data science Word Searches

Grade 7-8 MegaFun Word Search 2025-01-14

10 Items: science or logicid, ego and superegoBig fish in a small ......any person who buys a productWilliam..., wrote Lord of the Fliesa town where people lived very longa promise of quality or length of use.symbol of Jesus Christ in Lord of the Fliessystem where the most talented have the powerMalcolm...., wrote David and Goliath and Outliers

EnviSci Chapter 1 2025-11-13

24 Items: Educated guessInformation from studiesOil, coal, and natural gasA description of a pattern in natureA variable that scientists manipulateHumans and human welfare most importantNaturally replenished over short periodsNaturally formed more slowly than we use themBroader explanation for a wider range of observations...

MockWorldSearch 2024-01-18

108 Items: catsettaxaircubflypanbeecrydiplionkingjacksoreneatbeefcoolzoomsnowfangpetsbusypestsilkwisehighswaycoatdenyzebrahippoqueenjokerjumpyclosesnaildrinksteepamuckspikybriefstalebikestrailshortgradeawfulimplycravefreezeelatedflowerverifycolourforbiddoctorimmuremotionfavourcannontawdryimperilscienceashamedimperilcrowdedbereaveworriedswallowairportforgive...

100 Days of School 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Geometry Word Search 2025-04-01

32 Items: gleathgeoancedistanglequingleigletiondistacelesmetryaouteodtusactusecongrucalenethe study of shapesa figure with 3 sidesthe science of numberssame size and same shapea figure formed by 2 raysthe space between two pointstriangle with 2 congruent sidestriangle with 3 congruent sidestriangle with no congruent sidestriangle with 3 congruent angles...

Analytical Word Search 2025-10-01

100 Items: ENTPLOTAUDITERRORNOVELPOWERSQUARECOHORTEDITOREFFECTFIGUREGENOMEIMPACTREVIEWSURVEYTHEORYTHESISAVERAGECARDIACCONTROLCONSENTCONTROLETHICALJOURNALMETHODSOUTCOMEPATIENTRESULTSSCIENCEUROLOGYCITATIONCLINICALDATABASEFINDINGSGENETICSANALYSISONCOLOGYPROTOCOLQUESTIONREVIEWERRIGOROUSSAMPLINGTHEMATICVARIABLEEFFECTIVESECTIONALHISTOGRAMINTERVIEWNARRATIVENEUROLOGY...

Year 5 Semester 1 Wordsearch 2025-11-27

108 Items: moodyirateboughcoughhomeyroughloughweirdchiefniecepieceweighpeacecivilfightploughserenethoughgrumpyfoughtsoughtmoderne-bookrobustalliestreatybordernotionfiniteoptiondroughtthoughtvibrantachieveproteinforeignneitherpopularreceivesciencefictioneconomypeacefulbustlingthrilledhiccoughcharmingspitefuldoughnuttouristycomposedmajesticstunningjubilant...

100 DAYS OF SCHOOL 2026-02-05

100 Items: ArtGymMapPenBookCampDeskTripGameWorkWorkMathTimeSeatTestTimeToolToysWalkZoneBookBullyClerkCubbyGradeMusicRulesSnackStudyYoungFolderLessonMarkerMemoryPencilRecessReportSketchSpeechSupplyZipperFriendsGradingLibraryProjectReadingScienceShuttleStationTeacherUniformWritingActivityBackpackCalendarColoringComputerExerciseHomeworkInteractInternetLearning...

Hard Word Search 2026-04-15

105 Items: BusArtGymTapeMathDeskBellPensTestQuizDrawReadExamLunchSmartBooksNotesChairMusicRulerTeachClassWriteGradeClockChalkCoachGlobeCubbySchoolApplesPencilSnacksFolderSportsLockerBinderEraserLessonCrayonsScienceEnglishWritingMarkersSpanishHistoryAlgebraBiologyGeologyProjectLibraryHallwayStaplerTissuesJanitorScissorsNotebookLearningComputerTeachersStudents...

Easy work 2026-05-13

108 Items: penoeingaddchanellajosejuandiazaurachatrizzmathroottripcardracesafekindSantarenojsimonjorgebellaeliasalexajuliorodaslopezsigmalearnwordsfieldunionlunchdanceyoungPastoredwardmarcosdanielselenajuarezmanueljosephnayelianibalduartenajeramaganalampanvargasdivideavenueireadygradesreportrafflerecessmontanovilledavasquezestebanabigailpasqualcasildofuentes...

Kidpub Word Search 2025-02-24

10 Items: another word for typefacesallows users to edit imagesis a hypertext markup languageused to describe digital writingyou can creat one using google sitescollects, organizes, and manages dataa website used for digital book makinggoogle slide is an example of this kind of softwareprovides online access to image, audio, and video resources...

