fairy tales Word Searches

Cinderella 2025-06-11

21 Items: A wise brideCinderella's sonEven the _______!The princes motherLet's ___________.The prince's servantKing Gold's daughterThen there was a ____.Fights over stolen goldSix men ________ to me.King of the golden castleTimes flies like an _____The Beauties are too ____.Lives in the Beauty VillageGives the prince glass shoes...

Look at the clues and find the word (in brackets). Shadows in the snow: Part 1. 2022-05-28

25 Items: (tore)shredded(legend) myth, saga(domestic) not wild, tame(savage) ferocious, fierce(kinship)blood relationship(roam) wander, rove, ramble(biological) organic, living(breed) reproduce, procreate(deserve) merit, earn, warrant(shiver) tremble, quiver, shake(spine) backbone, spinal column(claim) assert, proclaim, profess...

Pokemon Camp Tucker 2025 2025-07-16

109 Items: TMMewAshAbraOnixAronFireDarkRockEeveeZubatDittoRaltsBagonShinxRioluGibleSnivyTepigZoruaWaterGrassSteelFairyGhostBerryKantoJohtoHoennUnovaKalosAlolaGalarMistyBrockJamesEmberMeowthMewtwoGengarMachopVulpixPidgeyOddishCuboneLaprasTogepiMareepWooperEspeonMudkipSwabluBeldumPiplupPotionSinnohPaldeaJessieTacklePikachuPsyduckSnorlaxRattataDiglettGeodude...

6 letter words: A through K 2026-02-01

11 Items: A mechanical contrivance or deviceA small earphone that fits in the earShort tales to teach a moral lesson (plural)Utterly foolish or senseless persons (plural)Annoy persistently; or a member of the weasel familyDevice for making arithmetic calculations with beads on rodsShort knife with a pointed blade used for piercing or stabbing...

fairy 2025-01-13

1 Item: Fidough Swirlix Jigglypuff Dachsbun Snubbull Diancie Aromatisse Slurpuff Sylveon

Fairy 2025-01-13

1 Item: Fidough Swirlix Jigglypuff Dachsbun Snubbull Diancie Aromatisse SlurpuffSylveon

Cinderella 2024-06-01

8 Items: Where does the prince liveWho is the main character of the storyAt what time does Cinderella leave the ballWhat is transformed into a coach for CinderellaWhat tasks is Cinderella forced do by her stepmother?What does Cinderella make that the fairy godmother grants?What event does Cinderella attend where she meets the prince...

Quizsearch! 2023-10-24

15 Items: What is a doe?The capital of England?What colour are smurfs?The capital of Scotland?What type of fish is Nemo?What do caterpillars turn into?How many legs does a spider have?Where is the Great Pyramid of GizaWhat is Harry Potter's owl called?The name of the fairy in Peter Pan?The ocean off the Californian coast?The current premier league champions?...

Movies based on a book 2025-10-21

8 Items: Where vampires sparkle and love bitesSci-fi epic set on the desert planet ArrakisBook where “Dauntless” isn’t just an adjectiveNovel featuring Zero, onions, and buried secrets90s teen classic loosely based on Jane Austen's “Emma”Fairy-tale parody featuring an ogre and a talking donkeyDark fantasy about a girl and her button-eyed other mother...

FANTASY 2025-11-30

15 Items: the knight’s shiny weapon.a magical horse with one horn.a magical place with tall trees.fairies and dragons use me to fly.a chest filled with gold or jewels.a stick wizards wave to cast spells.bright colors in the sky after rain.something wonderful you can’t explain.a giant creature that can breathe fire.a tiny creature with wings and sparkle....

Adventure Word Search 2026-01-14

129 Items: EraJigGoldHarpHolyHopeIconIsleKiltBoxtyCharmCoinsDanceFairyFaithFeastFieldFluteGloryGraceGreenHonorHumorIrishBeliefBishopBonnetCastleCelticChurchCloverCustomDinnerDivineDublinEndureEnergyEuropeExciteFamilyFlavorForestGaelicGardenGoblinGoldenGrowthHiddenHumbleIslandJoyfulLegendAncientArrivalBanquetBlarneyBritainCabbageCharityCobblerCostumeCountry...

Deutsche Weihnachten 2024-12-06

50 Items: (snow)(star)(bells)(angel)(frost)(feast)(sleigh)(tinsel)(sweets)(candles)(incense)(snowman)(cinnamon)(fir tree)(presents)(reindeer)(Christmas)(ornaments)(fireplace)(mistletoe)(snowflake)(shepherds)(mulled wine)(gingerbread)(gift giving)(Santa Claus)(family time)(Christ child)(Advent wreath)(Christmas Eve)(Christmas joy)(Christmas tree)...

