end of school Word Searches

Town vocabulary 2026-05-11

10 Items: towncityparksstoresschoolstreetsstationstationhospitalbuildings

Cost of the School Day Word Search 2023-11-01

10 Items: lunchtripsclubssnackjotteruniformpencilshomeworkcomputerfundraisers

Pencil slop 2026-05-28

8 Items: A form of artThe size of objectsThe parts of a human bodyAn art form using a cameracolors A form of color theoryA form of shading composed of dotsA form of shading composed of linesThe point(s) at which an object is perceived

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

Skin care 2024-10-30

30 Items: boilWartpimplespink eyeswellingbirth markbeauty markchicken poxlack of pigmentpersistent itchingmedical practitionerpore clogging ingredientsover production of pigmentdarkened shade of the skinfoul-smelling perspirationabnormal growth of the skina permanent mark on the bodyredness caused by inflammationa small sac or blister filled with liquid...

Qualitative Word Search 2026-01-07

20 Items: Mass per unit volumeAmount of matter in an objectType of data that involves sensesA proposed explanation for an observationThe sub-atomic particle that has +1 chargeThe substance in which the solute dissolvesUsed to separate coloured substances in inkType of data that involves measurements being taken...

HVAC 2026-04-23

21 Items: Thermal Expansion ValveA gauge used to read vacuumA style of in-line metering deviceOverfill of refrigerant in a systemThe transfer of heat through a solidDevice used to measure vacuum preciselyMoisture that collets on cooler surfacesGauge that reads both pressure and vacuumHeat that can be measured with a thermometer...

Dinner Word Search 2024-12-13

13 Items: bedplaylunchdinnerschooldressedclassesgo-homehomeworkwash-facebreakfastcome-homebrush-teeth

Diary Word Search 2025-05-15

14 Items: icetwinsnowbookdiaryMirrortunnelamericaBrennanskatingreadingsleddingthirteenfor blind

commerce find a word 2024-10-17

16 Items: items of valuebest teacher in the worldvery safe and secure sharesa tax on the profit of a companya part ownership of a public companyvalue of an asset increases over timeacceptable to society’s current standardsall the investments owned by an individualplace where shares in public companies are bought and sold...

Lech Lecha 5.0 2024-11-03

18 Items: מִצְרַיִם“messenger”King of ElamKing of Salem“KHohSHehK” חֹשֶׁךHer name means “flight”“father of a multitude”Hunger, scarcity of grain“noblewoman” or “princess”Son of Haran, Avram’s nephew.His name means “G-d will hear”His name means, “exalted father”Avram’s age when Ishmael was bornAvram ask her to masquerade as his sister....

Cell Energy Word Search 2025-02-21

18 Items: Requires oxygenDoes not require oxygenForm of energy for a cellLocation of the Calvin CycleFermentation common in plant cellsFermentation common in animal cellsOxygen is a by-product of this processLocation of the light-dependent reactionVital for animal life, produced by plantsOccurs in the cytoplasm to start respiration...

Year 5 light 2025-04-10

30 Items: SunRayBeamDawnTorchLaserMirrorObjectObservePhotonsDiffuseTwinkleRainbowEinsteinLightbulbBlackholeRadiationIntensityLess lightScatteringLuminescentThe best subjectDark area or shapeTo take in or swallow upNot letting light throughChange of direction of lightPermitting the passage of lightThrowing back by a body of light...

Advance Functions 2024-07-22

13 Items: To change the base, we used the:Statements that compare two expressionThe smallest repeating unit of the functionWhich is attached to the highest degree of “x”line that a curve approaches, as it heads toward infinityA set or group of functions that share common characteristicsA relation in which each x-value in the domain has a unique y-value...

