...

Beber Word Search 2024-03-13

35 Items: hamwitheggsmilksaladappleneverbreadtoastcoffeecerealto eatcookieI loveI likeorangecheeseto drinkto sharelemonadebreakfastfor lunchhamburgerfood, mealfruit saladapple juicepizza pizzaWhich? What?strawberriesorange juicemore or lessfrench friesto understandfor breakfastdrink/beverage

Epic Extra Credit Word Search 2025-04-03

95 Items: LeaNiaKilaMyraRemyAdynZakeLeanSimsMayoLiloNaniFoodMrExMayeeBrainJamieGrungDividRubynRiderAidunLalanDylenKeeryAydanOhanaJumbaVonnieAverieJunnieAlexesTeeganMerianNickeyJavienUhlenaNesterAdreilKennieTurkeySkyrimStitchHangryGrinchJordunnTiffanyBugbearBigBackJaydenaOooscarEmylenaApollenYelllotJordaanIfeelyaKayonnaGrandpaMrFrankYourMomJonesunShowers...

6th 2025-05-16

25 Items: MoooPrincipalOur mascotClass wingG fav foodbumba ____!yellow+blue=bathroom passMr. G fav teamteach japaneseEsports teacherbaseball champsgoodbye/spanishopposite of downFemale P.E. Coachhot-popular chipsONE security guardTwo security guardteacher 6th glasseshands but can't clapGaytan's other coursehow many tv's in roomClothing on the walls?...

For My Smurfy Ganoush 2024-03-05

16 Items: YouHiiiiiNext stop....For all eternityGood day (German)________ que eresAlways and ForeverRemoval of a pickleYou and Me/Jake and AmyCaptain Holt says to JakeYour favorite crispy friendsYour favorite non food snackTrick-or-treating trickster smurfTrick-or-treating trickster ganoushToby's______ was in the office trash...

Sheffield Word Search 2025-06-10

30 Items: Amelia’s ageThe Groom’s sisterThe Bride’s brotherThe Grooms hometownThe Bride’s hometownThe Bride’s maiden nameThe month they first metThe name of the best manAmelia’s favourite singerFather of the Grooms nameFather of the Brides nameThe Bride’s favourite foodThe Groom’s favourite foodThe Groom’s birthday monthMother of the Groom’s name...

Happy Birthday 2025-09-21

40 Items: Fav Dog.Fav Tea.Fav book.Fav Cake.Fav Fish.Your age.Fav color.Fav Drink.Fav Smell.Fav Series.Fav Prefume.Your Zodiac.Spirit Animal.French for love.You in body this.Your Birth Month.Your birth stone.Your birth flower.Filipino for love.Japanese for love.What you look like.You are this to me.Fav Chocolate Snack.What I think of you....

Zeus Basics 2025-09-10

28 Items: food of the godsruler of the seadrink of the godstitles or nicknamestree sacred to Zeusruler of the underworldLocation of Zeus’ oraclebird associated with Zeusweapon of Zeus, forged by the CyclopesKing of the Gods, the lord over the Skyson of Zeus and Aegina and king of Aeginawas the King of the Titans and father of Zeus...

Stale Word Search 2023-10-04

35 Items: luck or moneyto become more or biggerto think about before doinga big task that is taken onfood that is no longer fresha set way of doing somethingto quickly eat a lot of fooda strong or weak need for foodto cause excitement or pleasurea person who works for a companyto have the skill to do somethinga person who introduces new ideas...

Wedding 2025-02-19

15 Items: Maid of honor's name.Matthew's occupation.Hannah's middle name.The proposal location.Hannah's favorite food.First vacation together.Hannah's favorite holiday.Location of Hannah's bachelorette.The month Hannah & Matthew got engaged.Hannah & Matthew's wedding cake flavor.Hannah & Matthew's favorite restaurant.Hannah & Matthew's favorite sports team....

Birthday Boys Favorites 2026-01-30

16 Items: Favorite month: Jingle bellsFavorite sport: Ready, set, hikeFavorite food: A popular Italian foodFavorite color: The color of the oceanFavorite drink: Regular milk plus pizazzFavorite movie/show: Does Littlefoot ring a bellFavorite season: The season between spring and fallWhat he loves most: The people who care and love him most...