end of school Word Searches

Wicked Word Search 2025-10-27

20 Items: OzBoqCityShizWitchMagicSpellGlindaWizardFiyeroSchoolElphabaDefyingGravityPopularEmeraldMusicalNessaroseBroomstickFriendship

Noun 2025-10-28

20 Items: catdogbagcarsunbookballbirdricedollbiketreeapplechairtablehousepencilflowerschoolteacher

Read Word Search 2025-10-28

20 Items: readbookpagestorywordslearnstudywritequietauthorschoollibrarylettersfictionimagineteacherbookmarkcharacteradventurenonfiction

Respect 2025-10-29

20 Items: FairHomeKindProudHonestLeaderSchoolHelpfulPatientMannersListenerAcceptingRoleModelCommunityDependableEmpatheticTrustworthyAccountableSelfControlPersonalSpace

Geography Word Search 2025-11-13

20 Items: PEICTHWBArtRMPSModsMathsMusicFrenchSchoolEnglishSpanishHistoryScienceMcLarenNumeracyLiteracySubjectsGeographyTechnical

Jobs Places 2025-11-22

20 Items: bankcaféfarmshophotelstorechurchcinemamarketmuseumofficeschooltempleairportfactorylibrarystadiumtheaterhospitalrestaurant

Word Search 2025-12-04

20 Items: DoneTiredMasterDegreeAlumniFamilyPrayerSchoolHighwayTeacherJacksonStrengthLateNightEducationHappinessGraduationUniversityCelebrationMississippiAccomplished

CCA America 250 2025-12-16

20 Items: CCAEdioFlagStarsCometEagleCyberStatesBostonSchoolAmericaStripesLincolnCountryStudentColoniesWashingtonPennsylvaniaIndependencePhiladelphia

English Word Search 2025-12-22

20 Items: lastyearhopecutekindgoodluckthankhappygreatcheermiddleschoolalwaysfutureEnglishlearningtogethergraduationcongratulations

Everyday Life Word Search 2025-12-23

20 Items: buscarkeyboatcityfarmparkroadshoptownclockhousemoneyphonetrainwatchchurchmarketschoolstreet

Eva's New Pet 2026-01-01

20 Items: EVABATPETSCUTEACORNNAMESTREESGAMESBAXTERCUDDLYSCHOOLFLYINGSPIDERPICNICSPETCAREOUTSIDEFRIENDLYCOSTUMESSQUIRRELWATERFIGHT

Word Search 2025-11-26

20 Items: chefparkdoctorschoolofficesoccertennisteacherstadiumlibraryrunningcyclingengineerhospitalswimmingbaseballbasketballvolleyballfirefighterpoliceofficer

Occupational Therapy Month 2026-01-13

20 Items: CUTCALMCOLORFOCUSHANDSGRASPPINCHLACESPENCILSKILLSZIPPERVISIONSCHOOLSCISSORTHERAPYWRITINGSENSORYSTRENGTHCOORDINATIONOCCUPATIONAL

Housework Word Search 2026-01-20

20 Items: PARKRIVERHOTELTOWERSTREETSQUAREBRIDGEMUSEUMSCHOOLMARKETTHEATERLIBRARYSTATIONSTADIUMBUILDINGMONUMENTHOSPITALFOUNTAINSKYSCRAPERRESTAURANT

Learn Word Search 2026-01-22

20 Items: failpassexamtestlearnbreakboarddegreelessonschoolcollegesubjectteacherprojectstudenttraininghomeworktimetableuniversitykindergarten

Lipizzaner Word Search 2026-01-27

20 Items: WarNeroArmyFarmAloisViennaSchoolSovietRidersGermanyAustriaPastureColonelGeneralStallionDressageRefugeesNapoleanPodhajskyLipizzaner

Kryptolekso 2026-01-28

20 Items: addsixpagesevenfunnybuildsmallcentergardenfriendschoolbasketnaughtyunusualkitchenchickenfootballimportantskateparkclassmate

dw, sc, sw, tw Word Search 2026-02-06

20 Items: TwoSwanSwimSwapTwinDwarfDwellScaleSceneScaryScarfSweetSwarmTwiceSchoolTwelveTwentyDwindleDwellersDwellings

Upper Moreland 2026-02-10

20 Items: ParkTownSchoolHatboroLibraryVillageHistoryTownshipRailroadSettlersCommunityLandmarksPostOfficeWillowGroveKingCharlesWilliamPennPennsylvaniaPhiladelphiaUpperMorelandRevolutionaryWar