LAB RATS THANKSGIVING 2024-11-20

105 Items: PieHamPPEBuckCornDeerEllaFallMaryYamsArrowAsterBreadCassyFeastGravyPhoneRogieStacySaladButterDanielDinnerGatherGlovesGobbleHaileyLaurieLeavesSalineSodiumSputumSquashSupperTurkeyAlbuminAlcoholBiologyBlessedCarrotsDersheyGibletsGlucoseIndiansLithiumNeedlesPuddingScienceSiobhanStormieCultureBiscuitsBroccoliChlorideEfigenioFoodComaGratefulMacaroni...

Critical Thinking Period 2 and 3 2025-05-22

104 Items: MaxSamartLuisJuanSeanMayaLiamLeviFinnRiyaSaedskimscanreadmathKubuShayRomepeakHorchKrychBrunoCalebEthanGraceBrelyJacobRinoaKhyinYoungAnayaMeloyWellsMoorePricePradaBruniEgyptIndiaChinaearthghosttotalAdonisAndrewAliyahJayleeAstridJamesBJamesMDanicaKalaniAnaleeLeanniWesleycivicsCroucheverfiBrotkaVargasMaranoThomasIsraelGreecepatinaValeriaDerrickAbigail...

Blueback word search 1.0 2025-12-01

111 Items: seakidreefbabylanddoraabelfishsandtidesurfclammaillovereeffinsomenrainswimcoralmarryoceanboatsshorewavesswellgreedmoviesharkstormFamilydiversmotherstellafathernaturewhalesseabedpearlswisdomauthorscalesmarinesewwedcraftywitherfishingabalonefishingashamedsurfingwetsuitfriendsflowerssnorkalsciencecompostharbouranxiousloomingexploithistroyobscure...

6G Savvas Elevate Science Topic 7: Minerals and Rocks in the Geosphere 2025-03-03

13 Items: crustmantlemineralcrystalsedimentoutercoreinnercorerockcycleseismicwaveigneousrockcrystallizationsedimentaryrockmetamorphicrock

Data takes flight - Navigating privacy at the airport 2026-01-07

3 Items: ourJoinconference

Summer 2023-09-11

100 Items: hotsunhaticesandswimfirewoodjunejulytripfoodcokesodasingreadbakedopegoatyolobeachtowelhumidsunnyriverpartywaterfruitmangograpeguavapaintmoviestudyjapankoreachinasummercastlesportshotdogsmoresforestaugustshortsparadegelatopapayaorangepuzzletravelmexicokaraokecampingweathertouristbandanasandalsindoorssciencewritinghistorycountryecuadorenglandumbrella...

Monkey Word Search 2024-07-05

100 Items: phococogoatlilyendofishGatetentsealikeainyobearcozyjuneloveoceantahoeRanchlemurbunnyitalypratomilansheepotterReyesaamerdonutwhalemarinmochijapanEarthhondabeachquailmonkeysierracarmelsalmonhikingbutterfamilyhusainjennernevadatildencoyotedallasalbanyalpacacactusislandchurrohawaiigordoscampingmammothstinsontomalesseattleraviolipenguinfunstonhammock...

100 days of school 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Acceptance Word Search 2025-11-17

100 Items: FunHatTieLoveSionPatsBellworkCampcasePensartsDalyDatesExamsRulesSimondriveMusicBooksTeamsHappyAllmanLockerFamilySmilesMarianSportsNervesGrowthHousesRecessLibraryScienceAnxietyFriendsStadiumCanteenHallwayuniformCharismClassesHopefulLeadersUniformWelcomeRespectKindnessRevisionLaughingRoutinesAssemblyBackpackMaturityMemoriesSubjectsSwimmingTeachers...

Activity Word Search 2025-12-18

104 Items: ITPENamagebeddaydayhatjamMayartfunnamefacehometimeweekchipkitecampbikeroomtreecitytownJuneJulygameJapanteethclockbreakmusictodayclasspartywaterjuicegrapeAprilhorsepianothingsportmathsstoryMarchfriendschoolMondayFridaySundaysurveyguitarsummerflowergardensingerlettersportsAugustgoodbyeEnglandAmericacountryroutineweekendTuesdayJanuaryvillagescience...

Deutsch IV 5.2 2026-05-03

26 Items: truthlegibleto cheatcomplaintto inventto imitateto deceivecomparablerepeatableconversationlie (untruth)investigationto exaggeratenatural scienceto damage, harmto lie to someoneto twist the factsconclusion, wrap-upattainable, reachableto have sth in commontest subject/person (male)test subject/person (female)to realize, put into effect, implement...

Soap Word Search 2025-07-28

21 Items: A film or show with singing and dancingshow A program where guests talk with a hostcomedy A funny love story in a movie or showA funny movie or show that makes people laughA suspenseful movie with tension and excitementA film made using drawings or computer graphicsA movie about cowboys and life in the Wild West...

Soap Word Search 2025-07-28

21 Items: A film or show with singing and dancingshow A program where guests talk with a hostcomedy A funny love story in a movie or showA funny movie or show that makes people laughA suspenseful movie with tension and excitementA film made using drawings or computer graphicsA movie about cowboys and life in the Wild West...

