end of school Word Searches

100th Day 2026-01-28

26 Items: daynewfunhatsstarstotalcounteventschoolprizesfamilyheroescontestfriendshundredclassesstudentsballoonsteachersprogressfantasticeducationcelebrateactivitiesfriendshipachievements

COMFORT DOGS 2026-02-03

24 Items: DOGAIDDOGSREHABLOYALSCHOOLSTRESSREDUCELOVINGGENTLESUPPORTHANDLERPRESENTCALMINGANXIETYTRAININGHOSPITALRETRIEVERDEPRESSIONEMPATHETICTHERAPEUTICTHERAPEUTICAFFECTIONATECOMPANIONSHIP

Guess What? It's Greek! 2026-03-12

26 Items: IdeaChaosDramaMusicCrisisEnergyGalaxyMethodPlanetPoetrySchoolSystemTheoryBiologyHistoryPhysicsProblemProgramTheatreDemocracyGeographyTelephoneMicroscopePhilosophyPhotographTechnology

Places in the community 2026-03-24

26 Items: gymparkbankhotelchurchmosquebakeryclinicschoollibrarybookstoredrugstorecafeteriahairsalonlaundromatpostofficebusstationrestaurantgasstationfirestationsupermarkettrainstationgrocerystorepolicestationdepartmentstoreapartmentbuilding

The Watsons Go to Birmingham (Chp 1-4) 2026-04-06

28 Items: KennyByronFlintByronIceboxJoettaSchoolAlabamaBupheadhostileemulateMrWatsonMichiganJuvenileRoadtripSiblingspunctualgiganticblizzardMrsWatsonDinosaursUltraGlideBirminghamBirminghampassionateSegregationknuckleheadreinforcements

Languages of French Polynesia 2026-04-08

23 Items: RapaNameHelpLoveSeatPapeGameHelloWaterRulesFrenchThanksSchoolPhrasePointsGoodbyeStudiesTahitianSentenceTuamotuanRa'ivavoeMangarevaMarqueasan

Vegtable Production Unit 19 2024-10-01

15 Items: soil.hydrocooling— plant with one seed leaf.— plant with two seed leaves.— the cultivation of vegetables.— an area deficient in rainfall; dry.— plants grown from seed in special structures.— an area partially deficient in rainfall; dry.— one who studies the cultivation of vegetables.— rapid removal of heat before storage or shipment....

Is christ the messiah? 2025-12-21

10 Items: KingPriestProphetAnointedSon-of-GodSufferingsIncarnationCrucifictionDescendant-of-DavidBirth-from-a-virgin

#FINDINGDAHL - Matilda 2024-10-05

10 Items: The real name of Miss HoneyThe name of Matilda's brotherThe name of Miss Honey's fatherThe real name of Miss TrunchbullThe age when Matilda started readingThe name of Matilda's favorite authorThe title of the first book that Matilda readThe animal that was in Miss Trunchbull's glassMatilda's favorite book in the children's section...

Helena 2025-07-18

20 Items: The dark daysHumbling Jess DSeasick inducingHelena’s homebodyHelena’s sloppy messHelena’s secret loverThe accused trip copierLovergirl but …… at heartUnleashes chaos with 1 sipHelena’s acting debut & endHelena’s iconic granny shoeMadison’s creative stories outletYear 11 ultimate threat against MadsA fiery character with a heart of gold...

School 2025-10-14

5 Items: BagTableChalkMarkerSchool

School 2026-03-17

5 Items: PaperPencilTeacherStudentNotebook

School 2025-01-30

5 Items: labgymschoolstudentclassroom

Senator Myrie's Valentine’Z day Legislative Wordsearch Game 2026-01-22

19 Items: __ and kisses!Roman messenger of love.Moral soundness and honesty.Red flowers that say “I care.”The organized body that makes laws.Area of law dealing with wrongdoing.A symbol often shown in red and pink.Sweet treats shared on February 14th.A plan or plot — sometimes dishonest.Relates to online coins like Bitcoin....