Read Word Search 2026-02-20

20 Items: readbookstoryrhymetitlepagescoverlearnauthorreaderschoollistencreatelibraryphonicspicturechapterimaginefavoritecharacter

silly word search 2026-02-26

20 Items: garybluemallrubinmarchdubaisummerrobloxschoolslushybestiefashionbirthdayplaylistfortnitesoulmatepennstatesleepoverphotoboothfriendship

Miss Fig's Birthday 2026-03-01

20 Items: funlovepartyhappygamesschoolwishesfamilyteachercandlesfriendsstudentsbirthdaysixsevenlovebugsballoonssurprisecelebratestreamerscelebration

Perseverance Pod 2026-03-19

20 Items: PodArchMathCoolSchoolKintopfShulmanScienceHistoryEnglishAwesomeTheBestWinnersStudentsLaCrosseHalversonWashingtonLongfellowEighthGradePerseverance

/oo/ as in look and /oo/ as in food 2026-03-22

20 Items: lookfoodstewflewcuterudehoopgrewbookgoodmooncookstoodtoothbroomspoonwoodenschoolsmoothfootball

Exam Review 2026-03-23

22 Items: blewawayhelpsoongrowgrowbowlangrytouchtrickbeganlaughbraidjellyfriendwindowschooltwentybelievechildrensurprisesurprise

My Digital Footprint 2026-04-02

20 Items: AGESAFENAMEGAMESHAREPHONEVIDEOHOBBYSCHOOLONLINETABLETPRIVATEADDRESSDIGITALPICTUREBIRTHDAYINTERNETFAVORITECOMPUTERFOOTPRINT

Cooperative Word Search 2026-04-09

20 Items: CocoaLeagueBayoilSchoolSavingsTrainingBusinessDirectorsFisheriesEducationDemocracyBeekeepersMembershipGovernancePrinciplesCooperativeAgricultureMultipurposeNonfinancialAgroprocessing

Jacob Word Search 2026-04-14

20 Items: SeatTestJacobMeanySmileVoiceLunchLaughCassieSchoolFridayPoliteMichaelTeacherScowledMonsterEyebrowsClassroomNicknamesSubstitute

3 2026-04-22

20 Items: beeMONObookMESAABEJALIBROLÁPIZtableSILLAchairPAPELpaperCONEJOrabbitturtlemonkeySchoolpencilTORTUGAEscuela

Attire Word Search 2026-04-27

20 Items: DateGownKingLimoSuitCrownDanceHeelsPartyQueenAttireFormalSchoolSeniorSocialBanquetCorsageFriendsCelebratePromposal

Hilda 2026-05-03

20 Items: ELFMAPTWIGHILDAFRIDADAVIDTROLLGIANTFORESTSCHOOLSCOUTSSAILORSTROLBERGMOUNTAINCREATUREADVENTURESTORYBOOKWILDERNESSKETTLESTONENORTHWINDKING

Goodbye Word Search 2026-05-02

20 Items: BYESEEYOUSOONMISSCARELOVEKINDYEARNEXTMOVESTEPGROWTHANKCLASSGRADELEARNFRIENDSCHOOLGOODBYE

ESP2 - We Real Cool by Gwendolyn Brooks 2026-05-05

20 Items: wesingindiecoolpoolleftlatelurksingthinjazzjunesoonsevengoldenschoolstrikeplayersstraight

Artic Work Search 2026-05-11

20 Items: CatRedCarBluePlugPlayBlackGlassSleepSlideGreencleanPrizesnackRobotschoolPillowCarrotOrangekangaroo

Physical Education 2026-05-25

20 Items: DanceWarmupCardioEnergySchoolTaieriHealthJumpjamFitnessBalanceRoutineStudentTeacherExerciseMovementTeamworkCooldownWellbeingPerformanceCoordination

1HM1 Reading 2026-06-03

20 Items: LeoEmmateamvideoprizemusicgamingRobloxTikTokschoolcastleskillsprojectfriendsteachereffectsFortniteMinecraftInstagramcontroller

