fast food Word Searches

Soap Word Search 2025-07-28

21 Items: A film or show with singing and dancingshow A program where guests talk with a hostcomedy A funny love story in a movie or showA funny movie or show that makes people laughA suspenseful movie with tension and excitementA film made using drawings or computer graphicsA movie about cowboys and life in the Wild West...

Greendog’s Minecraft 2025-08-24

100 Items: SusdigdeadNoobMinespitsBlindFightshootsraidersquishynon-dogPotionsprotectexplodesuses axefast petSand areaHigh arealikes goldraider petFinal bossLava worldGrass areaWater areaFire water2nd chanceuses poisonDead hoglinmany housesacacia AreaYou can Flynon-pet fastForrest areaLAPIZ LAZLI!Main storageboy characterEnderman preyLvl.2 pickaxeUsed for trap...

unit 8 2024-05-01

13 Items: uses microbes to absorb or digest toxinschemicals are magnified through the food webincrease in death rate occurs over a large areaincrease in death rate occurs over a local areaflow of all wastes produced by the average persontype of waste that is from chemicals and constructionturning organic wastes into a sustainable fuel source...

Science Y4-Y5 2025-07-04

19 Items: How high or low a sound isHow loud or soft a sound isA plant that makes its own foodWhen light bounces off a surfaceThe natural home of a plant or animalThe largest planet in our solar systemThe ability to do work or cause changeThe path a planet takes around the SunThe force that pulls things down to EarthThe star at the center of our solar system...

Ornithology Not-Test 3 (Community Ecology) 2025-04-28

19 Items: The role a species plays in the environmentDiversity in birds decreases with increasing ___An interspecific relationship in which both or all species benefitA ___ niche is the resources and conditions a species actually makes use ofA ___ niche is all the possible conditions an resources a species could make use of...

2 2025-02-07

10 Items: What kind of animal is Franklin?What famous comic strip is also the name of a food?What animal swore that one day he would kill Mowgli?Who is the youngest of all Winnie the Pooh’s friends?Who owned a hammer so heavy that only he could pick it up?What was the fourth word used in all the Harry Potter titles?...

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

Unit 7 Vocab 2024-05-06

15 Items: The teacher had to __________ her actions.The U.S. army had many _________ soldiers.His ________ actions at dinner were embarrassing.The celebrity's _____________ mansion was beautiful.She tried to ________ the fall by trying to catch herself.His false accusations were meant to _________ the criminal....

Unit 7 Vocab 2024-05-06

15 Items: The teacher had to __________ her actions.The U.S. army had many _________ soldiers.His ________ actions at dinner were embarrassing.The celebrity's _____________ mansion was beautiful.She tried to ________ the fall by trying to catch herself.His false accusations were meant to _________ the criminal....

August ('25) Vocabulary Word Search 2025-08-07

15 Items: Small and weakTo eat food hungrily or quicklyA painful or horrific experienceOf very great extent or quantity; immenseProduce and/or discharge something; make a soundIn a way that is uncertain, indefinite, or unclearTo shine brightly, especially with reflected lightTo rise from; become apparent, important, or prominent...

MJ9 VOC Review 2025-08-18

15 Items: To follow orders or rulesWhat is the opposite of "cheap"?It is a color that is shiny and gray.A person who writes or broadcasts newsYou can eat it with milk for breakfast.It's Halloween. Let's go ____-or-treating!Harry Potter can perform magic so he is a what?You can use it to cover your body when sleeping....

Water 2023-11-23

19 Items: A holeA material.The presence of a resourceFrozen water in large clumpsA process where water is cleansedRocks/sediments saturated in waterA large body connecting to the oceanWhen water vapour groups together when cooled.A large body of water separated from the oceanA large body of water, the largest on the planet...

summer 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

Red Group Sort 44 Short Vowels with Final Blends 2025-10-23

1 Item: gift best fast desk lost must last just cost lift melt raft help fist milk soft mask tusk nest list left dust half

Personal Health and Fitness 2025-04-14

10 Items: POSTURE : The way one holds their body when sitting or standing.WELLNESS : A state of overall physical, mental, and social well-being.ENDURANCE : The ability to sustain physical or mental effort over time.STRENGTH : The physical power and energy to lift, push, or perform tasks....