UofM Alumni January Word Search 2026-01-15

10 Items: Our school colorsClassic NYE snackJanuary 19th HolidayA favorite winter drinkFirst holiday of the yearOur favorite January sportBasketball Coach, Penny ____Spring basketball tournamentFrozen shapes fall from cloudsWhere our Tigers play basketball

Silent to the Bone chapters 1-3 2025-04-04

8 Items: Branwells dadsay in a sentenceBranwells step momBranwells babysitterBranwells thought of schoolflag when the ship is going to sailbranwell was this after the accidentMain c Branwell'sle Branwells baby sister

Things of house 2024-04-26

11 Items: catliontreezebrahippochairschoolelephantelephantcomputerMan's best friend

House Word Search 2025-11-11

10 Items: zooparkparkhouseschoollibrarystationstadiumaquariumhospital

heidis word search 2023-04-11

19 Items: mailclothclocknearbyschoolmailboxweekendeveryoneanywherewheneverdrivewayseatbeltupstairseverydaysometimesnewspaperflashlightbasketballbabysitter

Ancient Greece Timeline 2023-01-25

15 Items: academy 386 BCE: Plato establishes this school.776 BCE: The first of these takes place to honor Zeus.431 BCE: These wars, between Athens and Sparta, begin.432 BCE: This temple to the goddess Athena was completed.323 BCE: This period begins after the death of Alexander the Great.490 BCE: The Greeks battle this Middle Eastern group for independence....

Ancient Greece Timeline 2023-01-25

15 Items: 386 BCE: Plato establishes this school.776 BCE: The first of these takes place to honor Zeus.431 BCE: These wars, between Athens and Sparta, begin.432 BCE: This temple to the goddess Athena was completed.323 BCE: This period begins after the death of Alexander the Great.490 BCE: The Greeks battle this Middle Eastern group for independence....

Inkspiration 2022-06-23

25 Items: catdogSIGNbookgamedreamhobbymottomoviecareercoupleANIMALfriendcopycathometowninterestmarriagememoriesmilitaryrelativechildhoodsuccessesOF A CHILDmilestonesOF A LOVED ONE

Cost of the School Day Word Search 2023-11-02

10 Items: clubssportsnacktripspencilblazerjotterlaptopuniformhomework

Ambassador Word Search 2025-04-21

17 Items: LeakOrderPolicyPardonActionTreatyCabinetImpeachCollegeof StaffPrivilegeSecretaryAmbassadorBureaucracyWhistleblowerSecurity Councilof Management and Budget

Inherent Powers - Word Search Activity 2024-01-28

11 Items: The Supreme Law of the Landthe Contract that Ended World War OneMs. Mangum’s Favorite Color (x2 points)Purchase made by President Thomas JeffersonA Form of Government that the United States HasDocument Written by Abraham Lincoln to Free the SlavesConsists of the House of Representatives and the Senate...

Retrieval 2025-01-06

11 Items: The brittle bone disease OThe body's primary source of energy CThe bodies secondary source of energy FHow many components of health there are TThe type of health that relates to friends SThe type of health that is effected by obesity PWhen a person has a large body fat percentage OThe name of the hormone released during exercise S...

Sugars 2025-09-02

16 Items: linkages found in glycogenthe unbranched type of starchcommon to all N-linked glycosidespolymeric form of glucose in plantsthe major structural polysaccharide in plantsisomers that are not mirror images of each otheramino acid responsible for N-glycoside formationclassification of any sugar that can be oxidized...

Words, words, words. 2025-11-17

17 Items: The King's wifeprince of NorwayPoured in the earsbrother to Opheliawhat the Ghost desiresa brother and murdereranother word for ecstasystabbed behind a tapestrydaughter of the King's advisorthe main setting of the tragedythe capital crime of this tragedyspeaks the first line of the playthe only person the Ghost spoke to...

Floral Design Vocab Review 2024-11-04

62 Items: Red, Blue and YellowTotal area a person can seeThe outline of an arrangementLight reflected off an objectJapanese style of floral designVisual or tactile feel of an itemAppealing odor emitted by flowersCenter of interest that draws the eyeThree colors side by side on the wheelType of shears used to cut woody stems...

Kristina 2026-02-28

16 Items: dobeupwearwalkknowlikelateideawaitneedcampearlyschooltogetherunderstand

The Cell Cycle 2026-04-16

27 Items: The male reproductive cellThe female reproductive cellExactly the same in genetic makeupA cell that has two sets of chromosomesThe membrane that surrounds the nucleusReproductive cells such as sperm and eggBody cells that are not reproductive cellsA cell that has only one set of chromosomesThe final stage where two nuclei begin to form...