Aardvark Word Search 2026-04-10

100 Items: EelEmuFoxPigSeaDodoSealKiwiWormPinkMoleBoobyBongoBoobyBoopsDingoGeckoSharkHyenaKoalaKrillLemurLlamaOtterSlothBaboonDragonBeetleBobcatTurtleDugongBeetleLizardGibbonHoopoeIguanaJerboaKakapoDragonMolochQuokkaHa WaspAxolotlAye-ayeDik-dikEchidnaGerenukMonsterHamsterKatydidMeerkatNarwhalOctopusOpossumOstrichPeccaryPenguinPigbuttAardvarkBarnacleBlobfish...

Cinderella pgs. 14-19 2023-07-12

14 Items: What did the prince find?Who put up an important notice?Whose foot was too big and fat?Where was the other glass shoe?How many girls tried on the shoe?Whose foot was too long and thin?Whose foot fit perfectly in the shoe?Who follows Cinderella out of the palace?They went to every ______ in the country.Where was Cinderella when the prince came?...

Haunt Word Search 2025-03-12

126 Items: BatCatBooRedRunFlyOwlOrbZapMothFallBinxStabGutsDarkRainWalkDeadMazeCornJumpScarGoatRoseLambMoonWolfEvilFireFallWandCrowRopeHowlCastHauntHouseWitchSalemBlackGhostGhoulMagicCandyAppleCiderCrispMyersKnifeBloodScaryStoneCloakDeathAngelDevilTarotSparkWingsDemonClownOuijaRavenSkullDonutSugarNightStarsFairyBonesTeethChainAlienBroomGreenStormReaperOrange...

SLO Review: The Dark Ages - The Middle Ages 2024-05-09

17 Items: What is the original language of the epic Beowulf?Who is the original author of the epic poem Beowulf?In what language is The Canterbury Tales first written?a two or three word phrase that replaces a one-word nounThe English language seems to begin when who leaves Britain?...

Ballet History Word Search 2025-09-11

18 Items: where ballet originated.is also known as the sun king.a traditional christmas balletcreated the first ballet school.a classical ballet about a bird.the language ballet terms are in.____ shoes came around in the 1830s.one of the famous classical ballets.created the five positions of the feet.The sun king costume was made out of this....

ABNV 2024-10-03

196 Items: MaxAdanAlexDaviEgonElbaJoãoLaisLaraNinaOrliRyanSaydTaisYuanAliceBrunaBrunoDakirDenisDianyDiegoEmilyEricaFabioJuliaJulyaKarlaLiviaLuigiMagdaMaysaNadjaPabloPaolaQueliSauloTalesTamisThaisVitorYandiAlannaAmandaAyanneCamilaCaroleDaniloElidiaEmilioFatimaGleiceKlysseLilianMaiconMarcosMilenaMiltonMonicaNadyneNathanNeliseRagnarRaquelRebecaRenataRenatoRenner...

FAIRY PASSWORD 2024-11-24

1 Item: CHRISTMAS

Knight Word Search 2025-02-11

15 Items: The female ruler or wife of a kingA weapon with a long blade used in combatThe medieval knightly system with its moral codeThe ruler of a kingdom, often with absolute powerA small community or settlement in medieval timesA powerful medieval siege weapon used to hurl large stonesA protective piece of equipment used by warriors in battle...

Eriala Sõnarägastik 2024-04-25

26 Items: H2Oküllusliktoopi tõstmapuhta vastandpuhastusvahendvene rahvustoitviib keele allakääritatud piimeesti rahvustoittoit teise sõnagaPuhastusvahendi brändGrilltoit inglise keelesvedelik mis lehmast tulebbakterite eemaldamine pinnalttoitude ja jookide loend, toiduvaliktaimset või loomset päritolu vedel rasvkollane lehterjas hõlmise servaga söögiseen...

spooky road trip 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmakeupmuseumoraclepoisonpotionritualsmoressandraspiritspookystatuetrialsvanishvoodoowickedwizardzombie...

Salem Road Trip 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmuseumoraclepoisonpotionritualsandraspiritspookystatuetrialsvanishvoodoowickedwizardzombiealchemyallison...

Salem Road Trip 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmuseumoraclepoisonpotionritualsandraspiritspookystatuetrialsvanishvoodoowickedwizardzombiealchemyallison...

salem road trip final 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmuseumoraclepoisonpotionritualsandraspiritspookystatuetrialsvanishvoodoowickedwizardzombiealchemyallison...

s&s trip 2025-08-13

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmakeupmuseumoraclepoisonpotionritualsmoressandraspiritspookystatuetrialsvanishvoodoowickedwizardzombie...