Sukkot 5.0 2025-10-05

24 Items: Sukkot is for how many days?“_____ to God is the highest,“So you are to keep my _________ …”Your offerings should be ________ ?Observing the festivals are ________ ?There are how many appointed festivals?“You must not profane my _______ ______”What day of seventh month is Yom Kippur?What day of seventh month starts Sukkot?...

Best friends for never word search 2024-10-21

13 Items: fallgirlrichpartyphonespookyschoolpopularfashionseasonsnot coolhalloweenfriends for never

My Chemical Romance 2026-05-04

75 Items: deadlolazerobatsbloodpansysleephelenacancerjetsetnananaphantomthe endray torokilljoysjet starvampiresdestroyacubiclesmikey wayfun ghoulkobra kidthe zonesteenagersdeathwishscarecrowambulancegerard wayfrank ierolate dawnsnew jerseymother warsummertimedanger daysmonroevilledesert songparty poisonbattery cityi'm not okayway brothersghost of you...

SCHOOL 2023-10-05

5 Items: spellchairwriteboardbequiet

Heidi Heckelbeck 2014-12-08

27 Items: meepzingpinkmicedramayummytoadsbaconmeaniefriendsecretschooljewelsspellsgrouchytroublebubbleshogwashglitterwitcheswafflesfrankieshowtimebejeweledchocolategrumpsvillegingerbread

In the street - 2 2016-08-08

27 Items: boxroadtownhallphoneschoolbinmenthingspeoplelibrarypostboxbusstoptownhallshoppersvisitorspavementhospitalmotoristsTjunctionlitterbincashpointspeedbumpbuildingsroundaboutpedestrianszebracrossingpolicestation

Welcome back to ACS  2019-08-25

27 Items: pengymartmathSTEMgrademusicbusesschoolpenciltritonfourthtypingsocialWestonCabralticketshistoryEnglishsciencestudiesForrestexcitedAtlantisnotebookCampbelllearning

SAT Word Search 2023-04-11

27 Items: timefocusproudessayscoreschoolpencilanswerscollegereadingjuniorsstrengthreadblurbconfidencebrainbreakcalculatoreathealthypositivityexcitementyougotthisdeepbreathsmathsectionarriveearlyyouaresmartbubblesheetpaceyourselfdetermination

NCRSP 2023-05-08

27 Items: pacncaecolancrsplocallobbyschoolwarrencountyagendaretiredmissiondirectorbenefitscarolinaadvocacydiscountpersonnelpresidentsecretarytreasurerlobbyistsmembershiplegislativelegislativecommunicatescholarship

WALK WORTHY-- BE A GOOD WORKER 2023-09-26

27 Items: godjobgoodkinghabitskillamourfaithlivedheartlaborworkerethicsbearerisraelblocksschoolchoressoldiertrustedlearnedstrenghtmusicianbelievedbalancedbuildingslingshot

Autumn 2023-10-18

27 Items: cozyautumnclovesschoolnutmegacornsgourdspecanssweaterbonfireequinoxharvestorchardflannelhayridesfootballcinnamonhotcocoacornmazepumpkinsgratefulfestivalhalloweenappleciderdriedleavescranberriesthanksgiving

Thanksgiving 2023-11-13

26 Items: piefallcorncozylovefeastfamilyturkeyseasongatherschoolgobblefriendsharvestpumpkinsharingthankfulnovemberpilgrimstogetherfeathersAmericanwishbonegratitudecelebratethanksgiving

Mrs. Lusk's Word Search 2024-09-24

27 Items: familyschoolfriendfloridpatronbecausebelievefoliagefloristfavoriteexcitingdendriteflourishmaternalbeautifulimportantbeginningportfoliomatriarchpatriarchmatrimonyfraternalpaternityfraternitypatriotismPennsylvaniarhododendron

unit 9 video 2025-05-11

27 Items: seaairtreegrowlakereadplaychildadultplantgrassrivercleandirtylearnteachwriteforestschoolgardenrecycleteacherstudentprotectindoorsoutdoorsenvironment

Phoenix Day Word Search 2025-05-29

25 Items: FUNMAPORRARTSMORANRULERSCHOOLSUMMERALGEBRAGRAMMARPHOENIXSCIENCESTUDIESREADINGWRITINGCOMPUTERGENETICSKARETSKYLEARNINGNOTEBOOKPARKLANDREITNAUERCALCULATORMATHEMATICSSPRINGHOUSE

