english Word Searches

Languages of the World. 2024-09-25

15 Items: Main language in IndiaLanguage spoken in JapanMain language in GermanyLanguage spoken in TurkeyOfficial language of ItalyOfficial language of BrazilCommon language in East AfricaOfficial language of BangladeshWidely spoken across Latin AmericaWidely spoken in Africa and EuropeWidely spoken across the Middle EastThe most spoken language in the world...

Hwan 2025-04-23

10 Items: summoned the council.Translation of the Bible.Did the Swiss Reformation.Another name for Puritans.Translated the Bible to English.Reformed the Churches in England.Who sought out and tried heretics?Called for reform within the Catholic. ChurchWhat is the peace treaty that was signed in 1648?...

About the ALT 2025-04-21

10 Items: One season is 雨季Another season is 乾季My name is _ _ _ _ _ Lmy hobby is S _ _ _ _ GMy language is E _ _ _ _ _ _T _ _ _ _ _ S lay eggs on the beachThere are pink and yellow P _ _ I treesA sweet fruit in my country is M _ _ _ OMy country is T _ _ _ _ _ _ D AND T _ _ _ _ OThe 3 colors on my flag are ____, white and black

2024 Fall Semester Final 2024-12-18

15 Items: Your teachera logical appealAn ethical appealAn emotional appealThe tallest mountainThe main idea of a textThe subject of this classWhat you are taking right nowThe largest animal to ever liveConvincing someone you are rightComparing two things using like or asthe name of someone in the 10th gradeRepetition of beginning consonant sounds...

A Fun Word Search 🤩🤩🤩 2026-06-13

11 Items: English or Spanish?A province in ThailandTryta gettin’ strongerA country, not far from here(v.) to study a lot (KVIS slang)The most wonderful dish ever createdThe highest area of the mountain rangeA good source of protein, unique to KVISAnother favorite subject of พี่รหัสน้องคิดดีOne of the favorite subjects of พี่รหัสน้องคลัง...

I love English because it is .... / I have ..... / the teacher is ......../ I don't...... 2026-02-13

16 Items: hardnicekindboringusefulstrictuselesshelpfulbadmarksdifficultimportantgoodmarksunderstandinterestingcomplicateddontunderstand

Search the parts of the body in spanish. Then translate it to english 2024-10-23

17 Items: uñacaramanodedobocaojospiesnarizbrazosorejasbrazoscuellopiernascabelloespaldarodillahombros

Chinese portrait Mrs Cloet 2024-09-16

53 Items: maithéeauclésacmarsaoutcentbleurosedorénoirsontpaysgrischatlaitavrilmillevingtblancaimerfleurrougechienlivrestyloboîtetrentetreizemarrontimideecossemuguetpenséetortuerenardmoutonjanvierjuilletanglaisanxieuxboissonlavandenovembreorchidéecinquantepissenlitjonquilletournesolAngleterrepaquerettecoquelicot

L'Ecole Word Search 2024-11-20

46 Items: PEartlawgymmatheasyhardclassgradeschoolfrenchI loveI hateofficeusefulsciencebiologyphysicshistoryspanishenglishlibrarydiplomauselesshomeworkeducationchemistryeconomicsgeographycafeteriaphilosophypsychologyhumanitiesarchitcturescholarshipI don't likeI really likefashion designsocial studieshigher educationComputer sciencepolitical science...

Soft Drinks 2025-03-22

100 Items: 4uTab7UpA&WIcyRCQSkiIzzeTeemBarrNehiSoloRitzDadsBigKBigYBigiKiriCottCawyTumsPushSparBogaBlueJah!JiveKistLiftFantaCrushPepsiSliceFaygoBublyTangoHawaiFreezZeviaWelchBustaCampaJollyMaineChubbySpriteA-StarActionCoo-eeKofolaMirindaFrostieFreshkyFreewayBlueSky7SelectTeaSodaBigColaGlinterJ-drinkBluedioHansensEnglishBuddiesExtensyDrPepperPibbXtraJarritos...

