fast food Word Searches

May Word Search 2025-07-22

25 Items: first dateJosh loves thesenumber of niecesJosh's workplacenumber of nephewsMaggie's professionMaggie's Godson's nameMaggie's favorite hobbythe name of Maggie's dogwhere Maggie and Josh metwhere Maggie and Josh worknumber of siblings Josh hasthe name of Maggie's schoolnumber of siblings Maggie hasfood that Maggie and Josh like...

Back to School Crossword Puzzle 2025-08-18

22 Items: The teacher's last nameWhere to place your backpackApp used for class communicationFollow directions the ______ timeThe subject of this class is ______Daily activity at the start of classThe shows materials needed for classBe in your ______ before the bell ringsAssignments must be turned in on ______Points are earned toward a class ______...

Word Search 2025-12-15

20 Items: App for short videosSweet ring-shaped treatSuperhero movie universeSport played with a hoopTakeaway food with toppingsPopular casual or sports shoesPlaying video or computer gamesWhat you hold to play most gamesUsed to listen to music privatelyThe part of a car that makes it runOnline game where users create games...

RileyM200's Song Titles 2025-10-25

30 Items: The TheSatan BoxReal TimesFinally FreedVictory ValetBirthday NamesQuick DecemberKind FriendshipThe Glorious SongGrammar "Gremmer"Everything is GoodaThe Helicopter SpinLocking Up My HeartDid All The Work NowPlease Help Me FocusNo Power, Life PausesAntarctica, the DesertFintry's Food DeletionJelly and Peanut ButterWhy Would You Assume That?...

Yellowstone Word Search 2026-01-24

30 Items: Bride's favorite movieGroom's favorite movieDylan's favorite drinkBride's favorite colorGroom's favorite colorDylan's first employerJessica's favorite actorDylan's favorite actressBride's favorite dessertGroom's favorite dessertJessica's favorite drinkBride's favorite flowersJessica's first employerFavorite song as a couple...

Roller Coasters 2025-04-17

11 Items: any push or pullgravitationalconstantspeeds up, slows down or changes directiona force caused by a rubbing motion between two objecta force that draws any two objects toward one another.a combination of speed and the direction in which an object travels.how fast an object moves. the distance that object travels divided by the time it takes....

A Dog of Flanders pgs. 73-79 2023-09-11

20 Items: What is the miller's name?Who were they paintings of?I have been ______ to that boy.Let's lie down _______ and die.What did Patrasche do at dinner?Who should have won the contest?Who did Nello draw in his drawing?Who wouldn't eat any food at dinner?Where in Antwerp did Patrasche go to?The boy and the dog then fell ______....

913's Quiz for Annie 2025-04-27

20 Items: 大學的社團(8)喜歡的季節(6)喜歡的口味(6)當助教的科目(8)近期愛戴的(11)想從事的職業(7)喜歡喝的飲料(6)收集的物品(11)正在學的語言(6)想買的汽車品牌(8)近期喜歡的顏色(5)想養的寵物品種(7)最近想嘗試的酒(7)期待考過的證照(3)大學讀的科系(27)近期愛的衣服種類(5)最近想買的物品(17)天氣好會做的事(15)最近想花錢用的app(7)favorite food 麥當勞(11)

Ahola Word Search 2025-10-23

34 Items: Remy's MomEnjoys animeFormer bikerMrs. MuffinsWorked at IBMFormer teacherLoves year end!Really likes catsHas an orange catOwns a food truckObsessed with golfDie hard Disney fanHer son attends JCUEnjoys highland cowsLoves to go to playsFather-Daughter teamUsed to be a stylistOwns a yellow MustangAhola's resident bakerRuns 5ks with his wife...

Vacay 2026-01-25

161 Items: napspafoodmaskpoolrobesandbeachgrilllobbyoceanphonescarfshoessockstowelvillaankletbrunchcameradaybeddiningharborislandjetlaglagoonlaptoploungeluxurymarinamiddaymirrorresortshoressiestasunsettabletwetbagarrivalbalconycuisinedaypassfirepitgetawayhammockhorizonjacuzzijournalleisurelipbalmmassagemorningretreatsceneryseasideseaviewsunriseterracebackdrop...