Grade 4_Unit9 2025-02-18

11 Items: uphomemy facemy teethmy houseto schoolmy dinnermy homeworkmy school bagout the garbagea wonderful dream

World Religions Word Search 2023-02-06

15 Items: God in IslamA Jewish FaithJewish LanguageJewish Holy BookA God or GoddessMuslim Holy BookMuslim set of rulesThe Worlds Oldest ReligionFounder of the Jewish FaithA leader of the Jewish faithA religion with only ONE GodA religion with multiple GodsA religion followed by MuslimsFounder of the Christian FaithThe set of rules for Christians

Medical Terminology Scavenger Hunt/Word Search 2025-01-09

15 Items: meaning fastsuffix for thirstdefinition of cytesuffix meaning recorddefinition of nephr/osuffix meaning openingdefinition of the term glyccombining form meaning brain-ic, -ior, and -eal all meanhemi is an example of a _____combining form meaning cancercombining form meaning voiceboxprefix meaning few, very little...

Words for Parenting 2026-04-20

15 Items: the ages 1-3no boundariesfeeling of joystages of growthstrict parentingwhat you all areunacceptable conductdeep feeling of carecaring for your childa feeling of fear or uneasesevere acting out of a childmaking connection with your childtriggers fight or flight responseallows infants to strengthen musclesuses boundaries and limits in parenting

Musicals 2025-01-16

15 Items: QManLineCatsRentGirlsAnnieWickedGreaseCabaretChicagoof MormonHairspraySide Storyof the Opera

Middle East Geography Challenge Word Search 2024-12-09

15 Items: The capital city of IraqThe largest river in EgyptThe largest country in ArabiaA large mountain range in western ArabiaThe sea that separates Egypt from Arabia80% of Arabia is part of this environmentA country that borders Saudi Arabia and OmanThis country is east of Iraq and north of OmanThe country where you can find the Great Pyramids...

WHI.1 Vocabulary Practice 2025-05-25

15 Items: more than necessary ___________________skilled craftspeople __________________way of life of a society ____________________also known as the New Stone Age ____________________also known as the Old Stone Age _________________________way of life characterized by little movement _________________...

Mixed Religious words 2025-11-07

12 Items: Ceiling of Paradise7 of them are above usThe life after this lifeMiracle from Jerusalem to aboveEvery creation was made from itBest act of worship after beliefRising of the dead from the gravesEach believer should fear entering itA man of significant religious knowledgeYou need this to get reward for your deeds...

Cold War Word Search 2026-03-31

12 Items: Creator of CommunismThe last Tsar of Russia2nd Leader of the Soviet Union1st leader of the Soviet UnionPresident of the U.S. after FDRA "war" without actual fightingThe heir to Lenin that Stalin exilesPresident who fixes the Great DepressionWhen the free market controls the economyWhen the "People" own the means of production...

Reception 2023-10-22

23 Items: First dateAustin's jobKaitlyn's jobWho is older?years togetherour cat's nameTown of first homeAustin's first namecouple's dog's nameAustin's birth monthname of the best manKaitlyn's middle nameKaitlyn's birth monthKaitlyn's maiden namewhere did he propose?Austin's favorite sportour nontraditional petsnumber of months engagednumber of total siblings...

Nail Diseases and Disorders 2026-05-14

20 Items: nailspoon nailswhite spotsbitten nailstrumpet nailfolded nailsingrown nailsfungal infectionram's horn or clawtiny pits roughnessdeformity or diseasethickening of the naildarkening or black bandlifting of the nail plateskin becomes split or tornsplit brittle nails with ridgesthin white nail plate very flexible...

Fraction Word Search 2025-12-15

10 Items: - one of four equal parts.- the same size or amount.- one of three equal parts.- to split something into parts.- one of two equal parts of something.- all of something with no parts missing.- to divide something so everyone gets some.- a piece of something that is not the whole.- a part of a whole, like one slice of a pizza....