The Jungle Book Word Search 2025-09-21

23 Items: cubKaaKhankidsCastRoarLouieBalooPropsAkelaBirdsHathiScriptMowgliWolvesCircusMusicalMonkeysTabaquiBagheeraVillagersBackstageElephants

6.1 Heart Words 2025-12-03

27 Items: fewsonlovesoonaboveownedwomanearlysinceminuteanswerschoolfourthhousestowardprettypersonfatheralmostminutesseveralbetweenlearneddaughterfamiliesdifferentbeautiful

Maribyrnong Word Search 2025-12-08

26 Items: AnnaBethMattMahaMarkWakaEmilyWinyuSallyAndrewCircleKambriGaneshKaleenManangSchoolRespectDhirrumGalumbanyEndeavourInclusionResilienceBassanelliYerradhangMaribyrnongResponsibility

Kucera 2026-04-30

27 Items: ASBSafePBISKyleDeskKylieRallyMansoKuceraSchoolCuevasNellonBehaveCoyotesPencilsTestingStudentsClassroomPromotionSmartPassRespectfulChromeBookAssignmentTardySweepResponsibleAlmostFridayMiddleSchool

Mars Patel Episode 7 2026-04-28

27 Items: GymDanceChaseNightMusicPartyTrustSchoolEscapeSecretDronesSignalLaptopDangerRunawayMysteryFriendsZiplineTrackingMessagesSuspenseMidsummerKidnappedTreehouseAdventureFriendshipSurveillance

NJrOTC cfi 2024-12-05

12 Items: lawvirtuecitizenreligionmoralityof powerauthorityprovidencecitizenshiprepublicanismof associationJudeo-Christian

JROTC 2024-12-05

12 Items: lawvirtuecitizenreligionmoralityauthorityof powersprovidencecitizenshiprepublicanismof associationjudeo-Christian

Chemistry Chapter 1 Vocab 2026-02-07

18 Items: A smart guess you can test.Using your senses to notice things.A test to see if your guess is right.A rule that always happens in nature.The study of the composition of matterThe thing you change in an experiment.The thing you measure in an experiment.Anything that has mass and occupies spaceThe study of chemicals that contain carbon...

SCHOOL 2020-10-06

5 Items: teacherlibraryenglishclassroommathematics

school 2025-06-15

5 Items: canteenteacherstudentnotebookhomework

school 2025-09-06

5 Items: buslinejerkbelleClaire

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Foucault Activity 2025-11-21

17 Items: the presumption that heterosexuality is normalthe institutional use of bodies purposes of controlcategorizations, talk, and silences pertaining to social practicesthe code or meanings inscribed in language and other symbols in a given societal contextthe idea that homosexuality and what it means to be gay vary across history and social context...

Vocabulary search 2025-01-23

7 Items: the product of an object's mass and velocityThe rate of change of velocity with respect to timean object's change in position independent of the path takenThe rate of change of position of an object in any directionthe speed in combination with the direction of motion of an objectthe property of the motion of an object traversing a circular path...

Unlocking Vocabulary: "The Danger of Silence" 2026-02-27

10 Items: Pacifying or placating someone by acceding to their demands, often to avoid conflict or further escalation.To allow oneself to enjoy a particular pleasure, often to an excessive degree, or to yield to a specific desire or whim....

Recess Word Search 2025-03-25

7 Items: roomparktoysrecessschoolfriendsbackyard

AFF2 UNIT9 2025-04-05

9 Items: workstoreschoolairportstationstationofficerhospitalfirefighter

Pencil Word Search 2025-07-27

8 Items: BOXRULERPENCILERASERSCHOOLCRAYONSMARKERSNOTEBOOK

Easter holiday 2026-02-10

11 Items: eggsunpopfreecreamgamesbunnyrabbitschoolclothsholiday

Energy 2025-03-19

13 Items: stored energyenergy from the sunheat transfer through wavesenergy of motion and movementpotential energy stored in atomsheat transfer from direct contactrenewable resource of kinetic energythe ability to cause motion or changeheat transfer through liquids and gasescombination of potential and kinetic energy...