Cricket 2025-09-14

20 Items: Indian captain known as “Dada”West Indian batting great known as “Viv”Famous cricket ground in Perth, AustraliaNickname of Tendulkar, India’s “Little Master”Australian batsman with a career average of 99.94Leeds ground famous for Ian Botham’s heroics in 1981Family name of Australian Test captains Ian and Greg...

Unit 4 Key Terms (Question/Answer Style) 2025-11-04

20 Items: Strain or straining force.Changing from a liquid to a vapor or gas.An interacting group of living individuals.The shortage or absence of something essential.An organism that is capable of making its own food by photosynthesis.The act, art, or manner of managing or handling; controlling or directing....

Vocabulary Review: Units 6 & 7 2025-11-15

22 Items: a score of zero in sportsa machine that makes a room warma long stick used in golf to hit the balla cold cupboard that keeps food and drinks fresha machine that moves air to make a room feel coolera small machine that heats and browns slices of breada machine that washes plates, glasses, and cutlery for you...

La comida 2026-01-08

35 Items: Sinónimo (synonym) de zumo.Toda la comida del mar (sea).Té frío con mucho hielo (ice).¿Cómo se dice "to eat dinner"?Mi tía llora cuando ella pica _____.Sinónimo (synonym) de sabroso y rico.El guacamole es hecho (made) con _____.Para hacer un omelet necesitamos _____.A la chica le gustan las _____ coladas.Las personas vegetarianas no comen _____....

Anatomy & Physiology: I 2026-02-12

27 Items: Also know as inhalationResponse of tissue to injurySuperior portion of the hip boneLoss of ability to control micturitionInsufficient blood flow to the tissuesPosteroinferior portion of the hip boneEntire life cycle of a cell, excluding mitosisPlant polysaccharide injected to determine GFRTaking food into the GI tract through the mouth...

Canadian cities 2025-06-14

28 Items: - Retirement paradise where gardens bloom and wallets empty- Car manufacturing town that puts wheels on Canadian dreams- Medieval fortress city that somehow ended up in North America- Cottage country gateway where city folk pretend to be outdoorsy- The center of the universe, according to everyone who lives there...

Child Rights Word Search 2024-11-15

15 Items: A safe place to live and grow.Being free from danger and fear.Children must be kept safe from harm.Every child should feel valued and respected.Every child deserves to go to school and learn.A loving group to care for and support children.Treating every child with kindness and fairness.The right to be cared for and live a healthy life....

Chemistry, Physics, Energy Concepts 2023-06-01

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

How to Survive a Tornado 2024-10-08

13 Items: The shape of a tornadoAnother word for a tornadoWhat can a tornado sound likeWhere should you go to survive a tornado?what type of air can be a sign of a tornadoWhat is the name of the tornado we talked aboutif stuck outside, where is the safest place to hideThe most important thing to focus on during a tornado...

Personal Protective Equipment 2025-12-29

13 Items: Safety is everyone's responsibilityProtect your head from unwanted bumps.Shield your hands from cuts, burns, and hazardsHigh visibility saves lives; be seen to be safe.Guard your face; keep the air you breathe cleaner.Prevents the hair from falling onto your food, ewww.Wear them now, or later you’ll be asking “HUH? WHAT?!”...

Ancient Egypt Word Search 2025-09-02

18 Items: very oldmany godsPeople who come from Egyptplanting seeds in the fielda sticky glue found inside plantsA rich or special group of peopleA group of people living togetherto stop something from going rottencollecting ripe food from the fieldsa place where a dead person is buriedgood for growing many plants and crops...

Jesus' Miracles 2026-03-08

14 Items: (See #7)(See #10)The Son of GodJesus raised the young man from the ___________________.Jesus ___________________ many people who were feeling ill.An unusual or wonderful event that is caused by the power of God.Jesus often made people who were ___________________ feel well again....

Environmental Science 2025-05-15

20 Items: ALBEDOTRAGEDYCONVECTIONCORALREEFSBIODIVERSITYWater that is safe to drinkCost-benefit analysis involves ___ assessmentDeepwater ___ spill made front page news in 2010Storing rainwater is one method to ___ freshwaterthe transfer of energy as heat through a materialLakes that create an abundance of nutrients are __...

Halloween Fun 2025-10-09

19 Items: Undead bloodsuckerSpirits from the beyondThis is the witching hourCreatures in The Walking DeadBoard game that tells fortunesThis song is a graveyard smashA large pot for brewing potionsThe author of The Tale Tell HeartA raven's quote or school for WednesdayThese creatures transform at the full moonThe most prolific horror author of our time...