Women of UPS (March, 2023) 2023-02-24

13 Items: EVP & Chief Corporate Affairs and Sustainability OfficerFirst woman package car driver, beginning in 1943, Los AngelesBoard of Director - President and CEO of Lumen Technologies, Inc.UPS’s first woman pilot, joining the newly founded airline in 1988Board of Director - Group President, Pfizer Biopharmaceuticals Group...

Unit 10 2024-05-14

15 Items: The smallest unit of lifeSomething that has never been aliveVariations that help a species surviveSomething that is alive or used to be aliveWhen two organisms both need the same resourceAll populations of different species in an areaPhysical differences between members of a speciesMosquitos and humans have this kind of relationship...

WHI.1 Vocabulary Practice 2025-05-24

15 Items: more than necessary ________________________way of life of a society _____________________skilled craftspeople __________________________also known as the New Stone Age ______________________________also known as the Old Stone Age ______________________________way of life characterized by little movement _______________________________...

summer 2014-06-06

24 Items: noinpoolparktripcampoverbeachrelaxfreshfruitsleepsleepwaterschoolsummercampingswimmingcanoeingicecreamcookoutswater-parkwatersideswatermelon

Congratulations, Great Oak High School 2015 Graduates! 2015-06-05

24 Items: OAKCAPUCRHIGHPOMPGOWNGREATCSUSMPARTYSCHOOLHONORSRECESSANALISEBRIANNANATALIEANTHONYBRANDONDIPLOMAWOLFPACKGRADUATETEACHERSUNIVERSITYCELEBRATIONCOMMENCEMENT

All in a Day's Work 2018-03-12

24 Items: jobvetzoochefmallnursepilotstoreplanedoctorpoliceofficeschooldentistofficerteacherhospitalrestaurantbusinessmanfirefighterhairdressersalespersonphotographerbusinesswoman

Community of Faith 2023-01-18

24 Items: gaatownclubteambandfaithislamsportmusicdancecountyparishfamilyschoolsoccercountryfriendsjudaismreligionhinduismbuddhismcommunityneighbourschristianity

WORD SEARCH 2023-02-14

24 Items: gymartmathmarymasslunchjesusprayerschoolchapelbowlinghistoryenglishscienceseniorsfootballbaseballreligionlearningvacationnotredamebasketballgraduatingcrosscountry

Mya 10 points 2023-04-13

20 Items: mailbeltclocknearbyschoolmailboxweekendeveryoneoutdoorsanywherewheneverdrivewayupstairseverydaysometimesnewspapertableclothflashlightbasketballbabysitter

Things that you like 2023-05-31

24 Items: phomayjunewifimarioluigipeachcandyhmongphonetiktokbowsernezukosummerschoolmewtwoyoutubepikachutanjirozenitsuinosukemarkersavengerscharizard

Dismissed Word Search 2023-12-08

24 Items: timehourmarkclockbreakschoolpickupchangegohomeclosurebusstophalfdayminutesstudentscalendarschedulereminderdismissedannouncedimportantattendancedontforgetearlyreleaseannouncement

DAILY LIFE 2024-03-07

24 Items: tvcarbusjobdryerradiotrainfridgecinemapicnicfamilyschooltoasterblenderbicyclebowlingfriendsbilliardsthemeparkneighborscoffeemakerrollerskatesvacuumcleanerwashingmachine

GROUP RULES AND EXPECTATIONS 2024-05-01

26 Items: grouprulesshareschoollistenengageskillsacceptdisruptwelcomefacilitybehaviorhomeworkpracticehomeworkpracticefeedbackvolunteerimportantrespectfulactivitiesredirectiondistractingparticipateexpectationsnonjudgmental

GROUP RULES AND EXPECTATIONS 2024-05-07

24 Items: grouprulesshareschoollistenengageskillsdisruptwelcomefacilitybehaviorhomeworkpracticefeedbackpreparedvolunteerimportantrespectfulactivitiesredirectiondistractingparticipateexpectationsnonjudgmental

