data science Word Searches

Uppingham 2025-12-03

15 Items: OUR SCHOOL NAME (14)OUR HEAD MISTRESS (7)HEAD OF UPPER SCHOOL(10)HEAD OF SENOIR SCHOOL(10)WHO IS HEAD OF SCIENCE(10)BUILDING OF LOWER SCHOOL(12)WHO WON THE FIRST HOUSE CUP(9)PAGE 19 CREATOR OF MAGASINE(13)PAGE 6 CREATOR OF MAGASINE (15)PAGE 22 CREATOR OF MAGASINE (14)WHO WON THE FIRST HOUSE COMPE (8)WHEN UPPINGHAM STARTED (NUMBERD ANSWER)(4)...

Unit 2 vocabulary revision 2025-02-27

10 Items: To go down in water.To stay on top of water.To make something dirty or unsafe.To wash something quickly with water.To block something so it cannot move.Special glasses that protect your eyes.A tool that helps you see very small things.A cup used in science to hold and mix liquids.To make a liquid go from one container to another....

Introduction to Aviation: The Wright Approach 2026-01-05

25 Items: the curve of the wingcontrols the yaw of an airplanecontrols the roll of an airplanecontrols the pitch of an airplanethe type of mechanics the brothers were.the length between the ends of the wingtipsis directly affected by the angle of attackthe shape of the airfoil when viewing from abovethe length from the trailing edge to the leading edge...

English Discovery Words 2025-09-22

15 Items: an animal who barksthe king of the junglea white drink from a cowsomething you use to drinkto move your body in watera place where the doctor worksa place in school with many booksa big room for meetings or eventsa long yellow fruit that is sweetsomething you use to sweep the floora place where children playing around...

Cyber - Technical words 5 2025-06-27

12 Items: Becoming desensitized to frequent security alerts.Taking advantage of vulnerabilities to gain access.The process of sharing cryptographic keys securely.Protocols for securing communications over a network.An ethical hacker who uses skills to improve security.A framework for developing and executing exploit code....

Animal First Aid Cost, Profitability, Record Management 2025-10-02

14 Items: money earnedvalue added taxaudits or filesData Protection Act 2018public image of business or personmedicinal logs and records at a businesscosts or how much the business has spentrevenue or how much a business has earnedquality of life wellbeing safety comfortable etc.the state of keeping or being kept secret or private...

Uppingham Cairo 2025-12-03

15 Items: Our School Name (14)OUR HEAD MISTRISS (7)HEAD OF UPPER SCHOOL(10)HEAD OF SENOIR SCHOOL(10)6 CREATOR OF MAGASINE (15)WHO IS HEAD OF SCIENCE(10)BUILDING OF LOWER SCHOOL(12)WHO WON THE FIRST HOUSE CUP(9)PAGE 19 CREATOR OF MAGASINE(13)PAGE 22 CREATOR OF MAGASINE (14)WHO WON THE FIRST HOUSE COMPETETION(8)WHEN UPPINGHAM STARTED (NUMBERD ANSWER)(4)...

English Vocabulary Test "Vit/Viv" 2025-05-04

9 Items: To bring back to lifeExtremely clear or brightNecessary, or essential to lifeA food substance that aids healthTo endure, exist, or to stay aliveThe act of cutting open live animals for scienceAttractively animated; lively (related to a person)Friendly, lively, and enjoyable (related to an atmosphere or an event)...

CURRENT AFFAIRS 2026-02-07

10 Items: Global target to balance carbon emissions.Annual financial plan presented in Parliament.Batter who scored a record 175 in the U19 final.Digital platform for government services and documents.Technology that enables smart search and data analysis.Online platform providing free courses by top universities....

CURRENT AFFAIRS 2026-02-07

10 Items: Global target to balance carbon emissions.Annual financial plan presented in Parliament.Batter who scored a record 175 in the U19 final.Digital platform for government services and documents.Technology that enables smart search and data analysis.Online platform providing free courses by top universities....