Healing Power of Wolves 2025-10-23

10 Items: All the plants and grasses in an area.A body part that helps fish take oxygen from water.The total number of a certain kind of animal or plant in an areaThe natural home or environment of an animal, plant, or organism.A living thing, like a worm or mushroom, that feeds on dead material....

Mission: Find the Hidden Words! 2025-11-13

10 Items: Relating to the whole world; worldwide - LOBGALA room or area where food is prepared and cooked - ENICHKTA day of festivity or recreation when no work is done - YLHODIAA game, toy, or problem designed to test ingenuity or knowledge - ZUPELZA person's regular occupation, profession, or commercial activity - SSBUNIES...

Vocuabulary Unit 1 Focus 2025-12-11

10 Items: ... but A and C only are connected...There is a... connection between points A and B...A sign that says “…” warns you not to enter a place.Tom can’t cook so he eats junk food. Not all the time but …With some people … is difficult because they just won’t listen.I was … to water my friend’s plants, but I forgot, and they all died…...

National Eating Disorder Awareness Week Word Search 2025-02-19

14 Items: Who do eating disorders affect?Caused by fear of gaining weightWhat age do eating disorders develop?When do eating disorders USUALLY begin?Emotional illness that is a great danger to your health?When someone eats excessive amounts of food and then purgesTrue or False: full recovery from an eating disorder IS possible...

Curse Word Search 2025-04-08

13 Items: – Extremely tired or worn out.– Under the influence of a magical spell.– A magical spell that brings bad luck or misfortune.– A piece of information that is sent or communicated.– Something that is difficult to understand or explain.– A magical action or words said to produce a special effect....

Summer Wordsearch 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

Energy of Waves 2025-11-11

10 Items: the highest point of a transverse wavestored energy in food, fuel, or batteries is _____________ energythe part of a longitudinal wave where particles are closer togetherenergy of motion is _____________ energy, anything that moves has this energyan _________________ transformation is when energy changes from one form to another...

GRADE 7 TECHNOLOGY EXAM REVISION 2025-11-17

10 Items: CAN BE USED FOR A LONG TIMEMADE BY CHEMIST IN A LABORATORYSOMEONE WHO FLEES FROM DANGER IN HIS OR HER OWN COUNTRYTHE FOOD OR FUEL THAT LIVING THINGS NEED TO LIVE AND GROWSUBSTANCES THAT ARE EXTREMELY DANGEROUS TO TOUCH OR INHALEA MAN-MADE TEXTILE USED IN PROTECTIVE CLOTHING FOR FIRE FIGHTERS...

Energy Release Hazards/Stuck In-Between Word Search 2025-09-22

12 Items: Powered by compressed airAbbreviation for "lock out, tag out"a safety shield attached to machinery used to lesson risk of injuryMaterial removed from a excavation- mixture of soil, rock, sand, etc.Underwriters Laboratory tag which should be found on all electrical cordsA wire that carries the power from the source to a switch, machine or appliance...

Athletes 2023-04-12

1 Item: chain energy producer consumers decomposers primary consumers secondary consumers tertairy consumers quaternary consumers

The Home 2024-12-14

1 Item: Carpet, Stove, Table, Food, Cook, Chairs, White board, TV, Cabnet, Laundry room, pictures

GRIDLOCK 2 2025-08-11

15 Items: Harmless treatmentTo return formatted value in SASOption in PROC FORMAT to create multilabel formatsWhat is the most frequent value in a dataset called?Macro variable that stores the current system date in SASWhich function in R is used to fit linear regression models?What system in SAS controls the destination and appearance of all SAS output?...

Title, Word Search 2024-10-26

2 Items: beef, wallaby, turtle, fish, lamb, chicken, culture, tradition, cattle farms, fauna, native, exotic.aim, goal, purpose, ingredients, steps, tools, measuring, making, cooking, tablespoon, mixing, food safety, wash hands, rules, equipment, instructions, games, sequence, safety,Top Tips, convention, conduction, radiation, heat.

Movement and Cells 2025-12-07

14 Items: Connects bone to bone.Connects muscle to bone.the type of joint in the skulla pair of muscles that work togetherthe type of joint in the elbow and kneeStructures in a cell that release energy.Tough outer layer of plant cells, made of cellulose.Layer around a cell that controls substances entering and leaving the cell....