Christmas Word Find 2025-12-26

156 Items: ElfEveFirHamIceJoyNutRedToyCakeCardCozyGiftGlowGoldHolyListMaryNiceNoelSingSnowStarTreeWrapXmasYuleAngelBellsCheerChimeCiderCometCupidElvesFairyFeastFrostHollyJollyMerryMusicMyrrhPeaceRoastScarfSmileSnowyVixenWhiteAdventBakingBaubleBrandyBrightCandleChillyChristDancerDasherDonnerEggnogFrostyGrinchHoHoHoIcicleJingleJosephJoyfulJumperLightsManger...

Salem Road Trip 2025-08-11

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmuseumoraclepoisonpotionritualsandraspiritspookystatuetrialsvanishvoodoowickedwizardzombiealchemyallison...

Find the words related to Terry Deary's Egyptian tales hidden in the wordsearch below. 2024-05-23

5 Items: tombmummyneriapyramidtutankhamen

ABNV 2024-10-03

204 Items: AnaMaxAdanAlexAnnaDaviEgonElbaJoaoJoseLaisLaraLuisNinaOrliRyanSaydTaisYuanAliceAlineBrunaBRUNOCarlaCesarClaraDakirDenisDianyDiegoEllenEmilyEricaFabioIanneItaloJuliaJulyaKARLALecioLivialucasLUCIALuigiLuisaMagdaMariaMaysaNadjaPabloPaolaPaulaPauloPedroQUELISauloTalesTamisThaisVitorYandiAlannaAMANDAAndreiAyanneAyrtonCamilacarlosCaroleCassiaDanielDanilo...

Literary Genres Review 2024-11-07

20 Items: tale´s openerfirst tale collectorsLittle Red Riding Hood author"slow and steady wins the race"the author of "Pride and Prejudice"All tales share the rule of three and...French fabulist who was inspired by Aesop"The Adventures of Huckleberry Finn” authorThe Ugly Duckling was written for this authora story about human events or actions not proven...

s&s trip 2025-08-13

155 Items: boohexRIPsamauracultfallgothmarymaskomenaltarbinkscandycharmcidercovencursedressemilyfairyfangsfoggyghostghouljudgemagicpartyravensalemsarahscaresigilskullspelltarotamuletapplesautumnbostoncastlechakrachillycobwebcoffeecoffinelixirhorrorlegendmakeupmuseumoraclepoisonpotionritualsmoressandraspiritspookystatuetrialsvanishvoodoowickedwizardzombie...

Other Lineages 2025-11-21

35 Items: Owl humanoidCat humanoidFrog humanoidFish humanoidBull humanoidSnake humanoidDivine humanoidRabbit humanoidTurtle humanoidSea dwelling elfElemental humanoidsSpace frog soldiersSpace frog psychicsFeywild dwelling elfSmall lizard humanoidLarge lizard humanoidSea dwelling humanoidUnderdark fish humanoidBird humanoid with wingsHairy humanoid with tusk...

Beauty and the Beast pgs. 14-19 2023-10-11

18 Items: Who came to Beauty's dream?Where did the horse go to eat?What can she see in the mirror?Where did they find food inside?What were the cupboards full of?Who did the Beast walk right up to?When does her father need to leave?What animal did the Beast look like?What was everywhere in Beauty's room?Who found the way to the Beast's palace?...

Rhetorically 2023-11-09

15 Items: The author’s attitude when writingRepetition of a beginning phrase (“I have… I have… I have…”)Using highly detailed language that appeals to the five sensesOffering specific details or instances as a way to support a claimGiving compliments to someone in order to win their good favor/affection...

Our State October word search 2025-10-02

20 Items: Source of strength for Ashe County beekeepers.Mountain town whose hotel became a post-flood symbol.Natural feature chased along the state’s scenic byway.Nutty partner to dark chocolate in a sweet-salty bark.Thousands of flowers planted in Swannanoa after Helene.New tributary restored in Todd by a pair of waterwomen....

Halloween EngSp 2024-09-28

174 Items: budarmalBatBooRIPWigbabacapacocohojaMagoogrovelaHowlMaskOgreTutuArañaataúdbolsoBrujaBrujomagiamomiaotoñotrollTumbaZombiAngelBeastCandyCarveClownFairyGenieGhostGhoulHauntMummyNightNinjaPartyPrankQueenRobotScarySkullSlimySpellWitchcráneodiabloduendeDulcesescobaGritarHorrorLápidaMomiasmuertorondarsangresombraTerrorTratosAutumnCandleCobwebCoffinCowboy...