Logan 2024-04-23

1 Item: dogs sports cars waffles pizza pancake pineapple watermelon cats

._. = number of letters in answer 2025-05-07

31 Items: .5. not old.4. not slow.5. not clean.4. place to sit.3. covers a dog.7. not backward.8. sibling of son.5. knuckle sandwich.6. mother and ______.6. eight legged freak.5. sport to sprint in.8. take to feel better.5. when it's not tight.4. doesn't cost any money.7. talking really quietly.4. inside a light or a lamp.4. good ____; chicken noodle...

Posties Dec 18 - Big Read 2023-11-24

6 Items: another word for "rubbish"knives, forks and spoons, used for eating and serving foodable to be decomposed by bacteria, so that it doesn't pollute the environmentto be unable to breathe because the passage to one's lungs is blocked by somethinga sea creature with a body like jelly and long thin parts called tentacles that can give a sharp sting...

3. In the Sea 2024-08-14

1 Item: dolphin pkay swim fast three crab eat seaweed octopus eight arm crawl into dark cave starfish bottom like star

Dialogue: Word Search 2023-10-04

6 Items: ‘Chef’ and ‘Cook’ both words mean someone who prepares food.clause what do you mean when you wrote: “You got home and.”When a teacher and student are talking about his or her homework.A country with no laws and people can do what they want to do whenever they want to....

Dialogue Word Search 2023-10-05

6 Items: What do you mean when you wrote: “You got home and.”‘Chef’ and ‘Cook’ both words mean someone who prepares food.When a teacher and student are talking about his or her homework.A new classmate is very positive and seems to want to help people.A country with no laws and people can do what they want to do whenever they want to....

Chemistry, Physics, Energy Concepts 2023-05-30

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

Logistics Luck: A Leprechaun’s Shipping Puzzle 2025-03-13

21 Items: – If you know, you know 📦💨– The fancy fast way to ship stuff ✈️– Giant floating metal box of commerce 🚢– Work From Home = Pajamas + Zoom calls! 🏠💻– Freight forwarding meets Korean machinery 🌏International – The MVP of freight forwarding 🏆– Where deals happen and paperwork multiplies 📑– Sounds important, must be logistics-related 🤔...

Beauty and the Beast pgs. 14-19 2023-10-11

18 Items: Who came to Beauty's dream?Where did the horse go to eat?What can she see in the mirror?Where did they find food inside?What were the cupboards full of?Who did the Beast walk right up to?When does her father need to leave?What animal did the Beast look like?What was everywhere in Beauty's room?Who found the way to the Beast's palace?...

Pet Parade ( Cute and cuddly animals kids adore ) 2025-05-02

5 Items: Puppy: A young dog that loves to play, run, and wag its tail with joy.Kitten: A baby cat that is soft, playful, and loves to chase yarn or toys.Hamster: A small furry pet that runs on wheels and stores food in its cheeks.Turtle: A slow-moving animal with a hard shell that can hide its head and legs inside....

Structure and Function of Plants 2023-12-05

9 Items: _______ help plants get what they need.The part of the plant that makes most of its food.Which plant part plays the biggest role in supporting the plant?Flowers contain structures that are responsible for _____________.An adaptation used by cactus to survive in a hot, dry environment is ________ ________....

Finding secret animals 2025-11-11

9 Items: Man's best friendDied and came back to lifeUsed to skateboard in the 90's but now he's too oldA helpful animal with a shiny bald head and kind eyesMan's second best friend who's honestly just using him for foodKind of like a kite but it lives underwater and killed Steve Irwin...

Dogs 2024-11-05

10 Items: What item is a chewy treat often given as a reward?What is commonly used to keep a dog from wandering off?What round object do dogs enjoy chasing and retrieving?What is a favorite outdoor activity for energetic dogs?What does a dog wear that has their identification on it?What is the loud noise dogs make to communicate or alert?...

WHI.1 Vocabulary Practice 2025-05-24

15 Items: more than necessary ________________________way of life of a society _____________________skilled craftspeople __________________________also known as the New Stone Age ______________________________also known as the Old Stone Age ______________________________way of life characterized by little movement _______________________________...