Eurofins PSS 2026-04-15

10 Items: Eurofins PSS' HQ location.What does the “P” in PSS stand for?What country was Eurofins founded in?Eurofins prides itself on ... service.One of the 4 pillars is ... excellence.Who(name + surname) is the HR manager for Belgium?What letters represent the 5 requirements of data integrity?Where do you upload your medical certificate if you are sick?...

mixed 2025-05-01

122 Items: buscardogcatpigyatewizztaxilegogoatlambrungrangtrainguardfaultleedsplanegreenblackwhitemathsblankqueenbleekplacemusicpianocelloviolabrasssignaldundeeticketenginedieselyellowspookyburialguitarrailwaystationjourneydelayedjubileetauntonsaltasheasyjetenglishsciencephysicsbiologybeetleshamstertrumpetstringsbakerloovictorianorthernpenzanceplyomuth...

Time Flies When You're Having Fun! 2025-07-28

26 Items: Sped up26 milesFemale namePurring petsCity in TexasSpeedy canineFemale nickname00:00, not 12:00Puzzle in a gridCastle basementsCity in MilwaukeeSynonym of surpassSinging as a groupCity in MassachusettsTown in MassachusettsFlying fire-breathersLong-running TV quiz show___ science (a STEM major)___ science (a STEM major)Position in a sibling group...

Random word search for Mr. Scully 2026-01-27

123 Items: anbycatanticesunbadlionsockdarkrockmilemealdutytestrentloseruinheadAIDSwearparkhangbombrareballdrawrockrearzebrahippoplantkittyfalsechainpettysmellradiolayerheartweighenemyscalemuggyswellshoutcoachpanictrailschoollitterdegustmosquechargerevealgarliccandlelistenmethodsmoothwonderrevivetrenchrejecthunterunlikemakeupsciencespanishgirafeeglaciermusical...

Chapter 11: Weather Prediction 2026-02-25

16 Items: Is a simple instrument that measures temperature.An instrument that records temperature on a graph.Measures the speed of the wind at various altitudesThis format uses symbols and numbers to report the weather.A sighting instrument used to measure the path of a pilot balloon.Instruments that show the direction from which the wind is blowing....

Idk 2026-02-09

17 Items: _____ SlayerMC from One PieceThe ____ Piece is realDemon Slayer Michel JacksonThe (un)objectively best teacherCreator of One Piece (Last name)MC from Demon Slayer (Last name)MC from Demon Slayer (First name)Author of Demon Slayer (Last name)Tanjiro’s sister from Demon SlayerThe (un)objectively best teacher‘s room...

Roots, Prefixes, and Suffixes Mastery 2025-04-14

10 Items: BIOGENIC : Produced by living organisms.GRAPHIC : A visual representation or image.BIOGRAPHY : A written account of someone's life.AUTOMATIC : Operating without human intervention.BIOLOGY : The science of life and living organisms.PHOTOGRAPH : A picture made using light and a camera.AUTOMOBILE : A self-powered vehicle used for transportation....

Math Word Search 2025-06-21

10 Items: A subject where you add and countA subject where you move and play gamesA place where you borrow and read booksA subject where you read books and storiesA subject where you draw, paint, and createA subject where you sing or play instrumentsA subject where you learn how to stay healthyA subject where you practice letters and words...

Word search puzzle 2023-05-12

124 Items: upoilartrugdeafswimvarydietcalmpackvastareasilkworldquietgrasspointexistrangespacesugarbreadonionbloodhabitimagemetalnativementalnoticeeuropesimpledollorcheesequincerarelyweightrecentmiddayreplaycarpetuniquecustommuseumsurfingbesidesprojectregionspopularpercentimaginecenturysocietyabilitydespitehealthymeasureservingharmfulpreventdiseasenatural...

Español 2A 2024-02-01

50 Items: IheforsheeasyWho?lunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthi needboringI havespanishenglishseventhamusingto teachto studyto speakyou needfavoritelets seeyou haveart classdifficultmore…thantechnology(feminine)mathematicsyou(formal)the class ofthe schedulethe homeworkyou (formal)science classin the…..houryou(familiar)...

