end of school Word Searches

LGAW Crossword 2024-02-28

18 Items: The Tla'amin Nation NewsletterElected Executive Head of the Tla'amin Nation.How staff present information to elected officialsElected Executive Head of the City of Powell River.The name of elected officials for the Tla'amin NationCampsite and Park managed by the City of Powell River.Elected Executive head of the qathet Regional District....

Motion Word Search 2026-05-14

20 Items: The rate of change of velocityMass per unit volume of a substanceA push or pull acting upon an objectthere is an equal and opposite reactionThe maximum displacement or height of a waveThe number of waves passing a point per secondThe speed of an object in a specific directionEnergy stored in an object due to its position...

The Digital & Genomic Frontier (2000–Present) 2026-02-05

10 Items: The type of math John Urschel studies.Using heat (from lasers) to kill cancer cells.The mathematical rules used in robotics and AI.The tiny "specks" Dr. Green uses to target cancer.The famous school where John Urschel is a professor.Dr. Howard designed software for rovers on what planet?The part of the virus Dr. Corbett studied to make a vaccine....

CHAPTER 6 2025-05-07

161 Items: HƯỚNG“FOR”TỪ-NỐIBỔ-NGỮGIỚI-TỪADJUNCTTÍCH-CỰPASSAGEDISJUNCTCONJUNCTPOSITIVENEGATIVETIÊU-CỰCON-(DAYSDURATIONWH-CLAUSEAT-IN-FORHẬU-BỔ-TỐDIMENSIONDIRECTIONTIME-WHENOF-A-PREPCHIỀU-KÍCHAT-(POINT)ĐỊNH-HƯỚNGBUT-THEY-CACỤM-GIỚI-TỪGIỚI-TỪ-ĐƠNCÁC-TIỂU-TỪAT-TO-ON-INCHUYỂN-DỊCHORIENTATION“FOR-TO-AT”KEY-NOTIONSFOR-EXAMPLEPREPOSITIONSGIỚI-TỪ-PHỨCPOSTMODIFIER...

Elements of Art & Principles of Design 2024-11-01

17 Items: the lightness or darkness of a colora mark that is longer than it is widecreated by lines and are two-dimensionalelements that are repeated in a predictable wayis using different versions of elements in one work of artcreated when light strikes an object and reflects to an eyeused to create a sense of organized movement in a work of art...

Executive Branch 2025-04-21

17 Items: A press secretary or press officera body within the US Executive Brancha key agency within the Executive Officethe senior staff officer of a service or command.a body of people representing the states of the USan intentional disclosure of something secret or private.a formally concluded and ratified agreement between countries....

Ch. 11 Hair Removal Vocab 2025-11-06

31 Items: Also known as bandingThe border of the lip lineThe anatomical name for the underarmThe soft, downy hair found on a fetusNecessary for hair growth and nourishmentA resin used in the manufacture of soft waxSecretes sebum to lubricate the skin and the hairThe area between the eyebrows at the top of the nose...

Reading-Writing Workshop example 2024-03-10

4 Items: The first day of the school weekThe name of the college you attendAn event or activity that repeats every weekThe short form (acronym) of the program you are in

Letters structure 2025-02-01

7 Items: Body. The main part of a letter where the message or content is written.Salutation. Is the greeting or opening phrase in a letter, like 'Dear...'Greeting. Is the initial expression used to welcome someone or begin a letter.Signature. Is the handwritten or typed name of the person who is sending the letter....

Back To School 2022-12-24

15 Items: mottoribbonteacherbookbaguniformsciencelibraryprefectlearningstudentshomeworkprincipalequationsclassroomclassmate