My first 50 words 2023-02-14

50 Items: unoaguataximesarojovidacasaniñacafégatoniñoazulcamamujerfaldaaviónplumahotelamigoperrorelojsillacochenegrobolsoángelinglésblancoshortsdinerohombrecomidabailarciudadlibroszapatosnaranjavestidobotellamanzanaamarilloparaguasnoticiaschamarraenfermeraluz/ligerohamburgesacocinero/chefcompañeros de clasepantalón de mezclilla

L'Ecole Word Search 2024-11-22

46 Items: PEartlawgymmatheasyhardclassgradeschoolfrenchI loveI hateofficeusefulsciencebiologyphysicshistoryspanishenglishlibrarydiplomauselesshomeworkeducationchemistryeconomicsgeographycafeteriaphilosophypsychologyhumanitiesarchitcturescholarshipI don't likeI really likefashion designsocial studieshigher educationComputer sciencepolitical science...

Hard Word Search 2026-04-15

105 Items: BusArtGymTapeMathDeskBellPensTestQuizDrawReadExamLunchSmartBooksNotesChairMusicRulerTeachClassWriteGradeClockChalkCoachGlobeCubbySchoolApplesPencilSnacksFolderSportsLockerBinderEraserLessonCrayonsScienceEnglishWritingMarkersSpanishHistoryAlgebraBiologyGeologyProjectLibraryHallwayStaplerTissuesJanitorScissorsNotebookLearningComputerTeachersStudents...

find 13 English word FOR THE ROCK SUS AND A COOKIE 2022-08-26

11 Items: p.emathschoolfrenchuniformcanteenteacherhistorystudentsscienceshomework

French Word Search 2024-11-22

46 Items: ArtLawGymEasyHardIloveClassGradeSchoolFrenchI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessHomeworkEducationChemistryEconomicsGeographyCafeteriaAbove allPhilosophyPsychologyHumanitiesphysique PEScholarshipArchitectureI really likeFashion designHigher educationComputer sciencepas I don’t likeForeign languages...

Activity Word Search 2025-12-18

104 Items: ITPENamagebeddaydayhatjamMayartfunnamefacehometimeweekchipkitecampbikeroomtreecitytownJuneJulygameJapanteethclockbreakmusictodayclasspartywaterjuicegrapeAprilhorsepianothingsportmathsstoryMarchfriendschoolMondayFridaySundaysurveyguitarsummerflowergardensingerlettersportsAugustgoodbyeEnglandAmericacountryroutineweekendTuesdayJanuaryvillagescience...

Middle School Chapter Coming to an End! 2026-05-13

104 Items: HopeGoalsUnityBeginFutureGrowthDreamsVisionEffortLegacyLockerCampusRisingAspireUpliftStriveLaunchJourneyAimhighBelieveAchieveCourageBraveryRespectSupportPassionGoodbyePencilsScienceAlgebraHistoryEnglishWritingReadingForwardFreshmanMovingupProgressAmbitionStrengthKindnessTeamworkMemoriesFarewellYearbookHallwaysBackpackTeachersSubjectsProjects...

francais 2024-11-22

46 Items: PELawGymEasyHardClassGradeSchoolFrenchI loveI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessL’artArtHomeworkEducationChemistryEconomicsGeographyCafeteriaPhilosophyPsychologyHumanitiesScholarshipArchitectureI don’t likeI really likeFashion designComputer science(les maths) MathPolitical scienceEspecially/above all...

French Word Search 2024-11-22

45 Items: artlawgymeasyhardclassgradeschoolfrenchi lovei hateofficeusefulsciencebiologyphysicshistoryspanishlibrarydiplomauselesshomeworkeducationchemistryeconomicsgeographycafeteriaphilosophypsychologymathematicsscholarshiparchitecturei don't likei really likefashion designsocial studieshigher educationcomputer sciencepolitical scienceforeign languages...

French Vocab 2024-12-02

46 Items: ArtLawGymMathEasyHardClassGradeSchoolFrenchI loveI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessHomeworkEducationChemistryEconomicsGeographyCafeteriaPhilosophyPsychologyHumanitiesphysique PEScholarshipArchitectureFashion designSocial studiesHigher educationComputer sciencepas I don’t likePolitical science...

Activity Word Search 2025-12-18

104 Items: ITPENamagebeddaydayhatjamMayartfunnamefacehometimeweekchipkitecampbikeroomtreecitytownJuneJulygameJapanteethclockbreakmusictodayclasspartywaterjuicegrapeAprilhorsepianothingsportmathsstoryMarchfriendschoolMondayFridaySundaysurveyguitarsummerflowergardensingerlettersportsAugustgoodbyeEnglandAmericacountryroutineweekendTuesdayJanuaryvillagescience...