Firstday Word Search 2026-05-20

21 Items: Max failed?WILLOW WINS!!!Lexi's Hair Quote"________ Jitters"What is Amber not?Arnav's Water QuoteJaxson's Hair Quote?Arnav's Science QuoteFirst Literature ProjectWhere Max can't take photosI NEED THIS WHOLE TRAIN TO...Revolution Literature ProjectMr. Tucker's (best) Band Song"Better Than Mr. Marks" - Katelyn"Call Me That When You Have a PHD"...

UNC (medium) 2026-01-17

25 Items: UNC hoops legacySchool pride vibeSignature UNC colorUNC live ram mascotGraduation ceremonyUNC athletic nicknameMain street near campusAdmin building on campusRare collections libraryStudent housing buildingTown where UNC is locatedBasketball arena nicknameGym and recreation centerFans and alumni communityFootball stadium on campus...

Technology & Its Impact 2023-05-17

10 Items: compass, wheel, simple toolsa negative impact of technologya positive impact of technologyprinting press, satellite, engineContinent where the first technologies developedthe age in which the printing press was developedsector that has improved by the Internet technologythe first tools are said to be developed in this age...

YLC8 - Unit 6 - Reading 2025-11-25

10 Items: Not deep. (nông)Liked by many people. (phổ biến)Almost, very close to. (gần như)Tell someone about danger. (cảnh báo)Harm or break something. (làm hư hại)Used in science or factories. (hóa chất)Stays and does not leave. (ở lại / còn lại)Makes people or things come closer. (thu hút)A long, curved tooth of an animal like an elephant. (ngà)...

Perfect 12 #7 2026-01-12

10 Items: quiet and modestinequality; differencelacking in self-confidence; shyone who studies an art or science for mere amusementto express disapproval of; to depreciate one’s effortextremely poor; lacking necessities like food and shelterconformity to accepted standards of conduct; proper behaviour...

6th Grade Sight words 2024-03-18

120 Items: agebadnorcatledbithitsonsitedgesoftwallmeetcopyhe'sunitflatskini'vetestpairsandtailwaitsignhugeriderichteamnoteracedeadthinwifebornrulepullleadkingcornbearhopesongshapeeightsouthpartyforceaheadwrongcoverisn'tguessbloodstonewe'llsensewomenmeantthicksighttrainfreshdrivebreakradioboardbrowncleanobjectminuterecordforestwasn'tyellowregionperiodcorner...

Weather Ch. 1-6 Vocabulary 2024-10-02

13 Items: the movement of airplanet where we liveto change from gas to liquidto change from liquid to gasthe place where two air masses meetthe layer of air that surrounds Eartha dangerous condition that can cause damageinformation that is observed or measured and recordeda scientist who studies weather conditions and patterns...

Observer Word Search 2026-02-16

10 Items: Home of the iconic Telstra TowerThe best student newspaper in the worldANU library bunker of despair and productivityLake you claim you’ll jog around this semesterANU precinct where all roads (and lunch money) leadWar monument every visiting relative insists on seeingNightclub that guarantees at least one regrettable decision...

Computer Storage 2025-07-23

2 Items: Online storage, Offline storage, Memory, Permanent, Temporary, Data, Capacity, Backup, Flash driveRAM, ROM, HDD, SSD, USB, Cloud, Primary, Secondary, Byte, Bit, Megabyte, Gigabyte, Terabyte, Petabyte,

Computer Storage 2025-07-23

2 Items: Online storage, Offline storage, Memory, Permanent, Temporary, Data, Capacity, Backup, Flash driveRAM, ROM, HDD, SSD, USB, Cloud, Primary, Secondary, Byte, Bit, Megabyte, Gigabyte, Terabyte, Petabyte,

ABA 2 2025-02-07

30 Items: Present one itemLearned reinforcerFree access to itemsChosen items replacedTwo-item choice trialTeach last step firstEasy demand then hardTeach first step firstExtra cue for responseStopping reinforcementTeach all steps togetherChosen items not replacedSome behaviors reinforcedBehavior persists over timeBehavior frequency over time...

Pathophysiology Word Search: Chapter 1 2025-09-07

20 Items: What is the academic study of tissue makeup?What is a objective manifestation of disease?What is a subjective manifestation of disease?What is the likelihood of recovering from a disease?What is the explanation of form for cells or tissues?What are characteristics associated with a disease that cause death?...