Dribbles Word Search 2026-01-19

15 Items: Stretched all the way out.In a way that is angry or unkind.In a careful way to not get hurt.Water ____ slowly from the faucet.Things that make a good combination.A person you know, but not very well.Signed up or officially written down.The sad, poorly dog had been _____ by his owner.Choosing carefully instead of picking everything....

my words 2025-10-07

1 Item: have mad fast ask hat bat has grass snap last rake face make came whale gate same page made name

Spelling & Vocabulary Wk. 10 2025-10-14

10 Items: every person.situated directly below something elsetake place; occur; find or come across by chance.almost certainly; as far as one knows or can tell.in spite of the fact that; even though; however; but.become fully aware of (something) as a fact; understand clearly.(noun)the liquid that comes from meat or other food when cooked....

Where We Live 2023-04-18

15 Items: costing a lot of moneysomeone who owns somethinga musical instrument with stringsto go to live in a different placesomeone who you invite to your homea small house, usually in the countrya machine that you use to dry your hairto have or use something with another personthe part of land by your house where you grow plants...

Good Deeds 2025-09-10

10 Items: Not a single person; no person at all.All the people in a group are included.When we mean any person at all, no matter who.Any object, idea, or action without being specificDescribes a place that is clean, neat, and well organised.An organisation or activity that helps poor or needy people....

ANI MY QARA Week - Crossword Puzzle Challenge 2025-11-11

10 Items: Who is responsible for quality?Which country does ANI MY distribute its products?What is theme of Quality and Regulatory Week of 2025?What product is NOT under the scope of Malaysia Milk Code?Abbott Quality Policy - My commitment to Quality changes________.What is the local Ministry that regulate Food safety and quality program?...

Ant Word Search 2025-11-22

10 Items: - A home where bees live together.- A place some insects build to keep their eggs safe.- A small creature like an insect that crawls or flies.- An insect like a butterfly but usually seen at night.- A tiny insect that lives in groups and works together to find food.- A small insect with two wings that can move quickly through the air....

Skylar P. Halloween Crossword Puzzle 2024-10-31

15 Items: The season after springWhat protects your brainCommonly worn at a masquerade partyThe creation of spider to catch foodAll that we have left after a body rotsUsually seen with a broom and a cauldronThis is usually associated with werewolfsThe place where dead loved ones are buriedThe day after all Hallow's Eve in Catholicism...

WHI.1 Vocabulary Practice 2025-05-25

15 Items: more than necessary ___________________skilled craftspeople __________________way of life of a society ____________________also known as the New Stone Age ____________________also known as the Old Stone Age _________________________way of life characterized by little movement _________________...

Olentangy Model UN Word Search 2026-02-16

17 Items: Most Popular UK FoodClosest US State to AfricaLargest country in the worldWhat is the capital of Jamaica?Number of months an Ethiopian year hasWhat is the largest desert in the world?Which country is also called The Netherlands?What country does the Rhine River run through?What is the least spoken language in the world?...

Life Science 2025-03-25

1 Item: Trait, Instinct, learned behavior, Producer, consumer, decomposer, ecosystem, food web, food chain, adaptation, structure, function, desert, savannah, forest, ocean, arctic, apex predator, consume, fungi, sunlight, plants, people, animals, organism, offs

Age of Discovery 2026-01-12

18 Items: The Spanish word for conquerorTo sail all the way around the world.An instrument for measuring time at sea.A movement to spread Catholicism in SpainA strip of land that connects two larger landsPeople who trade, buy, and sell to earn a living.A small, fast Spanish or Portuguese sailing ship.A tool that measures the positions of the stars or sun....

Encuentra las palabras 2025-08-08

1 Item: steeet Food, cheese, bacon, Wings, sabor paralelo, New York, caprichosa, cariñosa

Do you like to eat? All the french words are related to food.  2021-10-31

5 Items: poirebananefraisecitronchocolat

DOLCH All Levels 2026-01-30

219 Items: goinisitmemytoupweamAtbedohenoonsoanasbyoforusifandbigcanfornotoneredrunseethetwoyouallareatebutdideatforgetnewnowouroutransawsayshetoowaswhoyesanyaskflyhadhasherhimhishowletmayoldputbuyitsoffsitusewhycutfargothotownsixtentryawaybluecomedownfindhelpherejumplookmakeplaysaidcamegoodhaveintolikemustridesoonthattheythiswantwellwentwhatwillwithfromgive...