V-Guard Word Search 2024-06-13

10 Items: Provides instant hot water for your comfortEfficient cooking with precise heat controlTransmitting power and data with reliabilityKeeps you cool with a gentle breeze on hot daysEnsures efficient water supply for various needsProtects your electronics from power fluctuationsHarnesses the sun's energy to heat water sustainably...

N5-2C12 2025-01-15

32 Items: jobsoonrecallfuturewriterrapidlylifespanmoreovergraduallyto appearrepeatedlyto decreaseto threatento cope withto be chillyto take awayto come truepromising jobcommunicationto get rid ofto live longerto be automatedto be promisingto be mechanizedto substitute formedical specialistto design the futureto predict, forecastto predict the future...

Third Word Search 2025-05-26

100 Items: GumDayGymFunMathMuchGuggParkAreaTimeBestPensThirdWorldLunchMusicTalesNounsVerbsBonesJointGamesPartyHappyProudBooksPaperGoalsShalomMertonArcadeRecessFablesPoetryMotionTraitsHeroesEventsGrowthPencilReadingWritingStudiesScienceCursiveBretzelBittmanLibraryFictionFictionOpinionAdverbsWeatherClimatePelletsMusclesFriendsPost-itCrayonsPencilsMarkers...

Activity Word Search 2025-12-18

104 Items: ITPENamagebeddaydayhatjamMayartfunnamefacehometimeweekchipkitecampbikeroomtreecitytownJuneJulygameJapanteethclockbreakmusictodayclasspartywaterjuicegrapeAprilhorsepianothingsportmathsstoryMarchfriendschoolMondayFridaySundaysurveyguitarsummerflowergardensingerlettersportsAugustgoodbyeEnglandAmericacountryroutineweekendTuesdayJanuaryvillagescience...

Middle School Chapter Coming to an End! 2026-05-13

104 Items: HopeGoalsUnityBeginFutureGrowthDreamsVisionEffortLegacyLockerCampusRisingAspireUpliftStriveLaunchJourneyAimhighBelieveAchieveCourageBraveryRespectSupportPassionGoodbyePencilsScienceAlgebraHistoryEnglishWritingReadingForwardFreshmanMovingupProgressAmbitionStrengthKindnessTeamworkMemoriesFarewellYearbookHallwaysBackpackTeachersSubjectsProjects...

Containformation: Word Search 2025-09-11

13 Items: A type of malware that attaches to a program or file andThe use of digital devices to harass, threaten, or humiliate someone.Negative or unfavorable feedback from customers about a product or service.False or inaccurate information that is spread without the intent to cause harm....

Clinical Research 2025-06-03

10 Items: Lead researcher at a siteInactive control substanceConcealment of treatment group assignmentAny untoward medical event in a participantQuestionnaire where site records study dataMasterplan that spells out every study procedureFinal variable used to judge a treatment's effectChance method for assigning volunteers to study arms...

April Vocab #2 2026-04-15

9 Items: Part of a lineTo draw on a graph or mapnumeral 1 followed by 100 zerosA length equal to 3 feet or 36 inches.any curve that looks like an egg or an ellipseextends infinitely in both directions (no ends)having the same shape but not necessarily the same size.the collection, organization, presentation,interpretation and analysis of data....

Caves 2026-05-21

10 Items: rock pendants: ____________animal that roosts in caves: _______Early humans left _____________ on cave wallscaves that are formed quickly by lava: ____________science of studying and exploring caves: ____________Six women excavated more than 1,800 fossils of _________Waitomo Caves in New Zealand are known for _____________...

SAGE Diversion 2016-04-20

110 Items: ArtMathLabsTextDeskSageLateBandFireNounVerbPoemsPaperLunchFieldTripsChairBenchTardystartDanceChoirdrillStudyFlashcardsclaimSimileSocialHealthSchoolBreaksSportsLockerBussesIdiomsGradesClaimsAdverbTestingReadingScienceWritingStoriesQuizzesHistoryStudiesPencilsGrammarFriendsLibraryCoachesJanitorFacultyCarpoolCounterLanguageMetaphorPrefixesSuffixes...

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

PACE 2025-05-31

100 Items: ELMAIDBARNDORMFERNPLANPACEPONDTEAMDEANSDYSONFAFSALUBINMARKSMEDIANORTHPATONPRIDESANDSSTUDYTBONEALUMNICAMPUSCHOATEGRADESHEALTHHONORSJUNIORKESSELMARTINMILLERNATURESENIORSOCCERSPIRITADJUNCTBUTCHERDIPLOMAFACULTYGANNETTLIBRARYMASTERSMORTOLANURSINGPROVOSTSCIENCESETTERSWELCOMEWILLCOXADVISINGBOUDREAUBUSINESSSERVICESCOMMUTERCOSTELLOFINNERTYFOOTBALLFRESHMAN...