Cat Word Search 2026-06-04

20 Items: CATDOGPENCARSUNBOYBAGBOOKTREEMOONFOODGIRLDOORHOUSEWATERCHAIRTABLESCHOOLFRIENDFAMILY

Childhood 2026-06-13

20 Items: ToyDollGameKiteYoYoPuzzleSchoolBalloonBicycleCartoonDrawingColoringJumpRopeLollipopChocolateStorybookTeddyBearVideoGamePlaygroundTreasureHunt

RCC EAST 2026-06-14

20 Items: maemayakyliebrodysamaraalexiagracieholleeapolloschoolcookedkaraokenetflixspotifyyoutubekaelinntherapydaniellecourtyardbasketball

PHANTOM OF THE OPERA 2025-12-09

14 Items: ErikMaskRoseRaoulOperaMirrorPhantomBox FiveMasqueradeChandelierThink of MeChristine DaaeAngel of MusicMusic of the Night

Kpop Demon Hunters Characters 2025-09-03

9 Items: BobbyZoe's crushrapper of Huntrixdancer of Huntrixleader of Huntrixheart of Saja Boysleader of Saja Boysrapper of Saja Boysstrongest of Saja Boys

Famous Landmarks 2024-03-20

20 Items: petrabig-bentaj-mahalcolosseumacropolisstonehengeangkor-wateiffel-towermachu-picchugrand-canyonburj-khalifamount-everestmount-rushmoresagrada-familiapyramids-of-gizastatue-of-libertysydney-opera-housegreat-barrier-reefgreat-wall-of-chinachrist-the-redeemer

Ray optics part-1 2024-08-14

21 Items: PoleReflectionPlane-MirrorFocal-LengthOpaque-MediumConvex-MirrorMagnificationOptical-MediumConcave-MirrorPrincipal-AxisMirror-FormulaPrincipal-FocusSpherical-MirrorTransparent-MediumTranslucent-MediumLaws-of-ReflectionCentre-of-CurvatureRadius-of-CurvatureParaboloidal-MirrorSpherical-AberrationImage-Characteristics

La Escuela 2022-08-25

11 Items: school"I talk"schedule"favorite"Fourth PeriodEighth periodscience class"I like it more"subject prounoun for "we"How you would address a teachersubject pronoun for a group of all boys

Sea Word Search 2023-06-28

17 Items: rowgodboatwindrainsavepeterstormdoubtshorejesusof Godandrewpulledtwelvebelieveof Galilee

Chapter 4 Vocab 2025-09-02

22 Items: ActTraceTimesTariffeatersof 1817of 1832Provisoof 1850FlatboatBackbonePurchaseSecessionOrdinanceAnnexationCompromiseFree-SoilerSectionalismImprovementsAbolitionistScott decisionof Guadalupe Hidalgo

Hephaestus 2025-12-04

19 Items: Roman name for HephaestusIsland where Hephaestus lands in one versionRepresents his work as a smith and craftsman.Early king of Athens, part human and part serpentGreek god of fire, metalworking, and craftsmanshipSon of Hephaestus; said to have invented the flute.Tool of the forge; a key symbol of Hephaestus’s skill....

Minecraft (For Little Puppy) 2026-04-12

20 Items: UndeadSnipersAwww Man?mmmmmm MilkOg Best ToolNewest weponI swing my...Little F*****has a job lolTreeee ChoppaCraftable BossBig enemy houseTime to end thisOrange jumpy friendVilliger on the moveMulti Colored Animal?Nice song, not creeper"...I still love ya baby."Number 1 rule of minecraftFirst Block for a minecrafter

Leadership & Team Dynamics 2025-03-30

14 Items: fully concentrating on a speakercharacteristic type which avoids offending othersact of working effectively with others to achieve a shared goalorganization’s goal for future achievements and accomplishmentsact of controlling every part of an operation with excessive detailcooperative action of a group of individuals to achieve a shared goal...

Focus on Greek Roots 2024-03-04

19 Items: Study of living organismsEarly sound-reproducing machinePerson trained for space travelA person's signature, often as a mementoA sudden event causing great damage or lossVisual representation of data or informationAn account of someone's life written by someone elseAn account of a person's life written by that person...