Food Word Search 2023-09-08

1 Item: chain, consumer, producer, fungi, decomposer, composter, engineer, inventor, invention, innovation, food web, water cycle, matter, solid, liquid, gas, states of matter, changes of state, design process, condensation, evaporation, precipitation, Earth, sea

Transport 2026-02-16

25 Items: – A flying vehicle with wings.– A very large boat for oceans.– A two-wheeled vehicle you pedal.– A strong car used on rough roads.– A vehicle that travels into space.– An underground train in a big city.– A car you pay to take you somewhere.– A long vehicle that travels on rails.– A small vehicle that travels on water....

CFA Review 2025-12-14

17 Items: Earth’s ____________ causes seasonsstored energy is _______________ energyenergy of motion is _____________ energy______________ energy stored in food, fuel, or batteriesa ________________ wave where particles move up and downa _____________ wave where particles move back and fortha _______________ element is a poor conductor and often dull...

Thanksgiving Wordsearch 2024-10-25

181 Items: HamJamYamBunsCareCookCornDineDuckFallFishFoodFullHopeHugsKaleLoveMealMeatNutsOvenPotsSailStirTrayAcornAromaBasteBeansBisonBreadCarveCaterCropsFeastFloatGooseGourdGravyKayakPeacePecanPrideRoastRollsRootsSaladSauceServeTastyTotemTripsAutumnBakingClovesCrowdsFamilyGatherGivingGobbleGuestsHearthInviteJoyfulKissesLeavesNapkinNutmegOnionsParadePotato...

Pathophysiology Word Search 2024-11-10

20 Items: Having ketones in urineMucous lining of eyelidsHigh blood glucose levelspace between lens and retina of eyeReceptors stimulated by mechanical forceInflammation or infection of the middle earReceptors stimulated by change in temperatureAutoimmune destruction of beta cells in pancreasDeficit in growth hormone production and release...

Echoes of Honor – Castles & Classes WORD SEARCH 2025-04-24

171 Items: BOTHCAREFARMFOODGATEGAVEGIVEGROWHARDHAVEHELDHEREHILLHOSTKINDKINGLANDLIFELIKELIVELUTEMADEMANYMAZEMOATMOREMOSTPASTPLAYPOORRICERULETAKETELLTHANTHEMTRAPTRUEWELLWEREWIDEWITHWOODWORKABOUTARROWBRAVEBUILTCODESDANCEDOORSENJOYEVERYFEASTGAMESGIANTHONORJAPANLABORLATINLEARNLORDSLOYALMUSICNOBLEODORIPOWERRIGHTROYALRULESSLITSSPEAKSTONESWORDTHEIRTHICKTHOSETRUTH...

Puzzle Word Search 2025-11-13

22 Items: The gas we breatheA vast body of salt water.A mountain that erupts lava.An event with music and food.Often called man's best friendA person who travels in space.A colorful arc seen after rain.A place where you can find art.A sea creature with eight arms.The largest animal living on landA place full of books for reading....

rjdj 2026-02-26

72 Items: PieBeerCakeSodaBaconCandyDoughFriesGyrosKebabM&M'sOreosPizzaTacosBurgerCrispsCerealDonutsEclairNachosSmoresYodelsCupcakeCookiesHot DogNuggetsNutellaPopcornPretzelPo' BoyWafflesBrowniesIced TeaLollipopPancakesSausagesTwinkiesYule LogBurritos)Chow MeinChocolateIce CreamMargarineMilkshakePastries)Pop TartsEnchiladasFried FoodRocky RoadSandwiches...

hi 2026-02-26

72 Items: PieBeerCakeSodaBaconCandyDoughFriesGyrosKebabM&M'sOreosPizzaTacosBurgerCrispsCerealDonutsEclairNachosSmoresYodelsCupcakeCookiesHot DogNuggetsNutellaPopcornPretzelPo' BoyWafflesBrowniesIced TeaLollipopPancakesSausagesTwinkiesYule LogBurritos)Chow MeinChocolateIce CreamMargarineMilkshakePastries)Pop TartsEnchiladasFried FoodRocky RoadSandwiches...

Dream Jobs ( Fun and inspiring professions ) 2025-05-02

5 Items: Artist: Someone who draws, paints, or creates art using colors, brushes, and imagination.Doctor: A person who helps keep us healthy, gives medicine, and takes care of sick people.Pilot: A person who flies airplanes high in the sky and takes people to different places safely....