All FMS Staff 25-26 2026-05-04

110 Items: LuiYeeDayKullPhamLaraVolkKhanEmigParkClayMezaSyedErvinSmartPatelJonesOtteyBlackClarkChienReddyJonesRajidGodoyCraigLewisBakerKundeHealyEnnisLucasOlsenMunozGreenPatelKasimQamarTovarYassinSalmonPostonLuehrsStankeCastroWassonHaulcyHolbakHarrisAberleMindesBertaoCourisGarciaCarmelBhatiaMcCrayValdezKavetiMunshiRanjanPulimiTrevorPrewettLidsterBuckley...

Anna & Kim's friendship puzzle 2026-05-23

20 Items: Patatas _____Where Kim lived____ de ValenciaReally long parkWhere Anna livesTorres de ______City where we metIk hou van _______Valencia's festivalCopa de _____ _____Classic Spanish meatWhere we travelled toAnna and Kim's fav drinkEveryday at 2pm in MarchThe bike that will kill usWhere Kim goes to get tattoosEx: Cabanyal, Malvarossa, Saler......

First phase you see is your English plan for May 2026-04-30

9 Items: READABOOKSINGASONGWATCHAMOVIELEARNGRAMMARTALKTOMYSELFTALKTOFRIENDSWRITEAJOURNALDREAMINENGLISHBINGEATVSERIES

My first 50 words 2023-02-14

50 Items: unoaguataximesarojovidacasaniñacafégatoniñoazulcamamujerfaldaaviónplumahotelamigoperrorelojsillacochenegrobolsoángelinglésblancoshortsdinerohombrecomidabailarciudadlibroszapatosnaranjavestidobotellamanzanaamarilloparaguasnoticiaschamarraenfermeraluz/ligerohamburgesacocinero/chefcompañeros de clasepantalón de mezclilla

French School Word Search 2024-11-22

46 Items: PEartlawgymmatheasyhardclassgradeschoolfrenchI loveI hateofficeusefulsciencebiologyphysicshistoryspanishenglishlibrarydiplomauselesshomeworkeducationchemistryeconomicsgeographycafeteriaphilosophypsychologyhumanitiesarchitcturescholarshipI don't likeI really likefashion designsocial studieshigher educationComputer sciencepolitical science...

French Vocab 2024-12-02

46 Items: PEArtLawGymMathEasyHardClassGradeSchoolFrenchI loveI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessHomeworkEducationChemistryEconomicsGeographyCafeteriaPhilisophyPsychologyHumanitiesScholarshipArchitectureI don't likeI really likeFashion DesignSocial StudiesHigher EducationComputer SciencePolitical Science...

Famous First 2022-10-06

10 Items: first man on the moon.first woman to fly in space.first man to climb Mount Everest.first man to fly around the world.first woman to climb Mount Everest.first man to fly across the Atlantic.first man to swim the English Channel.first person to break the sound barrier.first woman to fly solo across the Atlantic....

Sukkot - Shemini Atzeret 2024-10-13

11 Items: G-d with us“Our Wilderness”The number of completionA flimsy tent like dwellingThe number meaning “A new beginning”Sukkot is observed 15 days following—None of this will happen in New JerusalemSukkot is usually translated to English as —How many gates on the city walls of new JerusalemHow many moedim are we required to appear in Jerusalem-...

WHO ARE MY CLASSMATES AND MY ENGLISH TEACHER? 2026-03-16

7 Items: MBFELIPEMELISALAUTAROLISANDROBAUTISTA

Fahrenheit 451 Word Search 2024-01-16

10 Items: Montag's selfish wifeThe girl who was killedA device used to shoot fireA retired English professorA chemical used to burn thingsThe captain of all the firemenThe main character of the storyA group of people who burned the booksA fireman who is responsible for burning other people's houses...

Ian Reformation 2026-04-17

12 Items: Started the JesuitsEnded the 30 Years WarBelieved in PredestinationThere were this many SolasThe years of the war in GermanyThe man that started AnglicanismAdvocated the bible not the popeThe man who made the printing pressCondemned the practice of indulgencesThe year in wich the 95 theses were writtenOne of the Five Solas. Meaning Scripture Alone...

Los saludos y las despedidas (Review) Nombre:_____________________ Nester S2 2024-08-07

15 Items: very good!good eveninggood morning!see you later!good afternoon!My name is......you say it to say good-byewhen you are having a rough dayyou are saying see you tomorrow!you want to know somebody's nameyou want to know how old a person isit's informal to know what's going oninformal greeting, similar to Hi in English...