Vocab word search 2024-04-26

12 Items: the part of your hand near your thumbA shocking moment, a great surprise of amazementlock of hair. A piece of hair hanging like a curlA fast movement of something or where you twitch.you achieve something a victory, you are successful.steadily into someone or something with a dead stare...

Acceleration: Word Search 2025-04-16

10 Items: Any push or pull.A force that draws any two objects toward one another.A force caused by a rubbing motion between two objects.A combination of speed and the direction in which an object travelHow fast an object moves. The distance that object travels divided by the time it takes....

Final Review 2025-05-23

17 Items: Male reproductive cell.The frist stage of alcoholism.Dilates to 10 cm during child birth.Having a purpose and direction in life.The last stage of the grieving process.A blood clot or blockage in/near the heart.Taking too much of a certain drug, can be fatal.The adictive substance found in tobacco products...

Raw Food Diet 2025-11-11

1 Item: VEGETABLES, FRUITS, NUTS, SEEDS, SPROUTS, SALAD, SMOOTHIE, DEHYDRATOR, JUICE, AVOCADO, FERMENT, PROTEIN, VITAMIN, CALCIUM, HYDRATION, ORGANIC, HEALTH

Age of Exploration Vocab 2022-11-21

12 Items: Spaniards born in the New WorldA Spanish conqueror of the AmericasA person of mixed African and Spanish ancestryA person of mixed Spanish and Native American ancestry.People living in the New World Spanish colonies but born in Spain.A small, fast Spanish or Portuguese sailing ship of the 15th-17th centuries....

Today's Vocabulary 2022-11-23

8 Items: A particular smell.Sore, red, and swollen from disease, injury, etc.A stitch or a series of stitches used to close a cut or wound.An injury that is caused when a knife, bullet, etc., cuts or breaks the skin.A serious disease that is passed from one person to another in dirty food or water....

UNUSUAL PROFESSIONS 2025-12-09

12 Items: make and repair dental appliances such as denturesis a professional who has licenses in funeral arrangingis someone who constructs, modernizes, repairs elevators.the study of Earth's natural environment and human society.performer who uses only their voice to bring scripts to life.operational manager of a train, responsible for crew coordination....

Peaceful 2025-10-31

1 Item: jacuzzi park sunlight together unitedfront, swings laughter gym drives cinema food quiet lover morningsex

A2 / Flyers Adjectives wordsearch - Spanish clues 2024-03-24

79 Items: mediopobresolo/aroto/acaro/alejanofrenteduro/aalto/aamablerico/avacío/alleno/alargo/alisto/amismo/abarato/aoscuro/arápido/apeludo/apesado/ahorribleligero/acasado/aen líneablando/aespecialseguro/acálido/aincreíbleQuerido/aexcelenteextinto/ael vidrioizquierdabajo/bajaperdido/apróximo/aruidoso/aextraño/aaburrido/aprofundo/atemprano/aoro/dorado...

Plant Diversity 2025-11-11

13 Items: The part of a plant that makes foodThe part of a plant that holds the seedsplant A plant that does not produce flowersplant A plant that produces flowers and seedsThe part of a plant that can grow into a new plantA tall plant with a thick, woody stem called a trunkA tiny non-flowering plant that grows in damp places...

African American Studies Word Search 2026-02-17

8 Items: Which colony passed the first slave codes?The Christian group that were mostly against slaveryWhich continent did most enslaved people get sent to?The movement that Phyllis Wheatley became an important part ofThe people who have any origins in the dark-pigmented populations of Africa...

logans crossword 2025-04-16

11 Items: Any push or pull.A force that draws any two objects toward one another.A force caused by a rubbing motion between two objects.A combination of speed and the direction in which an object travels.How fast an object moves. The distance that object travels divided by the time it takes....

UNIT 1 2025-11-27

17 Items: ElectricityTo speak in a very quiet voiceEquipment that makes a building warmTo happen, or affect people, with forceA large machine that you use to cook foodFeeling uncomfortable and a little stupidA sound that lets you know there is dangerAn investigation to test or discover somethingSomething bad that happens that often hurts you...

ASU Well-being Word Search 2025-02-27

8 Items: Humana's well-being program is called?In March, we focus our wellbeing on this.How many VTO hours do full-time associates receive?April will kick-off Humana's largest belonging event, the 100-day....What provides quarterly metrics and updates on Humana's well-being initiatives?...