Invasive Species Word Search 2025-11-24

16 Items: To shake quickly back and forth.So scary or gross it makes you shiver.To watch or check carefully over time.Needs to be done right away, no waiting!A person you work with or do projects with.An animal that hunts and eats other animals.Very mean or likely to hurt someone or something.To stop something from happening before it starts....

Chem 1 Unit 1 Vocab 2026-01-12

13 Items: _______ a measured that reflects the amount of matter______ the study of matter and the changes it undergoes_______ is a measure of the amount of space that matter occupies________ the amount of mass per unit volume; a physical property._______ a set of controlled observations that test the hypothesis...

adverbs and adjectives 2025-08-08

1 Item: small, fast, slow, happy, sad, hot, cold, loud, quiet, nice, mean, clean, messy, soft, hard, shiny, dull, sweet, sour, quickly, slowly, happily,

ENVIRONMENT AND HINDU MYTHOLOGY 2024-11-13

12 Items: WHO IS THE HINDU GOD OF WIND AND AIR?WHO IS THE SACRED BULL AND VEHICLE OF LORD SHIVA?WHICH AVATAR OF VISHNU TOOK THE FORM OF A TURTLE?WHO IS THE GOD OF WATER, OCEANS, AND RAIN IN HINDUISM?WHAT IS THE NAME OF THE EARTH GODDESS IN HINDU TRADITION?WHAT RITUAL INVOLVES OFFERINGS INTO A SACRED FIRE?...

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

Group 2 Short a long a 2023-05-14

1 Item: cake, mad, cup, make, fast, hand, what, gate, snap, last, page, came, whale, bat, grass, face, name, rake, ask, same, made, sack

A2+ Unit 1 Vocabulary 2024-09-06

20 Items: very scary filmsa show that discusses sportsa show or film that is animateda show that makes you laugh a lotshow or movie about people in lovemovie with a lot of action and eventsa game where people play as charactersa program about food and how to make ita game with a lot of interesting thingsa program on a stage with lots of music...

Infinitivos from 1A 2024-11-20

46 Items: to skito runto eatto buyto singto swimto drawto workto cookto restto skateto danceto sleepto drinkto studyto travelto watch TVto read booksto skateboardto rent a DVDto skateboardto write poemsto go shoppingto do homeworkto play soccerto read a bookto go to schoolto write storiesto learn Spanishto write e-mailsto ride a bicycleto read magazines...

Echoes of Honor – Castles & Classes WORD SEARCH 2025-04-24

171 Items: BOTHCAREFARMFOODGATEGAVEGIVEGROWHARDHAVEHELDHEREHILLHOSTKINDKINGLANDLIFELIKELIVELUTEMADEMANYMAZEMOATMOREMOSTPASTPLAYPOORRICERULETAKETELLTHANTHEMTRAPTRUEWELLWEREWIDEWITHWOODWORKABOUTARROWBRAVEBUILTCODESDANCEDOORSENJOYEVERYFEASTGAMESGIANTHONORJAPANLABORLATINLEARNLORDSLOYALMUSICNOBLEODORIPOWERRIGHTROYALRULESSLITSSPEAKSTONESWORDTHEIRTHICKTHOSETRUTH...

Semester Review 2025-05-20

28 Items: kneecapFormation of bone"Good" cholesterolOnly moveable skull boneDeep grooves in the brainMain site of gas exchangeGland that secretes earwaxTerm for too little oxygenA part of the thoracic cageLiquid element of the bloodNormal range is 70-15 mg/dLRupturing of red blood cellsUpper portion of the sternumkeeps food out of the trachea...

Daily Routines 2025-11-26

37 Items: sofirstlaternightbeforeduringto washfinallymorningthe soapto batheto shaveto get upto put onafternoonthe toiletto wake upafterwardsto lay downto take offto go to sleepto get dressedto dry yourselfto brush your hairuse this to wake upwhere you go to sleepplace where you showerwhere make your food atwhat you put on your feetwhere you wash your hands...

Verb forms. 2026-02-22

25 Items: Huy ____ a monkey.I have ____ class today.Huy likes _____ a monkey.Red shouldn't ____ pizza.Trung often _____ noodles.Everyone likes _____ pizza.I ____ no classes during Tet.Have you _____ any food today?I can't _____ have class next week.We haven't ____ Huy's monkey today.Huy's monkey can't ____ like a bird....