Renaissance word search 2024-10-08

15 Items: Had 6 wiveswrote 95 thesesof the archangelsbegan because tradeA painter and inventorThe hunt for "witches"The way of seeing peopleWhere the renaissance startedThe body of religious teachingsWas influenced by martin lutherTo make things smaller or largerMade one of the most accomplished sculptorsOne of the longest and brutal war in history...

find 13 English word FOR THE ROCK SUS AND A COOKIE >:3😏 2022-08-24

13 Items: p.emathmealtablelunchschoolchairsuniformcanteenhistoryteacherhomeworkplayground

The word guesser 110 2024-11-20

110 Items: catsadmadmapcapzaphatfargumartbeebinlionfirezerohoopboathardeasytallstargoodevilgluebearhairfairzebrahippochessangryjapansushiwaterhappystylekarmasigmachinahelthvideogamesitalypizzachilitrainsantaflutemangomusicmoneytigerclocklunchchalkboardspicytablegrassbooksgooglefamilyschooljelousdoctorpencilcrayonhotdogpeppereasterpoodleviolinbrainsmovies...

School in Japan 2026-06-01

39 Items: ITArtP.E.MathsMusicDramaRecessschoolScienceHistoryHome EcteacherHomeroomPeriod 1Period 2Period 3Period 4Period 5Period 6GeographyLunchtimeHumanitiesYear/GradeUniversityManual ArtskindergartenI study _____.Primary SchoolSchool SubjectsI/me (only boys)Religious StudiesJunior High SchoolSenior High SchoolI'm bad at _______.I'm good at _______....

Present Simple Verbs 2026-01-15

14 Items: She (teach) English.She (kiss) her baby.He (brush) his teeth.He (jump) on the trampoline.John always (rush) to class.He (kick) the ball very well.She(cook) breakfast at 8:00am.Amelia (walk) to school every day.She (watch) tv before going to bed.The dog (push) the ball with his nose.The student (read) a book every night....

RMGS History 2024-10-16

14 Items: Eleanor of...'A troublesome priest'First of the Tudor monarchs'Rebirth' of ideas in EuropeCivil war in the 17th centuryRevolution that started in 1789Conquered England in the 11th centuryLatin for 'great charter' - Magna .....Hebrew word for 'calamity', 'destruction'A significant individual in the Reformation...

Hardy - English 10 2025-04-11

2 Items: PresideManifest

Mixed tenses verbs wordsearch 2025-02-11

12 Items: I (visit) paris since 2016I(lose) my keys yesterday.I (never/eat) Sushi before.I (see) that movie last week.They (go)to the park yesterday.He (play) this game since 2016.We (play) football when it rained.She ( study) English for four years.She (read) a book when the phone rang.She (live) in this city for two years....

Gr.2 English-S2-Week1-Unit 2-Basic-Word Search 2024-11-07

8 Items: intheusefoodpreywatershelterpredator

Giant Word Search for ESL 6th Grade (1st Version) 2026-02-02

120 Items: hotsadredMayeggcoldcoolbusyfinegoodsickmathstarbluepinkfallJuneJulycornnutsbeefporkfishHellonightsunnyrainysnowyhappysorrytiredmusiccrossheartgreenblackwhitebrownMarchAprilapplebeanslemonmangomelononionpeachcloudyMondayFridaySundayhungrysleepycirclesquareyelloworangepurplespringsummerautumnwinterAugustbananacarrotcherrygrapesorangepotatotomato...

French Vocab 2024-12-02

46 Items: ArtLawGymEasyHardClassGradeSchoolFrenchI loveI hateOfficeUsefulScienceBiologyPhysicsHistorySpanishEnglishLibraryDiplomaUselessHomeworkEducationChemistryEconomicsGeographyCafeteriaPhilosophyPsychologyphysique PEScholarshipArchitectureFashion designSocial studiesHigher educationComputer science(les maths) Mathpas I don’t likePolitical science...

Paragraphs and Essay Writing 2025-11-05

16 Items: finishinga big lettera small letterwhat it is aboutto make a letter bigfirst, _________, third5 paragraph writing assignmentthe world's best baseball teama book with words and synonymsa book with words and definitionsa group of sentences with a related topica phrase that you write at the top centerthere are 26 of these in the English alphabet...