Student Handbook Word Search 2024-05-10

23 Items: booktaskdeskwormmathlearnstudyboardagendaschoolsportshealthmrlongcollegereadingenglishspanishteacherhandbookparagraphknowledgeenrichmentmanagement

Football Word Search 2024-09-10

23 Items: catsdogsnameohioyorklipsnoseeyesearswatertexasidahochiefsschoolFishingskatingsoonersboomersmontanaFootballOklahomasoftballjiujitsu

Save Me A Seat 2024-09-28

24 Items: JOENEWAMMAAPPAMISSRAVIBUDDYBULLYFIFTHFROSTGRADEINDIAJERSEYSCHOOLAMERICABIGFOOTDILLIONLEECHESPERIMMAPERIPPADISORDEREINSTEINCURRYHEADFRIENDSHIP

The Lemonade War 2024-11-08

24 Items: hotwarevanmathstandmeganfliesslumpschemeschooljessieprofitfourthfriendslemonadebusinessmischieflocationfranchisecompetitionpartnershipnegotiationundersellingreconciliation

High Frequency Words 2024-11-19

24 Items: yetfardrysoonhardstopdrivebuiltforceschoolfamilyIndiancenterweathercorrectsurfaceflowersprobablylanguagedirectionthousandscarefullyunderstandgovernment

Sun Word Search 2025-04-07

24 Items: SunStarSockSoapShoeSofaSignSnakeSpoonShellSkirtSharkSwingStoneSpiderSchoolSpongeSnowmanScooterSandwichSailboatScissorsSuitcaseSquirrel

Diary Word Search 2025-09-14

24 Items: KIDGREGDATELOVEDIARYWIMPYTHIRDWHEELSUSANFRANKMANNYDANCEHEARTCRUSHPARTYROWLEYSCHOOLMIDDLEABIGAILRODRICKCORNEYSVALENTINEJEFFKINNEYFRIENDSHIP

Word Search Wednesday #1 2025-09-17

25 Items: wewehedogbigrunyouredshereadcoldplaybikewelljumpfastsingapplehappyschoolslowlyfriendloudlyquicklyquietly

Ms. Heard's Favorite Things :) 2025-09-22

25 Items: PinkLakeTacosSushiFamilySchoolBakingAutumnSchoolYellowReesesFriendsReadingFishingFlowersPopcornCocaColaDrPepperDanceMomsChocolateMathematicsDisneyWorldJewelryClubGreysAnatomyJonasBrothers

Seniors Word Search 2025-10-09

24 Items: capmathwadehighheroessaybooksclassApplecanyongradesschoolseniorsspringsenglishsciencewritingcollegeBeowulfpersonallearningcomputerhomecominggraduation

Each Kindness 2025-10-31

24 Items: MAYALEWISEMPTYALONEFANCYSTONECOUNTWORLDMOVEDBULLYRAGGEDBROKENFRIENDSCHOOLBETTERWOODSONSECRETSBOUNCERKINDNESSLAUGHINGTATTEREDMEANNESSWHISPERINGSECONDHAND

Interest Word Search 2026-03-16

24 Items: HELPCLUBEVENTSSPIRITSERVICELEADERSMEETINGPROJECTSUPPORTMEMBERSSTUDENTSACTIVITYTEAMWORKINTERACTVOLUNTEERCOMMUNITYLEADERSHIPFRIENDSHIPCOMMITMENTCREATIVITYINVOLVEMENTORGANIZATIONPARTICIPATIONRESPONSIBILITY

Local Community 2026-03-30

24 Items: mapfirebuilturbanruralwasteschooldoctorstorespostalpolicenaturalgarbagecompostlibraryfeaturesserviceslocationhospitalcommunityemergencyrecyclingresourcesdirection

Civil Rights 2026-04-01

24 Items: dogfirespinjokecakebaconclownplantsportphonetablechairmoneyhouseschooljumperpencilkittenbubblesblanketglassesstudenttrafficfootball

unit 3 words 2 2026-04-26

24 Items: makestudyafterwritestorygetbyschoolbeforeskillshandinlookupmakeupinventenglishhowlongimproveprojecttelloffrevisionlanguageblendingculturesdictionarydevelopment