Global Convergence 2026-03-09

30 Items: propertydestroyednot movingvery profitableextremely dangerousextremely dangerousgold and silver barspeople born in Spainscience of map-makingability to fight diseasesbuilding things with wooda revolt on a sailing shipan open free-market economypirates supported by a countrySpanish explorers and conquerorstravel completely around something...

Protein Word Search 2026-02-26

1 Item: , fruit and vegetables , dairy ,carbohydrates ,dessert ,appetizer , grain , food group , main course

4B 0609 2023-06-08

20 Items: In Taiwan, people use LINE to ______ with each other.There was an ______ in the building, call 119 for help !There are two ______ routes you can take to the library.Police believed the ______ got in through the kitchen window.The ________ walk around on the floor looking for food that people dropped....

Anatomy & Physiology: L 2026-02-12

31 Items: LipAlso known as swaybackCancer involving leukocytesAlso known as white blood cellLymphatic capillary in the villiExcessive leukocyte proliferationSilk-like hairs that coat the fetusBelow-normal production of leukocytesFluid contained within the lymphatic systemDigestive enzyme with bactericidal properties...

Unit 13 Vocabulary 2025-01-15

12 Items: to get as one's ownTo show clearly; to put on display.The cruel killing of many people or animalsdull as a result of not changing in any wayhaving to do with health;free of dirt and germsone who hates or tries to harm another; an enemyA discussion of reasons for or against something.happening in many places or to many people; fully open...

Industrial Revolution Word Search 2023-07-27

16 Items: jethro tull's stellar inventionjoseph foljambe helps farmers outa noun denoting a period of big changea problem with industrial revolution citiesa problem with industrial revolution citiesperson who introduced the dutch four-field systemsomething workers didn't really have at this timethis machine could work eight bolts of thread at once...

Unit 7 Vocab 2024-05-06

16 Items: monument, and got fined.8. The teacher had to __________ her actions.11. The U.S. army had many _________ soldiers.5. They were caught trying to _____________ the3. His ________ actions at dinner were embarrassing.7. The celebrity's _____________ mansion was beautiful.4. His false accusations were meant to _________ the criminal....

Digestive System Wordsearch!! 2025-04-02

15 Items: The process of swallowing is called?Pepsinogen is secreted by _____ ____?The eight front teeth are called _____?what is the root word for large intestinethe innermost layer of the alimentary canalSeptum dividing tongue into symmetrical halvesWhat is the excretion and elimination of wastes?The first part of the small intestine is the _____?...

All About Madison. 2024-05-23

40 Items: ageCat's NameFavorite BandCollege MajorFavorite SongFavorite ColorFavorite MovieFavorite FruitFavorite DesertFavorite SeasonFavorite TV showFavorite BeverageDog’s name – MaleFavorite RestaurantDog’s name – FemaleBand Seen Most LiveName of High SchoolFavorite land animalChildhood Dog's NameCity she was born inFavorite Movie Genre...

EC2 Unit 3 Además se dice 2025-01-31

60 Items: flagherecropstherebreadsymbolskullsto fixMexicanshelvesflowersAmericanHonduranbackyardto offerto agreelost (m)lost (f)cemeteryto teachto renewfrontyardemployeesbuyer (m)male; boyholy cityskeletonsto createGuatemalanNicaraguanrural areaurban areaseller (f)keep goingloved onesto supportto recycleCosta RicanSalvadorianfemale girlall is goodturn around...

Financial Literacy Word Search 2025-11-21

20 Items: _________ Income after taxes_________ Income before taxes_________ Payment received for work____________ The money one has saved__________ What you can survive without__________ Money that is owed to another____________ Food sold in a grocery store__________ What you cannot survive without__________ A record of income and expenditures...

Industrial Revolution Word Search 2026-01-21

24 Items: Steel-making processCo-creator of communismBlack rock used for fuelModernized the steam engineFather of modern capitalismUses steam to power machinesCreator of the Spinning JennyAcute contagious viral diseaseBuilding where goods are producedTurns cotton to threat super efficientlyStimulates immunity to a certain disease...

HUMAN BODY SYSTEM 2025-12-02

38 Items: Tissues that enable movement.Another word for a nerve cell.Organs where blood gets oxygen.A muscular sac that stores urine.The strong muscle that pumps blood.The watery fluid part of the blood.The red fluid pumped throughout the body.The windpipe that carries air to the lungs.The main control center of the nervous system....