By-Election Losers since 2019 2023-10-31

19 Items: with envyKleptomaniacson of Patrickadept at making barrelsTiger in the Jungle Book1996 Formula One Championthe groover from vancouverVs Lion and nearly a Turkeya typical teenager's bedroomdamaged the governor's districtput undergarment in the rubbishtaking the courage out of the camelshortest reigning Monarch of England...

Personalized 2025-08-18

20 Items: favorite foodFood shoppingaccompanied byFavorite colorMans best friendway to cheer you upOur favorite 2pm gameSpeaking into existenceFavorite after work placeOne of your favorite mealsexpressing the future tensethe day of the month or yearmove from one place to anotherI call you this in the morningsyour way of ending a conversation...

Fly High 3 2026-05-05

113 Items: upshymapArtskiMaysunbuyauntflagtaximeatleafshowbirdlateJuneJulyrainsnowwindcooktalkmakewashdishropewaitmovestopunclecreamshirtsmileplanemoneyMathsalbumpandaearlyMarchAprillearnboredfloortastechasethiefbravefightswingtowelargueAfricacousinFranceGreececheesedinnerTurkeyshortsticketMondayFridaySundayletterparcelwintersummerspringautumnAugustcinema...

important people in early colonies 2023-01-30

14 Items: married pocahontasminister at Plymouthsecond governor of Plymouthfirst governor of Jamestownfirst child born in New Worldplanned first settlement of Georgiasaid, "you don't work you don't eat"a missionary from The Great Awakeninghired to protect Pilgrims at Plymouthfirst black woman to have book published...

Determinants of malnutrition in the Ikageng community 2024-07-29

7 Items: Clinic located in Ikagengmeaning of Ikageng in EnglishPrimary language spoken in Ikagengname of the DSD center we visted in Ikageng1 of the 3 burdens of malnutrition recognized by UNICEF conceptual frameworkCommunity we used as target population to determine possible causes of malnutrition...

Vocabulary - Kids Box 6 | Page 78 2024-10-05

11 Items: They spoke Latin.An ancient language from Rome.A way to show events in order.The Normans spoke this language.A tribe whose name starts with "J."To enter and take control of a country.The name 'England' comes from this group.People from France who invaded England in 1066.Areas of land with their own names and leaders....

Food Local 2025-11-11

10 Items: Bakso is usually served withWhat is the taste of sambal?What is nasi goreng in English?What is the main ingredient of rendang?What sauce is usually served with satay?What is the main ingredient of gado-gado?Which food is made from fermented soybeans?Which local food is wrapped in banana leaves?...

Food Local 2025-11-11

10 Items: Bakso is usually served withWhat is the taste of sambal?What is nasi goreng in English?What is the main ingredient of rendang?What sauce is usually served with satay?What is the main ingredient of gado-gado?Which food is made from fermented soybeans?Which local food is wrapped in banana leaves?...

Anguilla 2025-08-12

13 Items: - The national song.- The national tree.- The national sport.- The official language.- The capital and main town.- Anguilla's national motto.- The highest point on the island.- The original Arawak name for the island.- The national bird, also known as the turtle dove.- A large, uninhabited island to the east of Anguilla....

Find the words related to family in English(Ache as palavras relacionadas a família em Inglês) 2024-11-19

22 Items: SonAuntWifeNieceUncleCousinFatherMotherNephewSisterBrotherHusbandParentsChildrenDaughterGrandsonSiblingsStepfatherStepmotherGrandfatherGrandmotherGranddaughter

Unit 3 2023-10-05

10 Items: The _______ was a great succes.The film on TV today was __________.The english test is very ________ for me.There are lots of __________ in the museum.She was _________ by her very silly mistake.I wanna give him a box of _______ for a gift.I want to ________ a very amazing birthday party.There was an _________ film on TV this afternoon....

Lydia 2025-04-23

10 Items: Specific form of puritans.He was from the Czech Republic.Peace treaty after 30 years war.Dedicated teachers and missionaries.Body made up of clergy who sought out heretics.Emphasized Sola Scriptura and was from Switzerland.A woman who Emphasized spiritual connection with God.He was from northern France and wrote a book about predestination....

Ch. 10 Oceania Word Search 2025-03-12

9 Items: Low islands made of coral.Australian throwing sticks.The practice of farming fish.A treaty between the British and the Maoris.Musical instrument played by Australian Aborigines.Laws that regulated every aspect of life in ancient Hawaii.The first English ships that brought convicts to Australia....