Oman National Day 2025-11-19

13 Items: a dry riverbedthe capital of Omanthe place people go to praywhere the land meets the seathe money people use in Omanthe language everyone speaksthe title of the leader of Omanthe most popular animal in Omanthe long white robe worn by menthe name of the ocean closest to Omanthe colour of the mountains in the Khareef...

In English we explore, 2026-02-04

9 Items: Life storiesFilm studiesStudy of languageStudy of word originsStudy of ancient storiesStudy of ancient culturesEvents and facts from the pastNature, places, people et cetera Etc.Study of ancient Greek and Roman cultures

Wavelength Word Search 2026-03-12

11 Items: Reflectionhighest point of a wavea wave of light you can seeThe height of a wave or depththe number of repetitive motionsWhat is the lowest part of a wave?a wave where matter moves back and fortha wave where the matters moves up and downthe bending or changing direction of a waveWhat do you call colours or frequency of visible light?...

ICP Chapter 3 Vocab Words 2025-02-07

15 Items: A push or pullThe sum of all of the forces acting on an objectStates that when one exerts a force on a second objectThe tendency of an object to resist any change in its motionA region of space that has a physical quantity at every pointA force exerted toward the center of a center of a curved path...

VET 246 Wk 6 2022-12-07

19 Items: dog cecumcats "string of pearls"what is used for GI studies?is a type of negative contrastpositive contrast media appears?negative contrast media appears?contrast radiograph of esophagusfirst stage of excretory urographysecond stage of excretory urographyused for gastric emptying and motilitynot used very often, CT, MRI preferred...

Holiday Celebrations Around the World 2025-12-10

28 Items: DayDayYuleYearPoleStarLuciaFeastKinaraLatkesPinataKwanzaaPosadasDreidelMenorahOmisokaHanukkahFestivusSolsticeFireworksTraditionSaturnaliaProcessionPilgrimageCandlelightCelebrationof Strengthof Grievances

ROTC key terms 2024-12-03

12 Items: lawvirtuecitizenreligionmoralityauthorityof powersprovidencecitizenshiprepublicanismof associationjudeo-christian

Weather and Climate 2023-05-14

15 Items: Warm water currentChange in moister contentMeasures the air pressureMeasures the speed of windWarm air that rises rapidlyUsually brings precipitationMeasures the direction of blowing windThe weight of the air pushing down on earth.When the boundry between two air masses stallsMeasures the amount of precipitation that has fallen...

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

SAMPLE GRIDLOCK 2025-08-08

15 Items: An expression of happinessA vehicle that runs on tracksA piece of furniture to sit onThe natural satellite of EarthA large natural stream of waterA plant with a trunk and branchesAn animal with feathers and wingsA white liquid produced by mammalsA staple food made from flour and waterOrganized sound that is pleasant to hear...

Ancient China 2026-04-20

18 Items: What was Chinas first dynasty?What did the Romans refer to China as?Bones which were used to predict the futureWhich large empire did the Ming dynasty defeat?What did rulers of the Zhou dynasty call themselves?What was the name of the most recognized legalist philosopher?What was the name of the general which established the Sui dynasty?...

Mole Day 2023-10-23

10 Items: a mole is like a chemical '_____'a single unit of an ionic compoundthe mass of one mole of a substancea single unit of a covalent compounda unit used in chemistry to count particlesthe smallest particle of a substance that is not bondedthe scientist that the number 6.022x10^23 is named after...

Sustainability Word Search 2025-09-24

10 Items: to provide assistancein a pleasant and gentle waythe state of being without lightan act of choosing between two or more people or thingsnot allowing something to be wasted, damaged or destroyedto act with attention and thought to avoid harm, mistakesstate of feeling or showing pleasure or as the state of being satisfied...

Hiroshima Word search 2025-05-20

31 Items: The year the atomic bombing of Hiroshima occurred.The city that was bombed three days after Hiroshima.The country that dropped the atomic bomb on Hiroshima.The nationality of the majority of victims in Hiroshima.This religious group was affiliated with Father Kleinsorge.A person who lived through the atomic bombing of Hiroshima....