Oak Creek Wildlife Area 2026-01-20

30 Items: Who feeds the elk?What is a baby elk called?What is the name for a female elk?What do you call a giant pile of elk food?What is a large, heavy bundle of hay called?What do you call a male elk with big antlers?Which tree gives this wildlife area its name?What is the name of the nearby town and river?What are the hard parts on an elk’s feet called?...

ww5 u 3 & 4 2024-03-07

29 Items: weaka choiceto leavetoo earlyvery largeto cover upto lose hopestrong windsto understandexact, correctno longer livingsavage or fiercea meat eating animalto make strong againa feeling of great joya longing for the pastnot exact but close enoughto break off or cut in twoa long journey by sea or spacean animal that is hunted for food...

Megan and Aaron 2024-07-31

20 Items: Where do they live?The new Mr & Mrs ??What is their favourite food?What is the name of their dog?Where was their first holiday?What instrument does Megan play?What is Aaron's favourite hobby?What is the Bride's maiden name?What is the Groom's birthday month?What is the Bride's birthday month?On what day did Aaron propose to Megan?...

Daniel & Brittany 2024-10-10

40 Items: Year they metWhere they metBest Man's nameGrooms birthstoneBrides birthstoneBride's dream jobCouples' dogs nameGroom's ProfessionBride's middle nameGroom's middle nameGroom's zodiac signBride's zodiac signWhere was Bride bornWhere was Groom bornMonth Daniel proposedColor of Groom's eyesCouples favorite songGrooms favorite colorGroom's favorite food...

Atom Word Search 2025-02-09

20 Items: The smallest unit of matterA group of atoms bonded togetherThe amount of mass in a given volumeThe process of liquid turning into gasThe force that pulls objects toward EarthRelating to the movement of Earth's crustThe bouncing back of light from a surfaceThe speed and direction of a moving objectThe process of gas turning back into liquid...

Kelly and Jason 2025-11-26

25 Items: The father of the brideThe father of the groomThe mother of the groomThe mother of the brideThe grooms favorite beerThe sport the groom playsThe couples favorite foodThe profession of the brideThe first cat the couple gotThe birth month of the groomThe birth month of the brideThe middle name of the brideThe middle name of the groom...

Social Studies Interim Review Word Search 2026-02-25

20 Items: Founder of Georgia colony.Georgia leaving the Union in 1861.Major Civil War battle fought in Georgia.War between the colonies and Great Britain.Idea that states could ignore federal laws.Cherokee leader who created a writing system.Yamacraw leader who helped establish Savannah.Creek leader involved in land removal agreements....

Q3, Weeks 26-30 Vocabulary 2026-02-25

25 Items: a brief restdeeply emotionalshining brightlydeeply religiousgreat enthusiasmrude or unmannerlyremove blame or suspicionwell-known for a bad reasonbehavior keeping in good tasteexcessive admiration or praiseto show the falseness or hollowness ofto highly praise, especially in publicinsubstantial; in need of strengthening...

D&S WORD SEARCH 2023-03-07

25 Items: Brachialan artificial limbopposite of flexioncrippling arthritismedical term for fartfree from contaminationverbal threat to cause harma microbe that causes diseasethe side not affected by strokeviolence that occurs in the homeosteo is one form of this diseasea brain disorder that causes seizuresthis health care provides comfort care...

Getting away 2023-12-09

20 Items: feeling calm,quietsomething that is very oldbeing the only one of its kindwhen a place has lots of peopleto go on a difficult journey on footsolid substances such as wood,plasticsomething that makes you feel relaxedsomething that makes you feel excitedunusual and often from another countryto become larger and rounder than normal...

Great Depression Vocabulary Review 2026-02-11

25 Items: Failure to pay back a loan.Wealthy tax cuts help the poor.Property used to secure a loan.Risky buying for a quick profit.Places where the hungry got food.Making more goods than people buy.Period of rising prices in stocks.Buy now and pay the balance later.Using borrowed money to buy stocks.Severe drought on the Great Plains....

Soap Word Search 2025-07-28

21 Items: A film or show with singing and dancingshow A program where guests talk with a hostcomedy A funny love story in a movie or showA funny movie or show that makes people laughA suspenseful movie with tension and excitementA film made using drawings or computer graphicsA movie about cowboys and life in the Wild West...