PLACES AROUND TOWN 2026-05-20

24 Items: gymbankparkhotelbakeryschoolmuseumchurchlibrarybusstopairportpetshophospitaltownhalldrugstorebookstorerestaurantpostofficegasstationsupermarketfirestationbutchershopmovietheaterpolicestation

Zoe Word Search 2026-01-29

11 Items: EZoeBen1206PlaneEricaMurraySPYDERschoolLondoninvasion

summer 2026-05-19

11 Items: hotjunejulybeachsunnyoceansummeraugustumbrellahappinessback to school

science review wordsearch 2023-06-01

22 Items: Unit for workThe transfer of heat in the form of wavesHighly reactive nonmetal elements in group 17Solution that has more solute than the solventHow tightly packed the atoms are in a substanceDescribes both the speed and direction of an objectReactions that release thermal energy when they react...

Hornsby 2025-05-21

11 Items: Advanced classWhat is this on?Schools GuidelinesYour amazing schoolBooks, pens, and paperslights, camera, action!We just did two of themMaps, globes, and past timesBrushes, pencils, and paintsSpeakers, stages, and melodiesBeakers, chemicals, and goggles

Pinchas 2024-07-20

18 Items: Moses successorThe seventh day.Phinehas’ father.Daughter of Asher.Jeremiah’s hometown.Zimri was from this tribeSimon was know as a _______.Phinehas’ reward for his zeal.The 14th day of the first month.his Hebrew name means “3 Israelites”The new moon or the first of the month.Cozbi was the daughter of this Midianite prince....

Lech Lecha 5.0 2024-11-09

18 Items: מִצְרַיִם“messenger”King of ElamKing of Salem“KHohSHehK” חֹשֶׁךHer name means “flight”“father of a multitude”Hunger, scarcity of grain“noblewoman” or “princess”Son of Haran, Avram’s nephew.His name means “G-d will hear”His name means, “exalted father”Avram’s age when Ishmael was bornAvram ask her to masquerade as his sister....

3B word search week 13~15 2022-06-02

25 Items: to get pleasure from somethingthe process of doing somethingto produce leaves to begin to grownot containing any things or peopleone of the four periods of the yearsomeone who dances either as a job or for pleasuresomething bad that happens that is not expected or intendeda man of noble birth, who served his king or lord in battle...

Oak Island Depositor Theories 2024-12-01

25 Items: GrailTheoryTEMPLARVIKINGSCatharsBaronetof MaltaAntoinetteLOST PAPERSSHip TheoryMash THeoryGold TheoryKIDD treasureFrancis DrakeCipher TheoryDEMATERIALIZERHerring THeoryChamber THeoryHalpern TheoryOF THE COVENANTMAP/ FREemasonsTunnels/Box drainsKabbala/Gematria/Tree OF LifeColumbus-Ark of the Covenant THeoryof 7 people must die to find the treasure

TH10 U1 2025-06-23

24 Items: areapathaheada goalbehindthe viewthe pondthe trailup a tentand quieton a rootmade poolof breathof energythe treesin a cabina campfirethe silencein the shadeof the hikera water bottlenatural bridgeinstant noodlestop of the world

Halo (For baby Girl) 2026-04-12

23 Items: 343TankLAzorHumansZombiesJohn-117ATV of WarWormy BoysBig Monkeysrobotic dogsRank of shameRobotic deathRings aplentySnipers F*****robotic seeresmidevil robotsFlying, annoyingRace of The ElitesLittle floaty guysRace of the GruntsThey dont like humansSomehow Always has a fuel rodOver enginered crystal thrower

Circulatory System 2026-04-13

17 Items: clot the bloodartery on the neckAKA the lung circuitAKA the body circuittop chamber of the heartliquid component of bloodlargest artery of the bodybottom chamber of the heartartery on the upper arm / elbow________ blood cells carry oxygencarry wastes back TOWARD the heartartery on the side of the forehead________ blood cells fight infection...