Road-Profile Word Search 2026-04-08

150 Items: HardnessFormworkEarthworkToughnessAir-voidsBorrow-pitDurabilityElasticityPlasticityEco-designCatch-basinWater-tableLoad-factorWorkabilityTravel-timeSpeed-limitRoad-profileCut-and-fillLiquid-limitSoil-bearingSetting-timeRoad-failureEdge-failureLoss-of-bondDelaminationWarning-signSafety-auditSupply-chainPlastic-limitLoad-transferFlow-capacity...

RANDOM WORDS 2026-05-13

129 Items: CATDOGLOGBOGHOGUSECARSEASUNASLFROGFOODYOURDIMETORIDATASANDFISHSTORESTORYPUPILMONEYTHINKBRAINTIRESWHEELMOTORPENNYABUSEKECIIINPUTMANIASTAFFBEACHOCEANCRABSWINDYUSHERBUTTERSPREADBRIDGEHOLLOWMARKERCRAYONDOLLARPLEASERUBBERENGINEFRIDAYSUNDAYMONDAYNICKELSUPERBKEISHACRISISCENTERCOUNTYSMYRNAOFFICELIGHTSCAMERAACTIONSKILLSMORALEETHICSBREEZYROADWAYHIGHTOP...

Microsoft Excel and Spreadsheets 2025-07-23

2 Items: Spreadsheet, Cell, Row, Column, Formula, Function, =SUM, Autosum, Average, Chart, Table, Data, Graph,Conditional formatting, Sort, Filter, Flash Fill, Pivot Table, Shortcut, Budget, Invoice, Marks, Grade

YLC2 2026-05-16

16 Items: - A period of 100 years- An illness in the body- New and current, not old- Another word for the flu- To have something inside- A hurt feeling in your body- To grow or change over time- A medicine for pain or fever- A very high body temperature- To get better after being sick- A sick person getting medical help- A plant used for cooking or medicine...

Atomic Wordsearch 2025-08-12

11 Items: A noble gas with atomic mass 39.9First element of the periodic tableA vertical column on periodic tableA horizontal row on the periodic tableThe branch of science relative to atomssimplified atomic structure by Niels Bohratomic model proposed by JJ Thomson in 1904Found in our bones, number 20 of periodic table...

Vehicle Traffic Stops 2025-03-04

12 Items: Minor criminal offenseTire deflating devicesSerious criminal offenseCarefully planned actionsAction of chasing down a fleeing vehicleDriving under the influence of drugs or alcoholDocument issued by legal authority to make an arrestOccurs when a traffic law is violated by a vehicle in motion...

Cyber - Technical words 4 2025-06-27

12 Items: An entity that issues digital certificates.A standard for message logging in a network.Sending IP packets with a false source IP address.Dividing a network into segments to improve security.Controlling network access using device MAC addresses.A network protocol for collecting IP traffic information....

Vehicle Traffic Stops 2026-03-05

12 Items: Minor criminal offenseTire deflating devicesSerious criminal offenseCarefully planned actionsAction of chasing down a fleeing vehicleDriving under the influence of drugs or alcoholDocument issued by legal authority to make an arrestOccurs when a traffic law is violated by a vehicle in motion...

TpT Email 2022-07-30

13 Items: judaismbradburystarwarsRelating to the Middle Ages.The "end times" in Norse mythology.The primary religion of people from India.The last of the Ptolemaic leaders in Egypt.Short story from the perspective of Lady Capulet.His assassination sparked the beginning of The Great War.Approximately one-third of the SAT and ACT are based on this....

Stephen Hawkin 2026-05-28

11 Items: Where was Stephen bornWhere did Stephen study physics?Colour of the hole Stephen studied.What did Stephen use to communicate?What did Stephen study at University?What did Stephen enjoy learning about?problems What did Stephen enjoy as a child?Where do astranaults visit, one of Stephens interestsWhat topic did Stephen show a particulaar interest in?...