Ellie is 30! Sip & Solve 2026-04-08

30 Items: NicknameStar SignShoe SizeMiddle NameWorst HabitBiggest FearFirst ConcertGo-to PerfumeFavourite SongFavourite FilmFavourite DrinkMost Used EmojiFavourite ColourFavourite AnimalFavourite SeasonFavourite DessertCurrent Dream JobFavourite TV ShowFavourite TakeawayGo-to Karaoke SongChildhood Dream JobBest School SubjectFavourite Girl Dinner...

Alphabet Word Search 2026-04-10

100 Items: BusYouRoomFairDutyDeskExamTripPassTestAppleBoardChalkCoachGlobeLearnPaperRulerTutorEraserFolderGradesLaptopLessonMarkerMentorPencilRecessRewardSchoolWisdomCollegeCrayonsDiplomaFacultyInspireJanitorJournalLibraryPlannerProjectReadingRespectScienceStudentSuccessSupportTeacherUniformWritingAlphabetApplauseBackpackBehaviorBookmarkComputerLearning...

Digital Literacy 2026-03-16

15 Items: Also called programs, use the platform to perform tasks.Equal to 1,024 GB, approximately equal to trillion bytes.A sequence of instructions that can be executed by a computer.A pattern or picture on the screen background that you can choose.The plural for the Latin word datum, meaning an item of information....

Kortney Birthday 2025-11-18

10 Items: Your first nameYour birthday monthYou wear these to seeYou celebrate this holidayVolunteer at this science mueseumYour friend that used to work at UNMHYou celebrate this holiday in NovemberYour friend that used to go to Project Search withThe name of your teacher when you were in Project Search...

Forensics CH1 2025-12-15

10 Items: who made the exchange principlespecialized forensics service (dental)what Locard believed connected criminalstype of science, criminal and civil lawspolice analyze __, as an unbiased methodthe other important location besides labmore than 100 countries have one of theseyear the first DNA profiling test came out...

Dns Word Search 2025-06-20

15 Items: Converts web addresses to IPsProject management methodologiesOverall experience and usabilitySystem to track changes (e.g., Git)Designing for mobile before desktopCode that is free and shared publiclyImprove code without changing behaviorService that stores your website onlineVisual elements the user interacts with...

11 2025-08-16

15 Items: Nickname for a motorcycleAnother name for paved roadsPlace for racing motorcyclesMaterial used in many roadwaysa person who committed a crimeCommon road surface for highwaysanother name for a one percenterA type of motorcycle racing arenaThe feeling of freedom riding bringsUnpaved surface, often rough terrainLoose stones often found on dirt roads...

Oms Word Search 2026-04-05

5 Items: Característica do SUS no BrasilAção de informar e orientar a população sobre a importância da saúde.Organização internacional responsável por criar essa data comemorativa.Sistema de saúde brasileiro que garante atendimento gratuito à população.Direito garantido a todas as pessoas, relacionado ao bem-estar e acesso aos serviços de saúde.

Explicit Word Search 2025-11-15

6 Items: What KM tool uses games to engage users?What visual tool shows linked concepts and ideasWhat type of knowledge is easy to codify and share?What internal network do companies use to share infoWhat process involves acquiring knowledge from sources?...

Glossary 2024-11-11

15 Items: Lower than the  adjoining land.Raised, flat ground, higher than plains.A natural feature of the earth's surface.Heigh above a given level, especially sea level.Natural elevation, make mountain ranges when aligned.The tidal mouth of a large river, where the tide meets the streamBroad, flat, low-lying areas, no higher than 200 m above sea level....

Expand Your Horizons 2026 - Word Search 2026-03-12

15 Items: You are a future LEADER.'CTE' stands for "Career _______ Education."_____________ is considered the "birthplace of [answer to Q1]."60 units will make you eligible to receive an ____________ degree.If you're doing a research project, you may present it at _________.One of the common workshops at the Skyline College "Fab Lab" is _______________....

Modern Word Search 2025-10-30

110 Items: inontapfortagfastslowbankdatafilelinksavesendtypepostdownscansyncmutesmartmouseWi-Fistickcableclickswipeshareprintstoretrackmodernusefulbrokenonlinedevicescreenlaptoptabletroutersignalfoldermemorycamerapop-upenginescrolluploaddeletechargeupdaterecordstreamfollowunplugrebootaccessbrowsehelpfuldigitalofflinechargerbatterystorageadapterspeakermonitor...

Math Word Search 2026-04-27

120 Items: OddSumSetRealEvenBaseRootTermAxisLineAreaAreaEdgeFaceDataMeanModePrimevaluevalueRatioRangeSlopeGraphPointPlaneAngleAcuteAngleRangeLimitProofAxiomUnionFactorLinearDomainMatrixVectorOriginObtuseCircleRadiusVolumeVertexRadiusMedianSampleSubsetIntegerComplexProductDecimalRadicalFormulaPolygonSimilarTangentMaximumMinimumTheoremRationalQuotientMultiple...