Marine Science Word Search 2025-01-15

25 Items: South American, Canadian, PacificWhat is the main way that surface currents form?What is the term for measuring the acidity of a liquid?What is the name of a tidal current that leaves the land?What is the process of converting liquid water into vapor water?plain What is the flat ocean floor that covers 50% of the ocean?...

8th Grade Space Vocabulary 2025-05-15

19 Items: most distant region of our solar systemin a region of space located past Neptuneone complete trip of a planet around the Sunthe measure of the observed visible brightness of a starforce by which a planet or other body draws objects toward its centerthe galaxy which contains our Sun and its solar system, including Earth...

I'm Sorry Matt 2024-04-26

12 Items: Amazed by somethingThinking very hard on somethingA fantastic show or demonstrationA person who brings people togetherThe beginning or end of someone speakingSuddenly inhaling because of shock or fearsomething like shapes that have the same centerA Swiss food with melted cheese and wine in a potA type of drug that reduces appetite and boosts energy...

Vocabulary Word Search 2024-11-01

12 Items: How you use your hands.The emotion on your face.How fast or slow you speak.How clearly words are spoken.How high or low your voice is.The rise and fall of the voice.The levels you use in the space.The emotion in your voice, happy /sad.Raising the end of a sentence up to sound like a question....

Respiratory System 2024-10-14

29 Items: The movement of air into and out of the lungs.The double-layered membrane surrounding the lungs.The space between the parietal and visceral pleura.Pneumocytes-cells in the alveoli that produce surfactant-A ring-shaped cartilage located below the thyroid cartilageThe first branches of the trachea that lead into each lung....

Ballet History Word Search 2025-09-11

18 Items: where ballet originated.is also known as the sun king.a traditional christmas balletcreated the first ballet school.a classical ballet about a bird.the language ballet terms are in.____ shoes came around in the 1830s.one of the famous classical ballets.created the five positions of the feet.The sun king costume was made out of this....