TAYLOR SWIFT 2024-10-30

172 Items: AIRARTFARFRYLAWLAYLITOAROATOILOWLRATRAWRAYROTROWSATSAWSAYSIRSITSLYSOLSOWSOYTILTISTOTTOWTOYTRYTWOWARWASWAYWITWRYYAWAFROAILSAIRYALSOALTOAWOLFAILFAIRFASTFISTFLAWFLATFLOWFOALFOILFORTFOWLFRATFRAYLAIRLASTLIARLISTLOAFLOFTLOSTOILYORALRAFTRAILRIFTRIOTROILROLFROSYSAILSALTSIFTSILOSILTSLATSLAWSLAYSLITSLOTSLOWSOARSOFASOFTSOILSORTSTARSTATSTAYSTIRSTOWSWATSWAYTAIL...

Classical Literature 2025-04-14

10 Items: EPIC : A long narrative poem, often about a hero's adventures and deeds, such as the *Iliad*.PROTAGONIST : The main character in a literary work, often a hero or a person facing challenges.ANTAGONIST : The character or force that opposes the protagonist, creating conflict in the story....

Winx 2024-10-27

15 Items: La fée de la lumière et de la mode.Le nom du groupe de fées principales.Ce que sont les Winx (fées en anglais).La fée de la technologie et de la logique.La Winx qui utilise la musique comme pouvoir.La Winx qui contrôle la nature et les plantes.Ce que les Winx vivent en protégeant la magie.Groupe de trois sorcières et ennemies des Winx....

fairy tale wordsearch 2026-02-06

1 Item: good kind Enchanted Spell curse hex Throne room dungeon dark King Wicked evil stepmother queen

Alcohol 2025-06-14

15 Items: Rice wine that makes you bow to strangersLime-flavored excuse to wear a sombrero indoorsSpanish fruit punch that makes you dance on tablesBubbly liquid that costs more than your car paymentWhat you call your voice after karaoke night at 3 AMPirate juice that makes you say "arrr" uncontrollably...

halloween 2025-09-11

177 Items: batboocatelfhatowlRIPwigbonecapedarkdeadevilfallfeargoryhowlmaskmistmoonogrerobetogatutuwandalienangelbeastblackbloodcandycarvecloakclowncrowncryptdeathdemondevileeriefairyfangsgenieghostghoulhauntmagicmummynightninjapartyprankrobotscaryskullspelltiaratricktrollweirdwitchafraidautumncacklecasketcobwebcoffincorpsecowboycreepygoblingrislymakeupmorbid...

St. Patrick's Day Word Search 2026-03-06

1 Item: LEPRECHAUN RAINBOW CLOVER LUCKY IRELAND GREEN GOLD COINS WISH PARADE MAGIC FAIRY EMERALD HAT

Here are Word Search Topics 61 to 70, with 10 words each, both with and without numbers, no dots or commas: --- 61. Fairy Tale Creatures 1 Unicorn 2 Dragon 3 Troll 4 Goblin 5 Fairy 6 Elf 7 Mermaid 8 Ogre 9 Phoenix 10 Griffin Unico 2025-07-08

10 Items: roomroomAtticGarageKitchenBedroomHallwayBalconyBathroomBasement

Characters 2025-12-16

90 Items: BTEEO2SkyAsdaMarsMiniASOSNextTescoBootsArgosCo-opHeinzHovisFairyRadoxDysonThreeCurrysGreggsSubwayRibenaJaguarMullerAndrexPersilKitKatGalaxyWHSmithIcelandCadburyWalkersPG TipsBentleyFord UKEasyJetComfortTopshopWaitroseDomino’sTwiningsLucozadeVauxhallWeetabixSmartiesNew LookMorrisonsPoundlandNestlé UKKingsmillMaltesersTobleroneSuperdrugDebenhams...

A Tunnel of Hsr 2025-11-20

235 Items: IXSamRenOtiAhaEnaLanIcaOniMemElioWeltJadePelaMozeLynxLukaHookAstaFuliHooHLongNousXipeMaraAeonMareZuloSampoBladeKafkaPolkaHertaAnaxaNumbyMarchMydeiTopazRobinYunliXueyiSeeleSaberRappaMishaHanyaSkottFugueClaraBailuArlanOrderLygusCurioFairyAvginYuqueHimekoCyreneCipherAlgaeaPolluxBronyaStelleJarlioNewEdoSundayYukongServalLuochaHuohuoGepardFuxuanArcher...