Spelling Bee Level 1 2026-05-11

122 Items: skywokbangbarnchindatadawndinefairfateforkgoatgolfholyleftlimemailmeatmintmoodpainpartpathPeruplotpuckracerarerashrealreapsalescarshoeskimsnowsoilsolosongsumoswagtacttailteamtidetoneunitvasevinevoltwaitwashweakwildwirewormyelpyogazestblackbroadcabinchesscreekdancefleetfrontinletjellylemonmatchminceorbitpaintpartyplatepointpowerproveroyalrulersalad...

Good Laboratory Practices 2024-05-14

17 Items: The G in GLPThe L in GLPThe P in GLPThe L in ALCOAThe C in ALCOAThe O in ALCOAYear GLPs writtenYear GLPs approvedThe first A in ALCOAThe second A in ALCOAYear GLPs written into LawDescribes how a task is done on a studyCurrent Summary of training and experienceDirector Single point of contact for a study...

Phone 2023-06-06

10 Items: to end a callto return a calla monthly agreementto ring or make a soundto put in a number to make a callto pay for phone credit/data as you need itcompanies like Eir, 3, Lyca mobile, Tesco mobilewhen a phone call ends suddenly because of network problemsto be made wait on the phone especially for customer service...

Eurofins PSS 2026-03-26

10 Items: Eurofins PSS' HQ location.Who is the HR manager for Belgium?What does the “P” in PSS stand for?What country was Eurofins founded in?Eurofins prides itself on ... service.One of the 4 pillars is ... excellence.What letters represent the 5 requirements of data integrity?Where do you upload your medical certificate if you are sick?...

Inca and Maya Conflict Project 2022-09-20

15 Items: A female deity.Gods of the wild.We walk or dive on.Science of farming.An event of circumstance.A period of a hundred years.All visible future of an area.Person who designs a building.Largest continental mountain range.Widespread occurrence of a disease.The create and ruler of the universe.A condition of having too many people....

Women's History Month [Find the description that matches the women on the fireplace] 2026-03-04

15 Items: HIV/AIDS ActivistMother of Science FictionIraqi & British architectWriter & Television ProducerJapanese Feminist & SuffragistFirst Trans woman to win an emmyBritish Martial Artist & SuffragistFirst Trans woman to play the USA OpenMother of the Disability Rights MovementInvestigative journalist and abolitionist...

January Word Search 2026-01-05

121 Items: IceMugSnowColdCozyWinsDataToDoDeskFrostChillScarfBootsGoalsResetFocusEmailInboxIdeasTasksChairDriveTrustWinterGlovesAgendaCoffeeVisionGrowthReviewBudgetTrendsHabitsEnergyValuesJanuaryRefreshRestartKickoffMeetingPlannerSuccessLessonsMetricsQuarterReportsUpdatesCheckinProcessSystemsMonitorComfortBalanceRoutineSupportCulturePurposeMissionForward...

Math Word Search 2026-04-27

120 Items: OddSumSetRealEvenBaseRootTermAxisLineAreaAreaEdgeFaceDataMeanModePrimevaluevalueRatioRangeSlopeGraphPointPlaneAngleAcuteAngleRangeLimitProofAxiomUnionFactorLinearDomainMatrixVectorOriginObtuseCircleRadiusVolumeVertexRadiusMedianSampleSubsetIntegerComplexProductDecimalRadicalFormulaPolygonSimilarTangentMaximumMinimumTheoremRationalQuotientMultiple...

Math Word Search 2026-04-27

120 Items: OddSumSetRealEvenBaseRootTermAxisLineAreaAreaEdgeFaceDataMeanModePrimevaluevalueRatioRangeSlopeGraphPointPlaneAngleAcuteAngleRangeLimitProofAxiomUnionFactorLinearDomainMatrixVectorOriginObtuseCircleRadiusVolumeVertexRadiusMedianSampleSubsetIntegerComplexProductDecimalRadicalFormulaPolygonSimilarTangentMaximumMinimumTheoremRationalQuotientMultiple...

APUSH 2001-2025 2025-04-28

22 Items: The company that launched AWSThe company behind the Starship programA popular virtual assistant launched by AmazonGlobal wireless internet connectivity between devicesA voice-activated virtual assistant developed by AppleComputers or machines are made to think and act like humansThe increasing ease with which one can connect to the internet...

TEKS EKSPOSISI 2025-05-06

10 Items: urutan bagian dalam teks eksposisidata yang dapat di buktikan kebenarannyaciri bahasa yang mudah dipahami oleh pembacasuatu pernyataan yang dapat diterima akal sehatisi atau pesan yang di sampaikan dalam sebuah tekshasil proses memahami, mengamati dan mengkaji sesuatupernyataan yang digunakan untuk mendukung pendapat dalam teks eksposisi...