Animal Camouflage 2014-01-06

13 Items: hoopmoodsoonfoodroompooltoothigloobloompoochnoodleschoolrooster

best friends 2014-06-04

13 Items: fun5th3rdjakeevanbestjessimaleacrazyschoolfriendsneighborkingerton

Mr. Miller's Class 2020-06-18

13 Items: WordExcelInletGamesSchoolDigitalSyllabusMicrosoftSchoologyPowerPointTechnologyClasscraftInformation

Backpack Word Search 2024-07-20

13 Items: gluechalkclasseraserfriendmarkerpencilschoolyellowcrayonsstudentteacherbackpack

Hundred Word Search 2025-01-28

13 Items: DayMathDrawLearnCraftSchoolFriendHundredTeacherStudentProjectCountingCelebrate

Growing up in Port-au-Prince, Haiti 2025-04-08

13 Items: songHaitiblocksschooltailorfatherCreolemuseumEnglishboardinglaboratorystepmotherPortauprince

WELCOME BACK 2025-08-06

13 Items: FUNTRIPSWIMBOOKHOTELCLASSFAMILYTRAVELSCHOOLPENCILTEACHERFRIENDSBACKPACK

Nine Word Search 2025-09-12

13 Items: OneTwoOldNineFourNameHelloSevenEightThreeHouseAlmostSchool

8A autumn 2025-09-17

13 Items: piebookwarmtreebrownghostschoolorangeleavescoffeepumpkinhalloweenbilastqyz

College Word Search 2025-11-04

13 Items: PayMoneyIncomeSportsSchoolCollegeAthleteCoachesPassionStudentFairnessEqualityEquipment

Spelling Words 2.6 2025-11-05

13 Items: cityinsideschoolweekendsnowmanmailboxbathtubfireflycountrybackyarddrivewayraindroprailroad

Places around town 2025-11-21

13 Items: mallcafeMuseumbarberschoollibraryairporthospitalapartmentfirstationrestaurantsupermarketpolicestation

Ryan and Riley 2025-11-22

14 Items: RyanDeskTeddyChipsRileyColorChairLunchSchoolTeacherCrayonsTeacherChocolatePlayground

Fun, Word Search 2025-12-02

13 Items: Fun,Owl,Ball,Hero,Mind,Olly,Smart,Beach,Think,Super,School,Holiday,Routine,

sophia 2026-04-29

13 Items: dogscandydancesoccerschoolcraftsbarbiesglitterdressesshopkinsswimmingloldollstocaboca

GRADUATION 2026-05-20

13 Items: 2026MAMASPROUDSTUDYGOALSFUTURESCHOOLSENIORDIPLOMACOLLEGESUCCESSGRADUATEORGANIZED

Places of the city 2026-05-23

13 Items: BANKPARKSCHOOLCHURCHCINEMABAKERYTHEATRELIBRARYSTADIUMRESTAURANTSUPERMARKETFIRESTATIONPOLICESTATION

Halloween Fun 2025-10-09

19 Items: Undead bloodsuckerSpirits from the beyondThis is the witching hourCreatures in The Walking DeadBoard game that tells fortunesThis song is a graveyard smashA large pot for brewing potionsThe author of The Tale Tell HeartA raven's quote or school for WednesdayThese creatures transform at the full moonThe most prolific horror author of our time...

Unit 9: Energy Sources and Consumption 2024-04-25

16 Items: energy from the sunburning wastes for energycoal, oil, and natural gasburns in the presence of oxygenmost common form of water powerusing fuel for both efficiency and heatlocation of the worst meltdown in historyreducing the overall amount of energy neededthe process of building the bonds of an atomthe process of breaking the bonds of an atom...

BIOETHICS - "END OF LIFE" TOPIC 2025-06-11

5 Items: PAINRESPECTKINDNESSDECISIONEUTHANASIA

Srimad Bhagvatam Cantos 2025-04-23

12 Items: CreationStatus-QuoLiberationSumma-BonumScience-of-GodGeneral-HistoryCreative-ImpetusCosmic-ManifestationAge-of-DeteriorationCreation-of-the-Fourth-OrderPrescribed-Duties-for-MankindWithdrawal-of-the-Cosmic-Creations

emotions 2025-06-11

19 Items: most people are ...a state of peacefulnessfeeling of deep satisfactiona feeling of great happinessyou feel ... about grows thingssentimental longing for the pastpainful feeling of embarrassmentwhat people say when there cryingfeeling of listlessness, boredom,the feeling of self-consciousnessmost siblings are ... at one an other...

Middle Ages Review Word Search 2024-03-01

19 Items: Mr. Murphy's catsFirst Holy Roman EmperorA mix of two distinct culturesCommon targets of Viking raidsA code of laws based on Roman lawThe capitol of the Byzantine EmpireThe social system of the Middle AgesLeader of the Eastern Orthodox ChurchThe economic system of the Middle AgesReligious wars that lasted for 200 years...

polynomial class x 2025-04-21

15 Items: most A polynomial of degree 'n' can have at most 'n' zeroespolynomial A linear polynomial is a polynomial having a degree of 1.The degree of a polynomial is the highest power of the variable in it.If 'α' is a zero of a polynomial p(x), then (x - α) is a factor of p(x).The zeroes of a polynomial p(x) are the values of x for which p(x) equals 0....

Final Review 2025-12-17

17 Items: Variations of a trait.A part of a nucleotide.The site of translation.A change in the DNA sequence.Having two different alleles.Made by a chain of amino acidsType of cells produced by meiosis.The process of new species forming.A group of the same species in an area.When the last member of a species dies.A structure that no longer has a function....

Clue 1 2025-07-13

11 Items: MascotHead of College2025 Fresher danceNo. of members on club2025 Collchella headlinerName of our snack cupboardName of our instagram profileLast SAAUCC sport of semester 1First SAAUCC sport of semester 1Name of the blue punch from Hockey APNo. of people who ran for Fresher Rep

Cell Word Search 2025-01-31

27 Items: The variety of genes within a given speciesAny living factor in an organism’s environmentThe variety of ecosystems within a given regionNumber of different species living in a specific areaAnything that has or once had all the characteristics of lifeSpecies that normally live and thrive in a particular ecosystem...

Travelling Europe 2025-09-25

18 Items: Boat TourCity of LoveBay of SilenceCanel Boat RideCapital of BelgiumCapital of DenmarkCapital for FashionRome Pregnancy TourSwedish Shipyard TownHome of the Royal MileThe Infamous Tube FightFavourite Italian HotelDeclan and Megans WeddingCity of the Magnum DesertFavourite Italian ResterauntDamons Favourite Italian Drink...