Simple Equine Dental 2025-04-01

24 Items: TMJHayJawVetMarexrayGumsCapsToothFloatCanineMolarsCavityAlfalfaDentistGeldingIncisorsStallionWolfToothPreMolarsClinical: The exposed toothReserve: The part of the tooth hidden in the gumsParrot: An "Overbite" that forms the shape of a Parrot BeakMonkey: An "Underbite" that forms the shape of a Monkey's Mouth

Moses Word Search 2025-05-29

54 Items: GodarmlipsGiveKnowLORDMosesAaronIsaacJacobAmramKorahNadabAbihuEgyptBringSpeakHostsHouseMiriamCanaanGoshenAppearRedeemAbrahamPharaohof LeviEleazarIthamarPromiseBondageHearkenDeliverCommandShaddaiBondageJochebedPhinehasCovenantJudgmentHeritageof heartRememberGroaningHeritageFamiliesGenealogyObedienceEstablishRedemptionDeliveranceGenerations...

Work and Energy 2024-05-30

18 Items: Unit for workunit for energyEnergy that is storedThe ability to do workEnergy that's in motionenergy related to heightenergy of electric chargesenergy stored in chemical bondsenergy from electromagnetic wavesgravitational energy increases with:energy from the vibration of objectsenergy of moving particles in an object...

Flow Word Search 2025-09-15

17 Items: liquid (5 letters)(development synonym)name of movie (4 letters)main character (3 letters)animal that can fly (4 letters)opposite animal of Cat (3 letters)represents Cat's desires (4 letters)what helped Cat develop (10 letters)authorial choice of fish (8 letters)lack of this in the movie (8 letters)animal who helped Cat swim (8 letters)...

Unit 3 Vocabulary Word Search 2025-12-08

17 Items: successfulan armed forceto hold ruling powermade with great detaila rule or code of conductfor the most part; mainlyto take control of somethinga large number of people or thingsa moral, legal, or mental obligationbehavior showing high moral standardsa type of government where the people rulea community of people with common traditions...

Get_Up Word Search 2026-04-07

9 Items: BEDTEETHGET_UPSCHOOLHAVE_LUNCHGET_DRESSEDHAVE_DINNERHAVE_BREAKFASTPLAY_IN_THE_PARK

Yr 9 Atomic Structure 2023-11-07

26 Items: Discovered the electronsAll metal ions are _________Which element is in group 3, Period 3?Which group does not readily form ions?The charge of an oxygen ion is _________ 2The subatomic particle with a negative chargeWhich element forms a -3 ion and has 2 shellsThe periods on the periodic table are the _______...

Unit 13 Word Search 2026-01-31

29 Items: a five-pointed stara shape with four sidesa shape with five sidesa shape with three sidesa period of three monthslikely to argue or fightoccurring every five yearshappening four times a yeara vehicle with three wheelsa solid shape with five facesmade in three identical copiesa musical scale with five notesan animal that walks on four legs...

Asia Minor word search 2026-04-10

20 Items: Who founded the Seleucid empire?What was the capital of the Hittite Empire?What was the Hittites' first major language?What was the name of the Chaldeans’ main god?Which empire finally conquered the Seleucids?who was the first king of the Hittite Empire?Were the Hittites polytheistic or monotheistic?...

Space Stuff 2023-01-03

43 Items: The red planetThe first dog in spaceThe north's stars true nameThe color of a sunset on MarsThe brightest star in the skyThe galaxy of our solar systemA belt between Jupiter and MarsThe color of Venus' sulfur cloudsThe planet called the Water PlanetThe most common gas in the universeAn object that orbits another object...

Medical Terminology Prefix & Suffix - Part 2 2026-03-24

15 Items: the study ofpertaining to bonepertaining to bloodpertaining to musclepertaining to a jointdisease or disorder ofpertaining to the brainpertaining to the stomachpertaining to the bladder or sacsurgical repair or reconstructionabnormal enlargement of a body partdilation or expansion of a body partvisual examination using an instrument...

Complications 2024-12-11

16 Items: what causes DMDcaused by abnormal brain developmentdiagnostic test for plantar fasciitisligament between heal and phalanges is inflammedantibodies block signals between nerves & musclesabbrev. of disorder due to the lack of dystrophintest used to examine how damaged someone's muscle cells are...