Chapter 10 Teaching and Learning with Technology in English and Language Arts 2023-10-23

10 Items: digitalreadingliteracystandardsmultimodaltechnologyvocabularystrategiesinformationcomprehension

CH 10 Teaching and Learning with Technology In English and Language Arts 2022-03-29

10 Items: DigitalBlendedGrammarLiteracyDiversitySimulatedOutliningLiteratureInteractiveCollaborative

Shakespeare - Impact on Language 2025-08-01

15 Items: "Blue."Iambic pentameter.A group of singers.English playwriter and poet.Main events that in a story.Conversations between characters.An indirect reference to a person.A long speech given by a character.A joke exploiting different meanings.Brief instructions followed by actors.Things that happen in a play or story....

Español 2A 2024-02-01

50 Items: IheforsheeasyWho?lunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthi needboringI havespanishenglishseventhamusingto teachto studyto speakyou needfavoritelets seeyou haveart classdifficultmore…thantechnology(feminine)mathematicsyou(formal)the class ofthe schedulethe homeworkyou (formal)science classin the…..houryou(familiar)...

mixed 2025-05-01

122 Items: buscardogcatpigyatewizztaxilegogoatlambrungrangtrainguardfaultleedsplanegreenblackwhitemathsblankqueenbleekplacemusicpianocelloviolabrasssignaldundeeticketenginedieselyellowspookyburialguitarrailwaystationjourneydelayedjubileetauntonsaltasheasyjetenglishsciencephysicsbiologybeetleshamstertrumpetstringsbakerloovictorianorthernpenzanceplyomuth...

Literary Terms 3 2025-12-07

25 Items: Brief overview.Hinting future events.Using humor to criticize.Systematic investigation.Asking questions to learn.irony Unexpected outcome.Speed and rhythm of a text.Combining multiple sources.Distinctive way of writing.Scene set in an earlier time.Restating in different words.Line continuing without pause.Revising text for correctness....

Unit IV Review: Abs-sci-ment 2024-05-17

22 Items: ______ the Terrible_______ WollstonecraftThe Index of _____________The belief that one should doubt everythingEmpress of Russia known for her Enlightened ideasThe spread and mixing of various cultures and ideasThe idea that the sun is at the center of the solar systemA child who ascends to the throne following a parent's death...

Food Local 2025-11-11

10 Items: Bakso is usually served withWhat is the taste of sambal?What is nasi goreng in English?What is the main ingredient of rendang?What sauce is usually served with satay?What is the main ingredient of gado-gado?Which food is made from fermented soybeans?Which local food is wrapped in banana leaves?...

Silas reformation 2026-04-17

12 Items: was a major agestared the Jesuits.Paul lll summoned who?of the father, swiss church.this protestant comes from Martin luther.This protestant comes from King Henry VIII.faith-Both Catholics and protestants spread whatfive main what? (hint Scripture alone, Faith alone…)Translated the bible from hebrew and greek to english....

日本語①ワードサーチ 2025-01-27

25 Items: RedPinkGoldBlueNiceEasyMathGreenBrownOrangeYellowSilverPurpleStrictSchoolBad AtHistoryEnglishTeacherGood atDifficultThing you're bad atThing you're good atSocial Studies/SocietyELA/Japanese Class in Japan

Chess Word Search!!!!! 2024-11-20

122 Items: LiPinTalPawnRookKingForkSvenEmirBestGoodBookMissChessCheckQueenWallyBobbyRapidDailyBlitzGreatTempoKnightBishopSkewerCastleMartinMorphyLaskerBulletPuzzleScotchFrenchIndianMcLainMrRothAjedrezChesserAntonioChessinGukeshDEnglundEnglishItalianMistakeBlunderTyrannyChessingSicilianBluunderZugzwangCheckmateEnPassantDingLirenAnderssenBrilliantExcellent...

Reformation - Henrique 2025-04-23

10 Items: knwon for being a mystica method of dealing with heresiesTrity that ended the Thirty Years'Warsummoned a council to clarify Catholic teachingsIgnatious of Loyola started this a group of missionariestranslated Bible to English; shaped much of the KJV Bible3 Main Protestan denominations: Lutheranism, Calvinism, _____...

A Delightful Crossword 2025-09-18

6 Items: The lead member of one of Britain's best music groupsan English musician known for his spectacular songwritingan influential band from Swindon that lasted from 1970 to 2006a Czech-German artist, most famous for his psychedelic illustrations.contemporary, popular music designed for mass appeal, characterized by catchy melodies...