Unit 6 vocab 2025-11-07

15 Items: tenthrightsrecall6 vocablibertiesnineteenthinitiativereferendumseventeenthtwentythirdtwentysixthof servicestwentyfourthof the state Governmentof the local government

Topic 3 2024-01-19

26 Items: means Incomerider with Paul RevereTax on legal documentsriders with Paul Revereclosed the port of BostonProtest against the Tea actharsh and unfair governmentNickname for British Soldiersthe leader of the Sons of Libertyauthor of the Common Sense pamphletWarned the approach of British TroopsGroup that protested British policies...

Identity Word Search 2026-04-29

20 Items: The feeling of being forced out of your home.The province where Jesse's family roots begin.The process of becoming healthy or whole again.A physical or mental dependency on a substance.Continuing to exist in spite of great hardship.The ability to bounce back when things get tough.Something passed down through several generations....

Phenomena and end phases 2025-09-08

8 Items: CrabNebulaSingularityEventhorizonAccretiondiskGamma-rayburstStellarremnantSupernovaremnantGravitationalcollapse

Citizen Word Search 2024-12-04

13 Items: Classicalrepu…a member of a political communitya religion supported by the state through tax moneythe care, guardianship, and control exercised by a deitythe principles of virtue as expressed in Judeo-Christian teachingsthe status of a citizen with its attendant duties, rights, and privileges...

with VON 2025-02-05

15 Items: SurnameDating appFarming gameFirst date cafeDiscord channelName of boy catAnniversary dateName of girl catAnniversary monthFrequented KL plazaCondo we moved intoName of largest plantDream country to travelMultiplayer cooking gameCountry of overseas trip (not sg)

French Revolution 2025-12-08

20 Items: XVIRégimed'etatClergyEstatesAssemblyBastilleMonarchyJacobinsof TerrorGirondinsCourt OathAntoinetteGuillotineConventionBourgeoisieRobespierreNationalismSans-culottesof Public Safety

PhT 100 Word Search 1 (Spring 2024) 2024-05-09

17 Items: To grind to a smooth substance with moisture.The basic unit of weight in the apothecary system.The dating of any medication that has a short shelf life.The liquid in which another substance is being dissolved.The determination of the covererage an insured is entitled.Complete destruction of organisms after they leave the body....

Glossary 2024-11-11

14 Items: Is a raftelevationsflat ground.enclosed bodyNatural area,low-lying areasjob in the camplanguage of landbetween mountainspoisonous effectspractice of plantingLower than the adsaining land.quantity of water flowing throughThe difference of heught from place to place

The Long Way Home Word Search 2025-09-12

16 Items: EarDewBeadMossGnomeStaffCreekBadgerLilvaraAureliaBerriesMushroomsFireplaceNanna Firlof Croaking Stonesof the Listening Leaves

The armor of god 2024-11-07

6 Items: of Truthof Faithof Salvationof the Spiritof Righteousnessof the Gospel of Peace

Long County LIT-erary Terms 2025-12-08

15 Items: device techniques emphasizing sound.repetition of initial consonant sounds.(originally) a poem intended to be sung.a stanza or poem of four lines, usually with alternate rhymes.the leading character, hero, or heroine of a drama or other literary work.the study of historical linguistic change, especially as manifested in individual words....

Pixelart Word Search 2024-04-30

15 Items: gamer16-bitSchoolpixelsgamepadcoin-opvintagepixelartjoystickretrocadenostalgiacollectionretroconsoleretrographicsside-scrolling

Energy Science 2026-03-31

15 Items: What kind of energy is in the wind?– What nuclear process powers the sun?What is defined as Force times Distance?What is the practice of using less energy?What is the unit of electrical resistance?What kind of energy is stored in a battery?What gas is released when biomass is burned?What increases whenever energy is transformed?...

8th grade Mother to Son (poem) 2026-01-22

9 Items: brokenspeaker of the poemlast name of the poetfirst name of the poetin the place of somethingsmall, thin, sharp piece of woodwide, flat place between sections of stairsqualities like glass that is clear & elegantset of steps used to get from 1 floor to another

My neighborhood 2024-10-05

10 Items: CAFÉPARKBANKMUSEUMCINEMASCHOOLOFFICESTATIONRESTAURANTSUPERMARKET