Explore the School! 2025-06-05

15 Items: boardglobeERASERmarkerwindowUNIFORMLIBRARYCANTEENSTUDENTTEACHERNOTEBOOKCORRIDORSCISSORSPROJECTORbookshelf

Things at school 2025-08-11

15 Items: GymdoorTrayforkFencestepsFieldspoonknifeWindownapkinEntranceBuildingflagpolecafeteria

Palmetto High School 2025-10-10

15 Items: LuisJuanQuanRyianAydenAidenBlackDawsonHeavenTigersCornellBenjaminPalmettoHomecomingRedShoeFriday

My School Supplies 2025-11-12

15 Items: PenBagMapBookGlueRulerPaperLunchPencilEraserCrayonMarkerScissorsNotebookSharpener

My School Day 2025-11-12

15 Items: GoEatWakeReadPlayDrawSingTalkPackBrushWriteStudyLearnLunchSleep

9. SCHOOL DAYS 2026-03-03

15 Items: MAPGYMDESKBELLFLAGCHALKRULERRECESSCRAYONTEACHERLIBRARYLUNCHBOXSPELLINGHOMEWORKBLACKBOARD

School Word Search 2026-03-30

15 Items: goalplandreambuildfuturetravelinventbecomedesigncreateexploresucceedimaginediscoveradventure

7. School Days 2026-04-30

15 Items: RULERRECESSPENCILERASERREPORTTEACHERLIBRARYLUNCHBOXSPELLINGNOTEBOOKHOMEROOMASSEMBLYPRINCIPALCLASSROOMCHALKBOARD

Benchmark 2025-09-30

18 Items: inferthemeclaimrevealpropeleffectexcerptarticlepassageconveyssuggestof viewdevelopsnarratorargumentchallengecontributesof an article

Cycle 4 Science Review 2026-02-13

18 Items: All the water on EarthAll living things on EarthThe solid, rocky part of EarthRock changed by heat and pressureRock formed from layers of sedimentMelted rock beneath Earth’s surfaceThe layer of gases surrounding EarthRock formed from cooled magma or lavaMelted rock that reaches Earth’s surfaceA resource that cannot be replaced quickly...

Environmental Science- Species 2025-02-18

17 Items: Likely to become endangeredIn immediate jeopardy of extinctionType of limiting factor; ex. diseaseType of limiting factor; ex. droughtspecies with no living individuals remainingType of growth represented by a J-shaped curveType of growth represented by a S-shaped curveSurvivorship curve that shows consistent mortality...

Portrait of a graduate 2024-10-04

15 Items: WinBusPblSmartSchoolcitizenCreativeLearningStudentsTeachersResilientEmpatheticcommunicatorCollaborativeproblem solver

Happy Anniversary 2025-12-25

14 Items: OurLoveFoodBondStoryRidesschoolStrongMoviesDamarisFlowersDancingPartnersChristopher

Reyna's Favorite... 2023-10-05

21 Items: WordFoodColorGroupSnackFruitDrinkAnimalSeasonVeggieTV showCartoonCandy BarComputer GameSchool SubjectWhat on her ceilingItem from McDonald'sWhat she wants to beOverseas place to visitPlace in DC she visitedArticle of clothing, black ...

Clothes 2018-03-02

14 Items: coatDresspantsshirtshoessockssportshoesskirtjacketschooluniformsweaterT-shirt

Broken Strings 2022-12-20

14 Items: benPlayrameyzaydemindipropsshrilischoolattickviolinposternatashacostumegroccies

Microsoft teams 2025-02-04

13 Items: bookworktaskteamsloginschoolclassescalendaronedrivehomepageMicrosoftassignmentsannouncements

Meiosis 2024-05-31

17 Items: period between two periods of mitosishaving chromosomes in homologous pairsa period in the life of the cell when it is conducting cell divisiona condition in which non-sister chromatids of homologous chromosomes exchange geneshaving a single, complete set of chromosomes, or one half of each pair of homologous chromosomes...

Math 6 Vocabulary 2023-04-18

15 Items: Part of a wholePer one hundredA comparison of two ratiosA comparison of two quantitiesThe measurement of the space aPositive or Negative Whole NumberA statement of an order relationshipA math statement that shows equalityThe measure around the outside of a circleThe measurement of the outside of a polygonMath phrase with numbers and operation sign...