I like food 2025-10-20

1 Item: hamburger, cheese, milk, butter, orange, strawberry, watermelon. Bread , Chocolate ,Pizza ,Eggs ,Avocado, Apple, yoghurt, ice cream, potatoes, cake, soda, water, chips, fish,

Beacon Primary Eco Stewardship Puzzle 2025-08-19

9 Items: To work jointly towards the same end.Growing a mix of crops in the same area.The science of managing farms as ecosystemsThe activity or business of growing crops and raising livestock.the state or quality of being dedicated to a cause, activity, etc.An effect caused when something is missing and the whole world is affected....

U11 2026-01-12

16 Items: Very bad or unpleasant.In spite of that; nevertheless.Able to be used, obtained, or reached.To eat food or prey hungrily or quickly.Very pleasant, attractive, or enjoyable.Causing great surprise or wonder; astonishing.The act of formally or politely asking for something.To eat dinner in a formal setting or at a restaurant....

Food and Kitchen 2025-09-23

1 Item: NERDS, POT, THERMOMETER, GARLIC, KRACKLE BAR, BLENDER, DICE, SLICE, PIZZA, SKOR BAR, FUN DIP, GRATER, MIXING BOWL, BASTING, ALMOND JOY, ONE HUNDRED GRAND, POTATO MASHER, TIMER, SWEET TARTS, LAFFY TAFFY, THINGAMAJIG, BOARD, DOUGH, CRUNCH BAR, SMARTIES, GOB

Word Search: Respiratory System 2025-08-18

13 Items: The gas needed for cellular respirationThe thin double membrane that covers the lungsThe organelle where cellular respiration takes placeThe flap that prevents food from entering the windpipeThe process of breathing out air containing carbon dioxideTiny air sacs in the lungs where gaseous exchange takes place...

Food word search 2025-09-10

1 Item: Banana Orange Grape Strawberry Blueberry Raspberry Lemon Lime Watermelon Peach Pear Cherry Mango Pineapple Kiwi Avocado Grapefruit Papaya Plum Carrot Potato Tomato Onion Garlic Lettuce Cucumber Pepper Broccoli Cauliflower Spinach Peas Corn Eggplant Zucchi

good search 2023-01-12

250 Items: ainnotobeasatbebycatdogouryouadsusecanowntheactaddageagoairallandanyarmartaskbadbagbarbedbigbitboxboybutbuycancarfarfewlioncluesaveyourfreelapscanttextwithformablealsoareaawaybabybackballbankbasebeatbestbillbluebodybookbornbothcallcardcarecasecellcitycoldcomecostfactfailfallfastfearfeelfillfilmfindfinefirezebrahippowordsbuildsolveclickprintabout...

Diabetes 2026-02-02

1 Item: hyperglycemia; diabetes; glucose; insulin; fast acting; carbohydrates; fifteen minutes; complex; secondary; blood sugar; medications; protein; gestational; type one; type two; regular meals; severe; glucometer; testing strip;

ITS ALL ABOUT MICROSCOPIC LIFE 2024-03-01

22 Items: The powerhouse of the cellSingle Celled microorganismsone-celled aquatic organismsGreen pigment in plants and algaea substance capable of causing cancersmallest unit that can live on its ownMaterial within a living cell-jelly-likeSmall common fly found near rotted fruitViruses that infect and replicate in cells...

Genesis, Exodus, Leviticus, Numbers 2024-03-13

28 Items: cleanno foodliked the bestJoseph's fatherplace to worshipAdam and Eve's sonAdam and Eve's sonto do what others doboat that Noah builtGod so love the worldJacob's son (favorite)Adam and Eve's third sonthe first man God createdthe first book in the biblethe third book in the biblethe second book in the biblethe fourth book in the bible...

July Word Search 2024-07-16

32 Items: Jarrod's NRL teamNumber of groomsmenNumber of bridesmaidsWhere Jaz & Jarrod metJaz's favourite singerJaz's favourite colourJarrod's favourite foodThe month of our weddingName of our wedding venueJarrod's favourite colourJarrod's favourite dessertJarrod's favourite superheroJaz & Jarrod's favourite tripWhere Jaz went to unniversity...