MCAP review 1 2025-05-06

10 Items: highest power is 2highest power is 1Things you multiplyThe top of the graphYou can use this to model a percent changeall the other y-values are greater than this oneIf the graph is concave up, this is at the bottomWhen a set of data doesn't exactly fit a line, do thisTells you how many solutions the quadratic equation has...

computer 2024-07-19

10 Items: A set of rules or steps followed to solve a problem or perform a task.Software intended to damage or disable computers and computer systems.A set of rules governing the format of data sent over a network or the internet.The process of converting information into a code to prevent unauthorized access....

Economy Chapter 1 Definitions 2025-09-12

14 Items: To use limited resources efficiently in production.A theoretical unit of satisfaction that a person gains from consuming an item.A particular use of resources that achieves a desired end, such as consumption.The study of the way society makes decisions about the use of scarce resources....

Biomedical Engineering Word Search 2026-03-23

14 Items: To make better or as good as you canA minimum requirement for how the design must functionA desirable outcome given up to gain another desirable outcomeIn engineering design, some-thing that limits the solution to a problemA series of steps that engineers follow to come up with a solution to a problem...

VOCABULARY 1 UNIT 4 2025-12-03

10 Items: an illnessa test to learn somethingopposite of light in weightto move or drop to the groundto show that something is truesomething that allows us to see thingsa person who studies or works in sciencesomething that you take when you are ill or sickto touch someone or something quickly and with force...

Vit/Viv 2025-05-12

9 Items: clear, or brightto bring back to lifeto exist, or to stay alivenecessary, or essential to lifea food substance that aids healththe act of cutting open live animals for scienceattractively animated, or lively (related to a person)friendly, lively, and enjoyable (atmosphere or event)....

Evolution Vocabulary 2026-04-09

10 Items: remains of ancient organismsscience concerned with classificationscientific study of biological diversityspecies change slowly over time, not suddenlyan organism's success in surviving and reproducingsocial group to which an individual does not belongleads to species found in only one specific, limited area...

Unit 4: Spelling Quiz 1 2022-11-29

30 Items: comicaltruthfulnessshowing mercymarking a distinctiona physical disabilitydefiance of authoritythe operation of aircraftto set or keep apart; dividenasty or disgusting in naturean overseer or head of a groupto grasp suddenly and forciblyof a particular person; privatethe pouch which encases a letterthe biological science of animals...

Proforest Word Search 2024-10-08

51 Items: Mass BalanceGreenhouse gasLand Use ChangeChain of custodyTheory of ChangeHigh Carbon StockSoy working groupZero DeforestationConsumer Goods ForumHuman Rights CoalitionPalm Oil working groupSoft Commodities ForumSocial Risk AssessmentIndependent SmallholderHigh Conservation ValueTropical Forest AllianceForest Positive Coalition...

Vocab blast - translate French and find English 2024-01-08

33 Items: je vais écouterelle est...........regarder............souvent.............il est..............c'est...............parce que............jouer.................j'écoute..............j'ai écouté..............je regarde...............écouter...................j'adore.....................normalement..................les infos.........................

The word guesser 110 2024-11-20

110 Items: catsadmadmapcapzaphatfargumartbeebinlionfirezerohoopboathardeasytallstargoodevilgluebearhairfairzebrahippochessangryjapansushiwaterhappystylekarmasigmachinahelthvideogamesitalypizzachilitrainsantaflutemangomusicmoneytigerclocklunchchalkboardspicytablegrassbooksgooglefamilyschooljelousdoctorpencilcrayonhotdogpeppereasterpoodleviolinbrainsmovies...

School in Japan 2026-06-01

39 Items: ITArtP.E.MathsMusicDramaRecessschoolScienceHistoryHome EcteacherHomeroomPeriod 1Period 2Period 3Period 4Period 5Period 6GeographyLunchtimeHumanitiesYear/GradeUniversityManual ArtskindergartenI study _____.Primary SchoolSchool SubjectsI/me (only boys)Religious StudiesJunior High SchoolSenior High SchoolI'm bad at _______.I'm good at _______....

Proforest Word Search 2024-10-08

51 Items: Mass BalanceGreenhouse gasLand Use ChangeChain of custodyTheory of ChangeHigh Carbon StockSoy working groupZero DeforestationConsumer Goods ForumHuman Rights CoalitionPalm Oil working groupSoft Commodities ForumSocial Risk AssessmentIndependent SmallholderHigh Conservation ValueTropical Forest AllianceForest Positive Coalition...

Chapter 5 2025-08-01

5 Items: An example of exothermic reaction in daily life.Reaction that absorbs heat energy from the surrounding.When endothermic reaction occurs, the surrounding temperature _____.Branch of science that studies the changes in heat energy in chemical reactions.Exothermic reaction is the chemical reaction that ____ heat energy to the surrounding.

early childhood 2024-04-19

116 Items: desknursebookschairtablepapermusicnannyschoolweeklytoddlerecessfidgetblocksshapespencilinfantdaycareteacherlearingprogramnurserysupportculturemagnetspuzzlesnumbersmarkerscubbiestissuessciencedancinganimalscookinglibrarystorageprintercrayonsnewbornsandboxhomecaretrainingfeelingsbabblingemotionsfamilieslanguagesanitizesandwichlunchboxbackpackcomputer...