Critical Words! 2023-01-07

21 Items: A missionBold and hardypopular DnD showWhere it all beginsScholarly magic userGoing on an adventure!Master of martial artsPriest of the old faithSurvive by avoiding noticeSpellcaster with inherent magicHoly warrior bound by sacred oathMagical people of otherworldly graceInspiring magician with musical powerWielder of magic derived from a bargain...

Enero Word Search 2023-03-03

20 Items: not bad butnot good butopposite of sadopposite of youngcolor of the cloudsmonth of graduationnumber after nineteenhaving a lot of moneyfirst month of the yearhe wasn't handsome he waswhere you go to make moneyif something isn't true it'show you feel after a long daywhen you have a lot to do yourat diez y acho i am still very...

2024 October General Conference 2024-10-04

34 Items: FSYHymnsHoly GhostJesus ChristChild of GodWorld ReportPatrick KearonIf You BelieveDallin H. OaksGerrit W. GongUlisses SoaresHeavenly FatherThink CelestialDavid A. BednarHenry B. EyringQuentin L. CookDale G. RenlundNeil L. AndersenThe New TestamentRonald A. RasbandGary E. StevensonThe Old TestamentGeneral ConferenceThe Book of Mormon...

UNIT 3 VOCABULARY WORD- GRADE 6 2025-11-10

20 Items: a linea false ideaa very wise personto provoke or enrageto ambush, to ensnareopposing war or violenceto appoint; to point outworldwide, internationalan intolerant or biased personextremely puzzling; unexplainabledifference, opposite of uniformitya solemn or sacred promise or pledgespecial calling for one's profession...

sopa de letras : nuestra vida social 2026-04-30

20 Items: Mardi grasTarget,MacysYo form of IRTu form of IrNosotros form of IRVosotros form of IRA place to buy devicesMovies on the big screenEl,Ella,Usted form of IRA place you go for a treatA place to shop with friendsA place to buy needs and wantsA place to listen to music liveA place you go to see artifactsA place to buy things to walk in...

Unidad 3 Repaso de vocabulario 2024-11-20

25 Items: degreeat riskrespectlearningteachingexpensesto adaptsubjectspedagogyteachersleadershipresilienceuniversityintegrationthe purposeempowermentdisabilitiesentretainmententretainmentschool dropoutrepresentaiveslearning communitieshigh school (in Argentina)educacional educational inequalityeducacionales educational challenges

Clause/close/clude/cluse - close, shut, end 2026-04-17

16 Items: closeclosetencloseincludesecludeexcludeclosurediscloseconcludesecludedexclusiveexclusionconclusionconclusiveundisclosedclaustrophobia

Indyart Wordsearch 2023-09-02

12 Items: In winter, Pichwais are made on this type of cloth.Which Goddess is usually depicted in Warli paintings?White mud or Sudda ___ is used to prepare the canvas.In Warli paintings, the rectangular patterns known as?The married women who created Warli art were known as?What are the painters of the Bhil paintings referred to as?...

Unit 1 vocabulary Animals 2026-03-26

14 Items: TO HURTTO NEEDNOT KINDWHERE SOMETHING COMES FROMTO FEEL PAIN OR UNHAPPINESSVIOLENT OR UNFAIR TREATMENT OF SOMEONETO BECOME LIQUID AS A RESULT OF HEATINGSOMEONE'S OR SOMEHTING'S HEALTH AND HAPPINESSA POSSIBILITY OF TROUBLE, DANGER, OR DISASTERTHE SITUATIONS IN WHICH SOMEONE LIVES OR WORKSTHE NATURAL ENVIRONMENT OF AN ANIMAL OR OBJECT...

pythagorean theorem 2022-11-20

15 Items: one of its sidesSquare a number that is the square of an integerPlane a two-dimensional surface formed by two number lines.a number that cannot be expressed as a fraction for any integersSolid the shape or the figure that has three (even higher) dimensionsroot the factor that we multiply by itself three times to get that number....