Anatomy of the Respiratory System 2024-10-15

24 Items: Key process for making ATP.Blood in the pleural cavity.Air within the pleural cavity.From the larynx to the alveoli.Air passages between nasal conchae.From the nasal cavity to the larynx.Forms the floor of the nasal cavity.Part of the roof of the nasal cavity.This membrane is attached to the lungs.Gas exchange between the lungs and blood....

T.L.E WOR SEARCH 2025-02-03

20 Items: Creating fun shapes for cookies.Stirring soups, sauces, and stews.Garlic, onions, and other ingredients.Freshly grating nutmeg, ginger, or garlic.Cutting garlic, shallots, or small fruits.Cutting food packaging, bags, and wrappers.Organizing small tools, screws, and hardware.Soft fruits, boiled eggs, or tender pastries....

Owen 11-10-25 2025-11-11

20 Items: This football game is exciting!Owen is studying his spelling words!Owen likes to collect Pokemon cards.The other quarterback dropped a pass!I love sleeping late on the weekends.We like frying food in our air fryer.People enjoy decorating for Christmas.Today was the beginning of snow season!You can put an address into Google Maps....

Living on One Dollar a Day 2023-03-14

10 Items: Bank you can get loans atThe parasite Chris became sick withThe tropical storm that hit GuatemalaCountry the documentary takes place inThe vegetable the students grew to make moneyName of the kid who hung out with Chris and his friends1.1 __________________ people in the world live on one dollar a day....

GAITS OF A HORSE 2024-01-18

11 Items: The different speeds the horse travels.A gait with three beats, it is between a gallop and a trot.When a horse moves backwards, legs move backwards as in a trot.A pace faster than a walk where a horse lifts its legs in diagonal pairs.A controlled version of a gallop, rider is more forward and out of the saddle....

Roller Coasters 2025-04-17

11 Items: Any push or pull.A force that draws any two objects toward one another.A force caused by a rubbing motion between two objects.A combination of speed and the direction in which an object travels.How fast an object moves. The distance that object travels divided by the time it takes....

Roller coasters 2025-04-17

11 Items: Any push or pull.A force that draws any two objects toward one another.A force caused by a rubbing motion between two objects.A combination of speed and the direction in which an object travels.How fast an object moves. The distance that object travels divided by the time it takes....

CVPRD 2022 Holiday Word Search 2022-12-07

241 Items: aedbencprelfjoyacidcasscoalcodycoldevanfastivankacelynnmattnicenoelrestryansealselfsnowstarteamtonywishadultangelaveryburnscandychildcidercometconorcotwocupidemilyfrosthollyjollylanielogannilesoceanoscarparkspeacepulseriverrulesscarfshockslacktreesvixenwyattactiveairwayassistbleachbradyncarolsdaconodancerdarrendasherdonnereggnogfrostygloveshottub...

good search 2023-01-12

250 Items: ainnotobeasatbebycatdogouryouadsusecanowntheactaddageagoairallandanyarmartaskbadbagbarbedbigbitboxboybutbuycancarfarfewlioncluesaveyourfreelapscanttextwithformablealsoareaawaybabybackballbankbasebeatbestbillbluebodybookbornbothcallcardcarecasecellcitycoldcomecostfactfailfallfastfearfeelfillfilmfindfinefirezebrahippowordsbuildsolveclickprintabout...

Impact 1 - Semester Test Vocabulary 2024-11-06

29 Items: – Energetic and busy.– A very tall building.– To make something new.– To brighten or illuminate.– Having little or no light.– A large, fast road for cars.– Filled with thick mist or fog.– A person who lives in a place.– A special event or celebration.– The form or outline of something.– The style or design of buildings....

Single 2026-02-07

237 Items: gobedeatnapteabathcalmcookeasefastfeellooknapsreadrestsolotaskwalkwashyogaalonecleanfocuslearnmusicnightquietrelaxspacethinktrackwatchwriteawakencopingdisheshabitsunplugunseenbalancebedtimeblanketbreathecheckineveningfreedomlaundrymorningobserveofflineroutinestretchwritingarmchairautonomybathrobecleaningdowntimeendofdayfacewashfeelingshomebody...