DOLPHINS CHIMPS & ELEPHANTS 2025-04-27

21 Items: helpsmart人気のあるthe same特定の(特定の笛)a merit, 利点a high sounddolphin groupsalmsot the samehave fun togethera way of thinkingthe smartest monkeyfriendly, in a groupstrategies & methodsきちんと 正しい / correctlya way to do somethingyou can remember (well)people who study sciencea big, orange chimpanzee?use them to create music 楽器you can do it! Try! 誰かに何かをやろうと勧める

SAMPSON STALLIONS 2025-09-07

115 Items: FOXLEEMATHALMSDUNNEARLHOODREEDREIDROLLROSERUDDYANGPOLKPREKFIFTHFIRSTARAVEASTONBAKERBONDYBOMBABORAKELETAGOMEZDAVISMOOREMURRYPEREZPERRYPRICEREYESSMITHPEAMSPEREZPERRYTHIRDFOURTHACOSTACDAVISFERRERFRENCHGARCIAHABADAHOPPERKONCIRMARTINMICHELMITTONMOTZNYRIVERASITLERTEMPLETHOMASZAPATASECONDGRAMMARLIBRARYBARAKATBARFUSSBICKHAMBRANDONBRELANDBYGNESSGAMBHIR...

Malware Word Search 2024-09-12

7 Items: blocks access to a phone that steals moneywhen a scammer claims to represent a company onlinebreach data that a company stores is exposed to a hacker.It makes it harder for a hacker to gain access to your devices.questions identifying customers when they forget a password etc.Software designed to gain access to damaged software computer system...

Ma-Ka-Ja-Wan Merit Badges 2025 2025-06-25

42 Items: ArtNatureRowingArcheryCampingCyclingFishingGeologyBasketryCanoeingClimbingForestryKayakingSwimmingAstronomyFirst AidMetalworkBird StudyLifesavingPioneeringLeatherworkPhotographyWoodcarvingHorsemanshipMammal StudyMotorboatingLearn to SwimFingerprintingPulp and PaperRifle ShootingShotgun ShootingSearch and RescueConservation CorpsSmall Boat Sailing...

Giant Word Search for ESL 6th Grade (1st Version) 2026-02-02

120 Items: hotsadredMayeggcoldcoolbusyfinegoodsickmathstarbluepinkfallJuneJulycornnutsbeefporkfishHellonightsunnyrainysnowyhappysorrytiredmusiccrossheartgreenblackwhitebrownMarchAprilapplebeanslemonmangomelononionpeachcloudyMondayFridaySundayhungrysleepycirclesquareyelloworangepurplespringsummerautumnwinterAugustbananacarrotcherrygrapesorangepotatotomato...

NCE-51 2026-05-17

28 Items: 新的午餐音乐科学今天故事许多早上。星期一星期二星期三星期四星期五容易的星期六星期日放,安置图;地图制定,写学科,科目一日;白天找到,发现事情;物品计划,目标计算机,电脑在(某一天)字,词,单词图书室;图书馆

100 Category Words For The FET Exam 2026-06-08

102 Items: vetcagemaingenreEaglevenuemediavalleycomedyrabbitparrotacceptcareeronlinenephewLeaguejungleimaginefictioncompanycuisine& sushiofficerexploreleisuremanagerconsoledevicesweatherfactoryhackingwarmingStadiumanimalsepisodemountainscheduleSiblingsElephantdramaticsubjectslocationambitionengineertrainingreliablebenefitsChampiondomesticMemorieseducation...

NANO PCB 2025-06-13

6 Items: A classic and beginner-friendly Arduino board model.A very compact Arduino board ideal for tight spaces.A keyword used to send a value back from a function.Used to display text output with only 4 connection wires.A data type used to return decimal values from a function.The function in Arduino that runs once when the board is powered on.

Technical words - 3 2025-06-20

15 Items: Converts web addresses to IPsDesigning for mobile before desktopCode that is free and shared publiclyScrum Project management methodologiesImprove code without changing behaviorService that stores your website onlineLayout adapts to different screen sizesA computer that hosts and serves a websitecontrol System to track changes (e.g., Git)...

Sopa de letras con términos tecnológicos: IA, Big Data, automatización, IoT. 2026-05-24

4 Items: IAIOTBIGDATAAUTOMATIZACION

Week 1 Key Terms Word Search 2023-08-07

15 Items: Electrical cycles per secondGlobal de facto wireless networking standardThe measurement between triads on the displayLong-term storage device that plugs into the motherboardCompact and cheap storage device that can store a lot and are easy to useRoutine that is burned into a flash memory chip located on the motherboard...

vocab 2026-01-12

10 Items: quiet and modesta difficult choiceinequality; differencelacking in self-confidence; shyone who studies an art or science for mere amusementto express disapproval of; to depreciate one’s effortextremely poor; lacking necessities like food and shelterconformity to accepted standards of conduct; proper behavior...