Verbs with -ING 2025-11-12

18 Items: Jason is ............. a book.Jaime is ........... to David.Jonas is ................ his car.The teacher is ........... a story.Mrs Smith is ........... her tablet.My friends are ............. a film.I'm ................... to music now.Mike is .............. on his notebook.I'm ............ a photo of my friends....

Jamestown Word Search 2024-12-13

15 Items: founded in 1607Colony for English Catholicscolony for pilgrims and puritansClimate of the New England coloniessocial contract signed by the PilgrimsLarge southern farms that grew Cash Crops1st Anti-Slavery Group in the 13 ColoniesNorthern slaves worked in these occupationsBritish controlled trade, angered colonists...

Word search <Level MAX> 2023-07-20

3 Items: beautifulenglish music grandmother sister tuesday saturday hungrydance draw drink enjoy like listen look make meet play practice read ride sound stay swim visit walk want watch write three seven eleven dinner season winter basketball homework

Spanish 2025-01-29

56 Items: iheweforyouyousheeasywho?theytheylunchclassfirstthirdfifthsixtheigthninthtentha loty'allsecondfourthi needboringi haveEnglishseventhyou allto teachto studyyou needfavoriteyou haveart classdifficultpracticallet's seetechnologycalculatordictionarymathematicsinterestingmore...thanthe class ofthe schedulethe homeworkamusing, funSpanish class...

A Delightful Crossword 2025-09-18

9 Items: The Bassist of XTCBritain's most well known music groupA second leading member of the Beatlesan English musician known for his spectacular songwritingThe lead member of one of Britain's most famous music groupsan influential band from Swindon that lasted from 1970 to 2006a Czech-German artist, most famous for his psychedelic illustrations....

Yom Yerushalayim 2023-05-04

17 Items: What is the Kotel?What do we do to celebrate?Who did Jordan team up with?What year did the war happen?What did the Jordanians stealHow many days did it last for?How many tanks did Israel have?What did the Jordanians destroy?What Arab country invaded Israel?What month did the war happen in?What did the Jordanians take over?...

Phone Word Search 2023-12-28

9 Items: electrical applienceOther word for "behind".The city in Northern Ireland.The Day of pink T - shirts is fight against...Emotions because we are do not to do any obligations.When we get bitten by a mosquito, the consequence is...Actions we do in free time because we love that and we good at....

English 2026-03-25

1 Item: pulpless, permeate, innuendo, nobility, earnestness, tempestuous, hilarity, echolalia, quartet

Kimetsu Gakuen!! 2025-04-24

133 Items: ArtRuiMathGotoSumiKiyoNahoEnmuMizuZuhaYunaDoumaMusicCivicsTamayoHealthMakomoManagiTakadaSabitoPlacesYahabaRokuroHistoryBiologyEnglishCherukaParentsKotetsuKengYinPotionsSumaUzuiLawGroupStudentsCuteShopAkiraYinKokushiboChemistryLibrarianMakioUzuiKieKamadoSweetShopRumorClubDramaClubLowermoonsKanaeKochoTengenUzuiTennisClubAoiKanzakiUmeShabana...

Level 3 Whakarongo Vocabulary List 2026-02-12

53 Items: - way- law- boys- send- feed- Walk- dawn- home- sing- girls- these- faith- learn- dance- school- desire- priest- Listen- famous- fluent- expert- basket- private- parents- lessons- teacher– do/work- English- student- children- Minister- Hastings- remember– pole/end– last/end– say/said- forgetful- different- wellbeing– all of us– Army cadet...

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

Galen Faculty Word Search 2024-06-28

14 Items: Dean of FAST.The newest dean.Dean of Business.Email him if you can't access Moodle.Very knowledgeable on indigenous rights.Environmental science students know her well.She has a long history and experience in tourism.He's another tourism teacher with vast experience.He's criminal justice students' favorite lecturer....

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

ENGLISH 2024-06-19

1 Item: boony

English 2026-04-21

1 Item: question,identify,analyse,evaluate

education 2025-10-27

19 Items: Synonym of test.The study of numbers.To study for an exam.A mark on an exam or course.School after primary school.The opposite of public school.The days and times of classes.The opposite of pass (a test).After an exam, you get the _____.University graduates have a _____.A period of time in a school year.The study of novels, plays, poetry....