Transport 2026-02-18

20 Items: A beautiful, expensive boat.A large animal that people can sit on to travel.A vehicle with two wheels and a powerful engine.A small bus that usually has about 8 to 15 seats.A large, strong vehicle used for carrying heavy things.A comfortable bus used for long journeys between cities.A very large boat used for traveling across deep oceans....

Roller Coasters 2025-04-17

11 Items: Any push or pull.A force that draws any two objects toward one another.A force caused by a rubbing motion between two objects.A combination of speed and the direction in which an object travels.How fast an object moves. The distance that object travels divided by the time it takes....

Genesis, Exodus, Leviticus, Numbers 2024-03-13

28 Items: cleanno foodliked the bestJoseph's fatherplace to worshipAdam and Eve's sonAdam and Eve's sonto do what others doboat that Noah builtGod so love the worldJacob's son (favorite)Adam and Eve's third sonthe first man God createdthe first book in the biblethe third book in the biblethe second book in the biblethe fourth book in the bible...

Megan and Chris 2024-11-17

24 Items: What is Chris' hobby?Where was Megan's first job?What is Chris' favorite food?What was their college mascot?What town did Megan grow up in?What instrument does Chris play?What color are the groom's eyes?What month did they get engaged?Where did David and Eileen meet?What is Megan's favorite tv show?Where is the couple honeymooning?...

Lowe's 2025-04-13

24 Items: Toothy toolNot a door but aA door swings on itApplicator for paintOur Live Goods itemsThe thing #12 turns onWho maintains our bays?The ceramic style flooringPower tool used for screwsYou groom your lawn with itAppliance to clean your dishesUsed to pull on to open drawersAppliance to keep your food coldCabinet that your sink goes into...

@@EC2 Unit 4: ¿Te acuerdas? & Además se dice 2025-04-02

70 Items: hotpeeltoesheadarmsnoseeyesearslegsfeetbackcumincoughgrilldoughvirusmeatsstoresnacksweetfriedtastysaltymouthteethchestgratedbeaterchillstongueparsleyto peelcoveredto wantfingerscinnamonlukewarmto grateto grindmarinatehomemadeomelleteallergiescorn cakeinner earsupermarketI love foodIt's swollenrice puddingchicken brothI like cheesecorn tortilla...

good search 2023-01-12

250 Items: ainnotobeasatbebycatdogouryouadsusecanowntheactaddageagoairallandanyarmartaskbadbagbarbedbigbitboxboybutbuycancarfarfewlioncluesaveyourfreelapscanttextwithformablealsoareaawaybabybackballbankbasebeatbestbillbluebodybookbornbothcallcardcarecasecellcitycoldcomecostfactfailfallfastfearfeelfillfilmfindfinefirezebrahippowordsbuildsolveclickprintabout...

たのしいけいようし 2025-05-09

26 Items: いい ii – goodすき suki – likeわるい warui – badおおきい ookii – bigながい nagai – longやすい yasui – cheapこわい kowai – scaryたのしい tanoshii – funうるさい urusai – noisyしずか shizuka – quietきらい kirai – dislikeちいさい chiisai – smallあたたかい atatakai – warmいそがしい isogashii – busyおいしい oishii – deliciousまずい mazui – bad-tastingはやい hayai – fast / earlyつまらない tsumaranai – boring...

Winter Word Search AVID 2025-12-19

28 Items: Arguing about topicsAnother word for a testHaving to do with schoolWork we complete in classWhat the A in AVID stands forWhat the V in AVID stands forWhat the I in AVID stands forWhat the D in AVID stands forYou need 5 of these in an essayExpressing your thought verballyExpressing your thoughts on paperWhat you use to write down answers...

Parts of Speech - Nouns, Adjectives, Verbs, Adverbs 2022-07-20

1 Item: eating, piano, thunderstorm, painting, dancing, raining, quickly, restaurant, pretty, colourful, wagging, fast, spaniel, tutoring, snoring, saunter, culprits, enthralled, slowly, reading, musical, draw, write, compose, navigate, windy, sketching, cleaning

8th Grade Science Word Search 2023-05-17

23 Items: heat energyform of energy in the sunused in night vision gogglesenergy of an object in motionatom or compound with a chargesubatomic particle with no chargeused for cell phone communicationform of energy in food and batteriesform of energy resulting from motionpositively charged subatomic particlenegatively charged subatomic particle...