Word Search 2026-03-15

7 Items: Discrimination or prejudice based on raceDesigner who created the Euthanasia Coaster conceptTechnology that allows machines to learn from data and make decisionsScientific theory about electricity used in early experiments on lifePsychological film about a famous comic book villain released in 2019...

Quiz MPMAX Edisi Maret 2023 2023-03-28

15 Items: Active Ownership merupakanLingkungan kerja yang negativeSingkatan dari Operating CompaniesIstilah penjualan pakaian bekas importDimanakah pelaksanaan Honda DBL 2022-2023?Lokasi Depo Pertamina yang terbakar berlokasi diPembelian Honda pada kegiatan Honda Virtual ExpoBudaya membagikan bingkisan makanan kepada anggota...

Unit 45-46 2024-02-07

50 Items: technological(color) copper(color) silver(η) the science(το) the plasticof or made of glassof or made of plastic(η) the temperature, heat(το) the cement, concrete(η) the (female) scientistof or made of stone or rock(ο/η) the (m or f) scientist(ο/η) the (m or f) biologist(η) the chemistry (fig or lit)(η) the (genre) science fiction...

Word Search 2026-03-15

7 Items: Discrimination or prejudice based on raceDesigner who created the Euthanasia Coaster conceptTechnology that allows machines to learn from data and make decisionsScientific theory about electricity used in early experiments on lifePsychological film about a famous comic book villain released in 2019...

Vit/Viv 2025-05-08

10 Items: To bring back to lifefriendly, lively, andExtremely clear, or brightNecessary, or essential to lifeA food substance that aids healthTo endure, exist, or to stay alive(related to an atmosphere or event)The act of cutting open live animals for scienceAttractively animated; lively (related to a person)...

Earth and Its Neighbors 2025-12-18

11 Items: our planetthe star of our solar systemsomeone who travels in spaceis the closest to planet eartha vehicle used to launch somethingthere are 9 of these in our solar systema device used to see things that are far awaycollection of planets that revolve around a suna force that moves something quickly and powerfully...

Vocab 2023-01-21

10 Items: quiet and modestinequality; differencelacking self-confidenceextremely poor; lacking food & shelterone who studies an art or science for amusementto express disapproval of; to depreciate one’s efforta difficult choice, especially one between two alternativesconformity to accepted standards of conduct; proper behavior...

Vocab 2023-01-21

10 Items: quiet and modestinequality; differencelacking self-confidenceextremely poor; lacking food & shelterone who studies an art or science for amusementto express disapproval of; to depreciate one’s efforta difficult choice, especially one between two alternativesconformity to accepted standards of conduct; proper behavior...

Revive Word Search 2025-05-07

9 Items: To bring back to lifeExtremely clear or brightNecessary, or essential to lifeTo endure,exist, or to stay aliveA food substance that aids healthAct of cutting open live animals for scienceAttractively animated;lively(used for people)Friendly, lively, and enjoyable (related to an atmosphere of event)...

E14 | Recruit + Retain 2025-02-05

92 Items: In99MTVKnowGenZAidsICPCGenXTeamSageDataCityiPodSpaceLindaof OzPriceCanvaFormsEquipPlazaHarryDavisSwiftVinylTrackListenConroyImpactBoomerBatmanAndrewTikTokSilentFriendSeekerBensonCooperHopperEminemiPhoneNetworkMelissaDorothyDivorceChatGPTBundickBeatlesThreadsTwitterAmateurCreatorTellingStablerShermanPeraltaOrbisonBeyonceNirvanaSpotifyLatchkey...

Uppingham 2025-12-03

15 Items: OUR SCHOOL NAME (14)OUR HEAD MISTRESS (7)HEAD OF UPPER SCHOOL(10)HEAD OF SENOIR SCHOOL(10)WHO IS HEAD OF SCIENCE(10)BUILDING OF LOWER SCHOOL(12)WHO WON THE FIRST HOUSE CUP(9)PAGE 19 CREATOR OF MAGASINE(13)PAGE 6 CREATOR OF MAGASINE (15)PAGE 22 CREATOR OF MAGASINE (14)WHO WON THE FIRST HOUSE COMPE (8)WHEN UPPINGHAM STARTED (NUMBERD ANSWER)(4)...

Unit 2 vocabulary revision 2025-02-27

10 Items: To go down in water.To stay on top of water.To make something dirty or unsafe.To wash something quickly with water.To block something so it cannot move.Special glasses that protect your eyes.A tool that helps you see very small things.A cup used in science to hold and mix liquids.To make a liquid go from one container to another....