Spanish Vocab 5 2024-10-30

51 Items: heweforwhosheeasylunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthI needboringI haveenglishseventhto teachto studyyou needfavoriteyou haveart classdifficultpracticalcalculatordictionarythey(fem.)mathematicsinterestingyou(formal)they(masc.)the class ofthe schedulethe homeworkamusing, funspanish classscience classsocial studies...

Irregular verbs - week 5 2026-03-31

10 Items: To stop sleeping (You __________ up early.)To use your mind (You __________ about the answer.)To say something to someone (You __________ a story.)To have clothes on your body (You __________ a jacket.)To send something through the air (You __________ the ball.)To break something by pulling it (You __________ the paper.)...

English 2025-08-27

1 Item: strawberry, pineapple, guava, grape, peach, plum, avocado, banana, pear, dates, sheep,giraffe, snake, leopard, shark, dolphin, squid, hedgehog, ostrich, camel, lion, tiger, eagle, bird, fish,judge, lawyer, artist, butcher, captain, seller, florist, teache

Adjectives + prepositions 2026-04-21

12 Items: I am very _ of my grandmother.I am not _ to waking up so early.He is _ to improving his English.She is _ for organizing the event.He was found _ of cheating in the exam.She is _ of solving difficult problems.She feels _ with her life at the moment.This information is not _ to our discussion.The city is _ for its beautiful architecture....

10th Grade Pre-AP English 2 Unit 2: Persuasion in Literature Excerpt from "The Adventures of Tom Sawyer" 2025-10-19

29 Items: gaitpompchapjeerwagemusewendcovetresumenibbledaintyabsorbreckonhollowworldlyslackenconsenttranquilridiculeintervalalacritydeliciousmelodiousstarboardlaboriousexpeditioncontemplatedilapidatedcircumstance

Luci Reformation 2026-04-17

12 Items: Made the printing press.Known for “Christian Humanism.”Made a new church to divorce his wife.The church that King Henry Vlll created.Posted the 95 theses on October 31, 1517.The peace treaty that ended the 30 years war.Translated the first english bible from Greek.The church established this to deal with heresies....

Friday, September 1, 2023 2023-08-31

7 Items: Another name for a fight is c____________Who led the British soldiers from Virginia?The British offered the same goods at a l______ costThere are _____________ British colonies in North AmericaWho took over the planning for the war in 1758? W__________ P______The French and British started sending troops and s_______ to North America for the war...

AMS Word Search 2025-06-24

16 Items: The city of AMSThe mascot of AMSThe state we live inThe school district of AMSThe subject where you use numbersA class where people learn to actA class where people learn to singThe colors of AMS are red and _____?The subject where you do experimentsA place where you can check out booksThere are two of these in a school year...

Review Unit 1 and Unit 2 2025-10-04

2 Items: gym, reading, science, math, English, art, computers,homework, grade, flowers, rice, fruit, bike, camera, markers, building, bricks, guitar, robot, skateboard, tablet, cool, old, new, borrow

Present perfect 2025-05-16

15 Items: Have you __________ seen a ghost?I have __________ been to PortugalHe __________ just told me the news!I have ____________ done my homework.Have you ever __________ mango juice?Have you ___________ any news from Bartek?Zmęczykot has never ____________ fried octopus.I haven't _____________ my essay for Polish yet....

Elalmuerzo Word Search 2024-10-31

56 Items: ihewefunforwhoyousheeasylunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthi needboringi haveenglishto talkseventhto teachto studyyou needfavoritelets seeyou haveart classdifficultpracticalmore thantechnologycalculatordictionarymathematicsin the hourinterestingthe class ofthe schedulethe homeworkyou (formal)spanish classscience class...

Spanish Chap. 2A 2026-01-20

56 Items: IheweartforsheeasyWho?lunchclassfirstthirdfifthsixthninthtentha loty'allsecondfourtheighthI needboringI haveSpanishscienceEnglishto talkseventh...classschedulehomeworkto teachto studyyou needfavoriteyou havedifficultpracticalLet's seecalculatordictionarymathematicsamusing/funinterestingmore... thanyou (formal)social studiesin the... hour...

Spanish vocab man 2026-01-27

56 Items: Iheartfunforyoushemathtecheasyhaveyalllunchclassfirstthirdfifthsixthninthtentha lotquiensecondfourtheighthI needboringI havewe allspanishscienceenglishto talkseventhschedulehomeworkTo teachTo studyyou needfavoritelets seelaclasededifficultpracticalmore thancalculatordictionaryyou formalinterestingsocial studiesyou all formalin the ... hour...