Week 10 hard 2023-11-07

25 Items: to scareto receivemoved by windopen to attacka long look at somethingstorage area for a planefeeling or showing thanksThe physical need for foodplace for burying the deadcontinuing for a long timeshining brightly; sparklingwild or disturbing activityAdmired people we look up toa group of people watching an eventsetup an organization or set of rules...

cirque du freak 2024-04-09

26 Items: pizzaholywaterWho is Darren's sister?What is Darren's last name?Where does the story begin?Who is Darren's best friend?Who runs the Cirque du freak?What did Darren's mom collect?What can't vampires turn into?How many goals make a hat trick?What items don't affect vampires?Who is the Social Studies teacher?What sport is Darren really good at?...

Yes sir 2024-09-11

195 Items: aisbedogoamheanwasarehadcanusehasseedidgetmaysaysetputasktryaddsawgotruneatletcutwaydaymanboyendmenaireyecarseaonealltwonewoldanybigownhaveweresaidwillmakelikelookbeencallfindcomemadetakeknowlivegivehelptellcamewantshowdoesmustwentreadneedmoveplaykeepturnseemopenwalkgrowtookhearstopmisstalkwordtimepartworkyearbacknamelinefarmlandhomehandpagefood...

Wellness Word Search 2024-12-31

20 Items: An exciting or unusual experience.To make stronger or more resilient.To give strength and confidence to achieve goals.The ability to recover quickly from difficulties.A group of people sharing common goals or values.The act of changing physical position or location.The condition of being physically fit and healthy....

Howard Stax 2025 2025-12-20

20 Items: Best cat name everIt's this time againNickname of west coast Jesse.second opener for Dragonfly 2025Robert's sledge-hammering tag lineHe's got mashed potatoes for WendallChloe's music director at GhostlightTown where we all did Chuck and the ChocFirst part of name ending in "Meisterburger."Most frequently eaten Howard Christmas dinner...

Chai Spy Word Search 2026-02-13

47 Items: RAITACLOVEPEKOETABLAMALAIMANGOMEHNDIJALEBIPUNJABGINGERBENGALDHOLAKKOLKATAMONSOONSAFFRONNAMASTEKASHMIRCHUTNEYJAGGERYGUJARATCARDAMOMRICKSHAWTURMERICSHERWANITAMARINDDIASPORABOLLYWOODHIMALAYASSOUTHASIANGULABJAMUNDARJEELINGMULTICULTURALSTREETFOODPARTYA non-melting cheese common in South Asian cuisine....

Minnesota 2023-01-24

30 Items: hockey teambiggest lakebaseball teamnot saint paulthe state birdthe metro areaa northern citythe state flowerthe capitol citythe biggest rivera delicious burgerthe real state birdwe get a lot of thiswe got a lot of thesesport you play on icewhere the mayo clinic isour men's basketball teama saying to express dismayour women's basketball team...

Daily Routine & Frequency Adverbs 2023-03-04

24 Items: Action done to restAction done with a carAction done with a bookAction done after eatingAction done m¿with clothesAction done before an examAction done before getting upAction done to have a clean carAction done with a mop and a broomAction done to be healthy and strongAction done in the kitchen with foodFrequency Adverb used to express a 0%...

Clay's Vocab 2023-09-26

23 Items: made a choiceto show clearlycontaining nothingyoung cows or bullsa quantity of somethingto form a mental pictureto total numbers togetherreflection of sound wavesa way to get into somethinga value that does not changea breaking of a law or promisedownward measurement from a surfacea sweet, brown food that is made from cocoa...

Shoftim 5.0 2025-08-23

20 Items: ShoftimWhat should judges pursue?Who must write a copy of the Torah?What tribe receives no inheritance?The punishment for a false witness.If you love Me, keep My _____________.What are the Levites to live on as food?What must a king not multiply for himself?Who said, “I have been with you so long….”?“I will not abandon you as _________. “ (NT)...

DELICIOUS WORD SEARCH 2025-11-26

32 Items: very tastynot cookedready to eathas no tastetastes of salthas too much oiltastes like nutstastes like lemontastes like sugargood for your bodyhas a lot of juiceold and bad to eatno taste or flavoureasy to cut or chewrecently made or pickedfood you must chew a lotnot sweet; salty or spicythick and smooth like creamfirm and dry on the outside...