Compact Word Search 2023-10-06

11 Items: a compact's usual shapea synonym of compactingwhat a compact can carryan antonym of compactingtype of makeup that boldens lipstype of makeup that tans your facetype of makeup that boldens eyelashestype of makeup that colors your eyelidssomething to apply powder onto your facetype of makeup that makes your cheeks rosey...

Made Word Search 2025-04-07

17 Items: newMadeonceverywantyourseenjumpmorefromtheirwouldagainlivedschoolcalledanother

Ruler Word Search 2026-02-16

17 Items: bagpencardoorbookdollballkitebiketoysrulerteddytrainwindowrubberpencilschool

Young Mr Finn 2026-03-07

17 Items: DrMomDadLouFinnMimiZaneIpadSchoolBeckhamCharlieNoodlesBaseballSwimmingCharlotteSnowBoardminecraft

Avalon Word Search 2026-05-26

10 Items: Top TrumpsCaptain...Glacier...Your schoolYour teacherStations speaking activityBefore evidence or elaborationThe best spelling practice gameThe most important part of an essayWords that describe touch/taste/feel/smell...

summer 2025-06-03

19 Items: buscarfootboatparkparkparktrainbeachbeachschoolcastlecraftssummervillagefunfairaquariummountainsplayground

Bromsgrove 2026-02-02

16 Items: HolySnehaJesusSpireschoolReverendWaitroseGargoyleLychgateHistoricCommunionSandstoneSpiritualHighstreetSaintjohnsThomascookes

To Kill a Mockingbird word search!! 2026-04-28

30 Items: or failure-inborn; natural.noisy and difficult to control.success, favorable, or fortunatein an enjoyable or agreeable manner.consider or regard in a specified way.make an unpleasant feeling less intenserarely, infrequently, or not very oftenfilled with excessive and single-minded zealexceptionally bad, detestable, or unpleasant...

Nindita, Maisya & Shofia Riddle 2023-02-23

25 Items: : separating the room: another name for loft: vertical height in stairs: the bottom part of the door: a very common type flooring: different levels of building: the bottom part of the window: highest level in the apartment: the lowest load-bearing part of building: the top element that covering the building...

June 5-11 2023-05-13

24 Items: joylifeloveseeknisanfriendwisdomloyaltyhonestyjehovahprosperinherittogetherhezekiahpassoverhumilityholinessmarriagegatheringjerusalemof jehovahmotivationneutralityof Unleavened Bread

Bachpan theme 2026-03-28

11 Items: DollToysCandyMastiToffeepakdaiSchoolBachpanLollipopHopscotchGullidanda

Chapter 4 Word Search 2023-11-16

34 Items: Organelle of protein synthesis.Viscous fluid enclosed by the nuclear envelope.Small circle of DNA in some bacteria and archaea.Long, slender cellular structure used for motility.Barrel-shaped organelle from which microtubules grow.This eukaryotic organelle specializes in producing ATP.Semifluid substance enclosed by a cell's plasma membrane....

Third Grade 2024-09-02

18 Items: LeofunJakeRaedDaryaTymekgradeDanielRahimaschoolDrushilMikolajSolangeVismayaKrithigalearningMissJuliaPriscilla

Fairmont Area Cardinals 2026-05-31

18 Items: — Today’s guests of honor— Activities chosen simply for joy— Time to slow down and enjoy life— Every year adding another chapter— The reward after years of hard work— Building knowledge and opening doors— Someone who made the journey brighter— Time now belongs to hobbies and happiness— Lasting far beyond one career or classroom...

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

Skeletal System Word Search 2025-12-05

42 Items: Knee CapSolid boneCheek bonePorous boneMovable jointUpper jaw boneUpper arm boneImmovable jointMature bone cellBone building cellBone breaking cellBones of the wristBones of the ankleAny break in a boneConnects bone to boneVertebrae in the neckBone of the upper legSlightly movable jointOnly movable skull boneThe unit of compact bone...

Forensics Wordsearch 2026-03-23

15 Items: The study of poisons, drugs, and toxins and their effects on the human body.The physical location where a crime has occurred or is suspected of having occurred.The scientific study of blood and other bodily fluids to identify biological materials.The scientific study of projectiles (bullets) and firearms, including their motion and effects....