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Skills Unit 5 Ch 30 Bowel Elimination and Care 2025-07-15

15 Items: Hidden or not visible blood.Outside opening of an ostomy.The process of bowel elimination.Blockage of the movement of feces.Stretching of the intestinal walls.Voluntary control of bowels is lost.Black, tarry stools with a foul odor.Ostomy located in the small intestine.Hard stools that are difficult to pass.Several liquid or watery stools per day....

Word Search 2025-10-28

15 Items: The solid form of waterThe opposite of subtractA shape with three sides.The main gas we breathe in.The first planet from the sunWhat do plants make using sunlight?The biggest planet in our solar systemWhat star gives Earth light and warmth?The hardest natural substance on Earth.What do we call the study of living things?...

2024 October General Conference 2024-10-04

34 Items: FSYHymnsHoly GhostJesus ChristChild of GodWorld ReportPatrick KearonIf You BelieveDallin H. OaksGerrit W. GongUlisses SoaresHeavenly FatherThink CelestialDavid A. BednarHenry B. EyringQuentin L. CookDale G. RenlundNeil L. AndersenThe New TestamentRonald A. RasbandGary E. StevensonThe Old TestamentGeneral ConferenceThe Book of Mormon...

Empowering & Uplifting 2024-06-25

25 Items: Lacking fearGive out a bright lightThe center of interest or activityGive out steady light without flameTrust in yourself and your abilitiesNot deterred by danger or pain; braveFreedom from disturbance; tranquilityA feeling of great pleasure and happinessShowing a heartfelt and powerful intensityRegard for one's own well-being and happiness...

Remain Word Search 2024-01-09

50 Items: betotheendjewsezragodswillhelpprayseektimesfaithworrywallsfocusdoingremainduringstrongarmiesfuturetraveltemplehaggaijewishexilesestherhumblyremainjehovahbabylonreturnsdeclaresproblemsunstableeconomicprophesycompleteconfidentuncertainlifestylepoliticalzechariahconfidentconditionsoppositionrebuildingintervenescomfortable

Fry Words Second Hundred List 3 & 4 2025-09-29

50 Items: ussetputendbigwhyaskmentryoffairdoeswellmustevensuchturnherewentreadneedlandhomehomekindhandplayawaypagelargeagainspellhousepointfoundstudystilllearnworldchangeanimallettermotheranswershouldanotherbecausepictureAmericadifferent

WEEK END SURPRISE 24/11/2023 2023-11-19

12 Items: spanoelfroidhotelalsaceweekendfamillebretzelmassageamoureuxanniversaireflammekueche

Words that END in SILENT /e/ 2024-10-28

12 Items: adorebecameignitebesideimposeawhilebehavesurprisetelephonesupervisecalculateevaporate

Benny's Exploration Journal 2024-10-24

12 Items: A secreted molecules that influences cells near where it is secretedA transmembrane protein channel that opens or closes in response to a particular stimulus.A type of intercellular junction in animal cells that function as a rivet, fastening cells together...

Unit Word Search 2026-04-09

13 Items: MoneyMoneyMoneyMoneyLoansLiquidPaymentof ValueExchangeDepositsReservesOf AccountTransaction

LS:2 The Zhou Dynasty 2026-04-17

10 Items: minorrulersDynastydynastywarlordsof heavencrossbowsof societyVirtuouslygovernment

Qualitative Research 2024-07-09

10 Items: The consistency of a research study or measuring testRecurring patterns or topics found within qualitative data.The process of categorizing and assigning themes to qualitative data.A method of collecting data through direct questioning of participants.A research approach that seeks to understand individuals' lived experiences...

Rote Words 2025-12-16

15 Items: A person, place, or thingThe sequence of the storyA word that means the sameAn action or state of beingA comparison of unlike ideasA word that means the oppositeThe time and place of the storyA person in a book, play, or movieA comparison of unlike ideas using like or asThe universal meaning of the story, a life lesson...

Unit 1 2025-10-22

14 Items: type of computer deviceused to describe the size of a businesstype of business where members are ownersadditional fees may be charged for their usethis type of business is owned by one personfunctional areas responsible for staff trainingthis equipment is used to help protect documentsthis helps increase productivity in the workplace...