Young Family 2024 2024-12-18

26 Items: peacehappinessJohn’s daily fixSuzy’s favorite appAlison’s favorite appAlison’s new found freedomFamily's go-to comfort foodRyan and Alison’s summer jobRyan’s sanctuary in BerkeleyJohn’s short-lived fall hobbyFavorite TV “show” this summerAlison’s favorite NY Times gameFinally tried this trending sportWhat Jacob is currently looking for...

Photosynthesis Word Search 2025-03-23

20 Items: A large, slow-moving mass of iceA dry region with little rainfallThe layer of gases surrounding EarthEarth’s spinning movement on its axisThe second layer of Earth’s atmosphereThe path a planet follows around the sunA mountain that erupts with lava and gasesA piece of land nearly surrounded by waterRain, snow, sleet, or hail falling from clouds...

Sarah is 24!!! 2026-03-06

20 Items: your fav placebabysat this good boywe flew here togetherthis place fucking suckswe played this at Easteryou did this in may 2025RIP May 2025-January 2026this is how i feel about you <3went here to eat from food trucksyour attempt to make your own cupsour first hike... you were mad at mewe went here on your birthday last year...

Mesopotamia, Egypt and Indus 2025-09-08

38 Items: wheelfarmingGeometryA seasonal wind.Belief in many godsEgyptian writing systemThe river changed coursefell It was hard to defendHow people meet their needs.In Indus the way the cities werethe world's first system of writingwell planned cities, indoor plumbingking who United upper and lower EgyptA ruler of ancient Egypt seen as a god...

Animal Behaviors for Reproduction 2025-09-24

28 Items: One female mates with one maleOne male mates with multiple femalesOne female mates with multiple malesThe behavior patterns related to how animals mateAmphibian larvae that develop into adults without parental helpThe amount of time and resources given to the care of offspringSome animals migrate to a better environment for _____________....

Adjetivos 2023-02-09

19 Items: something spicy - algo que piquea fat man - un hombre con kilos de másan attractive woman - una mujer que atraea sharp object - un objeto con mucho filoa smart person - una persona lista o astutaa beautiful woman - una mujer linda o bonitaa safe place - un lugar que no sea peligrosoa picky man - un hombre complicado con detalles...

Unit 8 word search 2024-11-07

19 Items: Think of Maui, the demi-god lolAn android is like a human in its...If something is legible, you can ... it.To adapt is to ... into a new environment.People often ... if miracles can really happen.Doing a vocal exercise helps to exercise your...If you get a question correct, then you got it...Metaphors can often ... the meaning of a sentence....

March 2026 Word Search 2026-02-27

1 Item: make, of, some, them, your, color, hand, play, red, thing, white, fast, hear, learn, music, off, sound, bright, echo, energy, light, light wave, loud, sound wave, vibration

countries 2024-07-19

12 Items: - Largest country in the world, spanning Eastern Europe and Northern Asia.- North African country famous for its ancient pyramids and the Nile River.- Southeast Asian country known for its temples, beaches, and spicy cuisine.- Island continent known for its unique wildlife, such as kangaroos and koalas....

Hatcho Elementary School 2025-10-05

15 Items: What animal is Mr. Tomono afraid of?The groups made from all grades are called what?What disaster experience did you do in 4th grade?What is the name of the 5th grade English textbook?What sport did the 5th graders practice in PE class?What famous Toyohashi food did you make in 3rd grade?Teachers read books to students during Story __________....

EDH Word Search 2025-08-19

15 Items: concern about and action aimed at protecting the environment.the mission of the EDH department is to "defend and care for _____ on earth"The acronym for the thematic area and gateway course: Global Inequality & DevelopmentThe acronym for the thematic area and gateway course: Environmental Sustainability & Global Health...

Plastic: Here to stay? 2022-10-10

9 Items: capable of being made newA place where trash is buried or placed on top of the groundTo make something new from something that has been used beforepolymers that are produced by or derived from living organismsnot capable of being broken down by the action of living organisms...

Biology Word Search - Kiki 9b 2024-06-11

15 Items: the coloring in a leafa reagent that tests a leaf for starchA part of a plant that attracts pollinatorsA part of a cell that supports and protectsA part of the vascular bundle that carries waterAn organ that is responsible for transport in plantsthe product of using iodine on a leaf after photosynthesis...