Kids Movies 2025-12-01

1 Item: adventure, magical, funny, brave, hero, heroine, sidekick, villain, quest, journey, friendship, teamwork, imagination, castle, forest, kingdom, treasure, mystery, mission, talking, animals, wizard, fairy, dragon, pirate, robot, superhero, secret, danger,

Forensic Team Members 2025-06-11

20 Items: I scan the body without a blade, Broken or hidden, my images aid.Who am I?Data and clues, I piece the chart, Making patterns a work of art.Who am I?Why do they do it? That's my quest, I study crime to know it best.Who am I?Poison or drug, I test the blood, Revealing secrets beneath the flood.Who am I?...

ULTIMATE WORD SEARCH 2025-04-22

41 Items: Half girl, half fishThe king of the jungleHidden gold and jewelsA sneaky, fast fighterColorful arc after rainA spooky floating thingA colorful flying insectA tiny cake with frostingIt buzzes and makes honeyA slow animal with a shellA yellow fruit monkeys loveCold, sweet, and melts fastA horse with a magical hornA spiky plant in the desert...

Fantastic Fiction 2025-03-06

20 Items: This title character travels to the islands of Laputa & LilliputPeter Beagle wrote of 'The Last ___' who lived alone "in a lilac wood"Home of House Tyrell, Highgarden is a fertile wine-growing region on this continentThis sword-wielding barbarian from ancient Cimmeria was created by Robert E. Howard...

Stray Kids (if you get all of these ur a hardcore stay but if u dont dw because its kind of hard) 2026-02-17

58 Items: atehopdoitallin5stargiantkarmaiamnotiamwhoiamyougoliveinlifenoeasycircushollowmixtapeskz2020skz2021oddinarymaxidentthesoundrockstarcle1mirohskz-replayhan's skzooi.n's skzooclelevanterfelix's skzooskz's companyskz's animalschristmasevelpink and greencle2yellowwoodhyunjin's skzoomixtape:timeoutlee know's skzoochangbin's skzooseungmin's skzoo...

__________The Wordsearcher God of Mythology: Known as the Master of Word Searches 2025-03-01

30 Items: A gorgon with snakes for hair, whose gaze turns people to stone. She is often seen as a symbol of danger and fear.The god of the sea, earthquakes, and horses. He is one of the most powerful gods in Greek mythology and wields a trident....

1. Word Search 2023-10-19

132 Items: KaaAbuSmeeYzmaAnnaFlitTerkToddSvenChipLiloEricNemoJaneScarOlafRemyDoryGoofyPlutoAliceDopeyDaisyBelleTianaBambiArielPachaStichMoanaMulanPongoSimbaWendyBeastMeekoTimonDumboKronkAkelaLouiePennyGenieMushuBalooLewisPercyMickeyMinnieSneezyTiggerFalineAuroraMeridaPumbaaGastonWinnieBaymaxMowgliPigletEeyoreTarzanGrumpyJasperUrsulaBanzaiMufasaTantorShenzi...

The Characters of Christmas 2022-12-11

10 Items: He is said to be the youngest member of Santa's reindeer team with a red glowing nose.The world’s best-known Christmas gift-bringer figure whose sleigh is pulled by a team of reindeer.Magical, dwarf-like creatures with pointed ears. They are Santa Claus’s helpers at the North Pole where they make toys in Santa’s workshop....

PBSCLEARAGE'S 150 Cartoons (V 3.0) 2025-03-21

150 Items: BingOobiDougPinguMaisyOswaldArthurRupertKipperOliviaCatDogBen 10RecessPokemonRugratsCaillouChowderPJ MasksT.O.T.S.FranklinLazyTownDoraemonFloogalsRobotboyAmphibiaPeppa PigPeg + CatOctonautsDuckTalesWordWorldPoppy CatOdd SquadPaw PatrolScooby-DooMax & RubyHey DuggeeTwirlywoosZoboomafooMia and MeTimmy TimeCamp LazloLittle BillThe JetsonsSuper Wings...

ULTIMATE DISNEY FEMALE CHARACTER WORD SEARCH 2024-05-19

249 Items: BOODEBDOTENAEVEFLOJOYPEGROZANNAASHAATTACLEODORYELSAFAWNHERAKALAKIDALADYNALANANANITAPLIORAYARITASINASISUTINAYZMAALANAALICEANGELARIELBECKYBELLEBULDADARLADINAHDOLLYDORISESTERFA LIFAUNAFLORAKANGAKIARALIBBYMARIEMOANAMULANNANNYNEERAPEARLPENNYPRIYAROSIETE KATIANAVIDIAVIXEYYESSSADELLAAQUATAARISTAATTINAAUDREYAURORABARBIECHICHAEUDORAFALINEJESSIEMAGGIEMAUDIE...