18 Saddle Shoes (Difícil) 2024-09-21

15 Items: JazzshoesblackwhitelacessaddleschoolBrogueOxfordWingtipsneakerspolishedstudentsTwo-tonecomfortable

thing I love 2025-12-10

15 Items: DogsfoodcarscadysyearsgamesclasssoccerRobloxsummerschoolwinterfriendsbaseballfootball

Healthy Gum Project 2026-03-13

16 Items: pinkchewfairschoolstomachgumbasehealthybubblesproteinmickaylamolinskiglycerinbubblegumdominiqueplaydoughplaydough

HHMS Yearbook Word Search 2026-04-08

15 Items: KipBookStaffSportSpiritDesignCameraVikingsEditingEDesignProjectYearbookPicturesPhotoshopPhotography

For Ashlynn 2026-05-05

15 Items: cowpigpetfallSNOWHorsefriesspringsummerwinterpencilschoolneedohteahcerchicken

The Crossover 2026-05-07

15 Items: JoshLossTwinsFilthySchoolFamilyReboundTeamworkConflictBrothersCrossoverFreethrowSuspensionCompetitionChampionship

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

JHS2 SDG12 2025-11-22

25 Items: the world around usto use something againsomething you do oftento make less of somethingpower we use to do thingsfood waste turned into soilhaving the right mix of foodswaste or things we throw awayhow your body feels and worksto arrange or prepare somethingthe act of giving food to othersthe amount of food for one person...

Un élève américain 2024-01-17

20 Items: byinboywhogirldoorsayswantsotherschoolentersstudentAmericannew (m.)confusednew (fem.)high schoolto know (someone)hi! (peek-a-boo!)is called/is named

Bible Word Search 2025-07-12

4 Items: father of hopewhat will be coming in the endWho went to jail in the age 17and Eve first persons in the bible

Here Word Search 2024-12-16

26 Items: VetoCabinetDemocracyDiplomacyFederalismImpeachmentBureaucracyTerm LimitsSupreme LawConstitutionSupreme CourtLandmark CaseBill of RightsThree BranchesElectoral VotesAge RequirementDirect DemocracyMajority OpinionFreedom of SpeechCommander in ChiefPopular SovereigntySeparation of PowersElectoral Vote ProcessRepresentative Democracy...

Creation 2024-12-06

25 Items: SeaSkyManSinDayGodLandDeepLightWomanFruitImagePlantsBreathAnimalsof Edenof LifeSerpentEveningSabbathMorningDarknessCreationCovenantBlessing