"Find Me If You Know Me" 2025-07-03

15 Items: - plant- Big win- Patriot of ??- Music and music- round and ring'ed- Her favorite award- we are very emotional- School days fast throw- friends trip to a match- jumps and humps heee!!!- something you want to do- all Your favorite symbols present- Blue buildings, Blue Skies, Blue water- Anytime, anywhere you can see it on her...

Unit 9 Definitions 2025-12-08

17 Items: A collection of objectsFundamental ___ PrincipleElements in both sets A and BThe set of all possible outcomesA useful way of visualizing setsElements that are in either A or BA possible result from an experimentAn action or trial with varying resultsA way to describe a set with no elementsThe product of all natural numbers from n to 1...

Word Search vocab 2024-09-11

31 Items: rugbedredlampwallbluegrayPinkvideowhitebrownblackmirrorcolorsyellowpurplebedroomcurtainspaintingDVD playertelevision settelevision, TVWhat color...?orange (color)closet, wardrobeshelf, bookshelfcompact disc (CD)clock (alarm clock)sound (stereo) systemnight table, end tabledresser, chest of drawers

Islam and Crusades 2026-02-10

13 Items: holy book QuranLeader of the third CrusadeBuilding where muslims worshipFounder of the religion of IslamMuslim leader of the third crusadeCode of Conduct that all knights followedThe Third crusade ended with a peace (blank)Name of the war fought by Muslims and ChristiansCity the Muslims and Christians wanted control of...

Harry potter 2023-06-12

14 Items: Scared of spidersHeir of slytherinA Hufflepuff girlFriends with GoyleFriends with CrabbeA twin brother of FredHe killed Nagini the snakeA Chinese girl from RavenclawThe main character of the movieA Weasley that died in the last movieThe smartest one out of the group of 3A lovegood member taken by the death eater...

TH 8 Review 2026-03-25

12 Items: schoola contestveterinariansomeone downstudies classmakes perfectup toilet papercare of somethingnotes in language classsome cheese into the cageup a word in the dictionarya worksheet in history class

Pathophysiology Practice 2025-06-15

15 Items: Plantar wartItching sensationMalignant bone tumorOily secretion of integumentFixation or immobility at jointNoise of broken bone rubbing togetherScratching that results in abrasion or woundExcessive forward curvature of thoracic spineInflammatory disease of the eye's uveal tractPlug of keratin and sebum within hair follicle...

Task #13 - SPH4U Word Search (Lucas Soliman) 2023-06-14

25 Items: A quantity with only magnitude.The change of an object's positionThe x and y properties of a vector.The amount of matter within an objectThe amount of energy stored within an objectenergy in the form of motion within an objectA material that permits the flow of electronsThe rate of change within an object's position...

Salon Skin Care 2023-07-10

20 Items: Foul-smelling perspirationCapable of destroying fungiA large blister containing clear, watery fluidThe study of muscles - their structure, function and diseasesAny material that allows or supports the flow of electric currentSmall, red elevated protrusion of the skin, usually containing no pus...

Dept. Education and Early Childhood Development 2016-05-18

16 Items: earlyyearsschoolofficegrowthstressbranchsubsidydaycarecenterscubiclelearningfamilieseducationchildhooddepartment

A Baker's Dozen 2023-01-14

16 Items: eggsteamdiaryextraicingsugarflourschoolbakingtwelvecupcaketeacherhomeworksprinklesencouragefriendship

Week 3 Spelling Words 2023-05-30

16 Items: savekeepsafeeasygraderaisethemeoceanschoolfatherscreamtravelreachedhighwaynavigatedirection

Back To School 2023-07-26

16 Items: deskbooksclasspaperpencillockerschoolaugustteacherstudentfriendsbackpackcomputerhomeworklearningknowledge

Girls Group Crossword 2024-01-04

16 Items: safeannahazylslimechloetiannabaileyschoolmikaylarespectdanielafriendsjaylynnkindnesscoloringpositivity

School Sample Puzzle 2024-01-16

16 Items: testquizmathstudysmartschoolsubjectcontentscienceenglishhomeworkeducationacademicsschoologyassessmentsocialstudies