Community needs Vocabulary 2025-10-09

13 Items: FoodwaterNeedsSchoolSafetyHealthGarbageTrashcanSecurityEducationCommunityElectricityContamination

Colosseum 2014-05-01

10 Items: RomestonefightsSchoolanimalsconcretecolosseumellipticagladiatorsamphitheater

Spelling 2016-01-26

10 Items: savekeepsafegraderaisethemeschoolfatherscreamreached

Where are you going?  2016-10-05

10 Items: SEAPOOLPARKHOMEBEACHWHEREGOINGSHOPSSCHOOLMOUNTAINS

Inglis keele sõnad 2017-03-30

10 Items: penbookapplechairschoolspiderlettercomputerkeyboardlunchbox

he and me skittles 2018-03-21

10 Items: holdsoaktoneglowcrewdrewgrindsneakslideschool

Find the words with oo 2020-03-13

10 Items: moonsoonhootspoonbloomsmoothschoolscooterfoolishbroomstick

Find the words with oo 2020-03-13

10 Items: moonsoonhootspoonbloomsmoothschoolscooterfoolishbroomstick

Teachers 2020-07-15

10 Items: BooksTeachSchoolEducateHomeworkLearningStudentsClassroomWhiteboardTechnology

p1-120 2020-11-23

10 Items: sadsayseeringroofroomrulersaladsheepschool

Around Town 2021-02-28

10 Items: bankparkhotelschoolcinemamuseumtheatrelibraryrestaurantsupermarket

word search puzzle 2021-04-18

10 Items: Zigzagzenithwanderuniqueshrinktailorschoolsnorkelingveterinarianresponsibility

Belmont Wordsearch 2021-05-25

10 Items: funplaybookslearnschoolbelmontfriendsnumbersscienceoutdoors

Whoot makes new friends  2022-02-28

10 Items: hidegamefrozeschoolunfoldjumpedactingfriendssadnessteacher

Haunted places 2022-10-23

10 Items: shiphouseforestcastleasylumschoolmansiondungeonairfieldfairground

Teacher Word Search 2022-11-13

10 Items: dogbearsummermondaygardenschoolteacherjanuarygrandmacomputer

third grade spelling 2023-02-16

10 Items: hoodmailpainbootsshooksnailtraingrainschoolchoose

Let's learn about... 2023-03-17

10 Items: petsfarmfoodfruitschoolcoloursnumbersobjectsanimalsvegetables

Squirrels 04/05 2023-05-04

10 Items: stepstopstackstingstuckstorywriteschoolbeforebecause

Friends 2023-09-04

10 Items: realgoodtrustloyalfriendschoolimportantchildhoodclassmateunderstand

WORD SEARCH 2023-10-15

10 Items: familyschoolchurchsocietyemotionsbehaviormassmediaattitudespeergroupssocialization

SPELLING WORD SEARCH 2023-10-18

10 Items: doesfindeightagaincarrybelowhouselaughmotherschool

School Word Search 2023-11-29

10 Items: bagtwofourpensfivethreerulesbooksschoolpencils

Brain Word Search 2024-04-26

10 Items: artreadtalkgrowbrainlearnbookssmartschoollibrary

Cooker Word Search 2024-06-27

10 Items: runjumpsofajuicelunchpizzasugarcookerdinnerschool

Buildings 2024-08-04

10 Items: OfficeSchoolMuseumLibraryTheaterHospitalApartmentWarehouseCathedralSkyscraper

Places 2024-08-10

10 Items: ZooGymParkSchoolChurchMuseumCircusCinemaLibraryHospital

Spelling 2024-08-15

10 Items: teamjoinleaderschoolhopefulstudentrememberbuildingtogetherrespectful

Where to use your Yooushi Backpack 2024-08-30

10 Items: parktripsbeachschoolpicnicdaycarecampingpracticeplaydatessleepovers

Classroom Action Research 2024-09-24

10 Items: schoolproblemstudentsresearchclassroominterviewobservationquestionnairelearningprocessteachercentered

Gospels Word Search 2024-09-20

10 Items: OneArtHelpTeachTodayToolsBusesSchoolSimpleSlates

Sophia B. Packard 2025-01-10

10 Items: SophiaSchoolPackardFounderTeacherEducatorAdvocateEducationLeadershipEmpowerment

Ruby Bridges 2025-01-10

10 Items: SchoolChangeSymbolRightsCourageJusticeBraveryHistoryEqualityStrength

Dream Word Search 2025-01-11

12 Items: EqualUnityUnityChangeSchoolFreedomFreedomCourageDreamerLibertyFairnessNonviolent

Word Search Puzzle 1 2025-02-05

10 Items: Mrsourchairemptyschoolstudentfriendsfavoriteassemblycafeteria

100day 2025-02-05

10 Items: FunHatDaysLearnCountPartySchoolHundredNumbersCelebrate

Heart Word Search 2025-02-16

10 Items: boyballheadsandwolfhearttrainschoolstreetfootball

School Word Search 2025-03-06

10 Items: BankHotelSchoolMarketMuseumChurchBakeryLibraryTheaterHospital

Ethnic Studies 2025-03-25

10 Items: ShowEthnicSchoolAbbottStudiesEffectsRedliningElementaryTelevisionInequalities

Cereal Box Project 2025-04-20

10 Items: DogLoveColorFamilySchoolFriendsTeacherSpecialDifferentMagnificent

ool word family 2025-04-23

10 Items: coolfoolpooltooldroolspoolstoolschoolcarpoolhighshool