Wordly Wise UNIT 12 2025-10-12

9 Items: My body is made up of many ____________.The family decided to ____________ a dog.The dress has a striped ______________ on it.The CREO library is _______________ by reading level.The girl's _____________ is bad so she wears glasses.His interest in space was ______________ by the science museum....

Cyber - Technical words 6 2025-06-27

12 Items: Documentation of who handled evidence and when.An observable occurrence relevant to system security.A European regulation on data protection and privacy.Proactively searching for signs of malicious activity.A form of public key encryption based on elliptic curves.Creating an exact copy of a digital device for investigation....

Fundamental Skills and Safety 2024-10-31

2 Items: Gas Biohazard Acute Chronic Safety Label Controlled Products Supplier Label Workplace LabelExperiment Observation Analysis Conclusion Variable Data Control Prediction Results Question Research Symbols Warning Health Hazard

Word Search puzzle grade 6 2024-12-06

20 Items: The light from the sunA place with many treesSomeone who creates artFeeling good and strongA large stream of waterA place with many booksA place for cooking foodAn opening to see outsideA large body of saltwaterSomeone who helps you learnA meal eaten in the eveningA tool for writing or drawingThe study of the natural world...

Spanish 2025-01-29

56 Items: iheweforyouyousheeasywho?theytheylunchclassfirstthirdfifthsixtheigthninthtentha loty'allsecondfourthi needboringi haveEnglishseventhyou allto teachto studyyou needfavoriteyou haveart classdifficultpracticallet's seetechnologycalculatordictionarymathematicsinterestingmore...thanthe class ofthe schedulethe homeworkamusing, funSpanish class...

What club do you want to join? 2026-02-06

20 Items: Art club 美術部Kendo club 剣道部Dance club ダンス部Brass band 吹奏楽部Karate club 空手部Tennis club テニス部Track team 陸上競技部Cooking club 料理部Fishing club 釣り部Soccer team サッカー部Climbing club 登山部Science club 理科・科学部Esports club eスポーツ部Calligraphy club 書道部Outdoor club 野外・自然活動部Volleyball team バレーボール部Board game club ボードゲーム部Go and shogi club囲碁・将棋部Basketball team バスケットボール部...

franciscos wordsearch 2025-05-14

9 Items: v. - to bring back to lifeadj. - extremely clear or brightv.-to endure, exist, or stay aliveadj.- necessary, or essential to lifen. - a food substance that aids healthn. - act of cutting open live animals for scienceadj. - attractively animated; lively (related to a person)...

Vocabulary Lesson 8 2022-11-08

10 Items: The _____ of the word "bright" is "brightest."Building a bridge requires _____ calculations.The word _____ is similar to the term "exonerate."Some conflicts can be _____d by proper communication.After _____ing the data, the scientist concluded a trend.You can use a pesticide to kill plants and an _____to kill plants....

Getting to Know Ms. Considine 2025-07-30

20 Items: Her favorite holidayWhere she went to collegeHow old her oldest son isHer favorite baseball teamWhat Ms. Considine teachesWhen Ms. Considine was bornHow old her youngest son isWhere Ms. Considine was bornHer favorite basketball teamThe math teacher on this teamMs. Considine's favorite colorHow many pets Ms. Considine has...

Business 2025-08-19

18 Items: Activities between businessesRecording all business transactionsUsing data to inform decision-makingMetric used to measure effectivenessRatio of net income against investmentMovement of money in and out of a businessProcess of enhancing products and servicesDebt or expense a business must legally payActivities between businesses and consumers...

Introduction to Physics & Scientific Method 2022-10-29

8 Items: Everything around us is made of _____.An example of a career related to physics.A branch of science that studies the physical world.Patterns or procedures every investigation usually follows.Physics uses ______ to describe observations and predictions.An example of a technology (device) developed with the help of physics....

Science 2026-03-17

1 Item: Jupiter, planets, atmosphere, vinegar, explore, sun, Earth, light, habitat, animals, food chain, nasa, experiment, dinosaurs, extinct, life cycle, rain, clouds,

Amanda 2025-11-06

23 Items: Last nameMiddle nameBirth monthTabby gray kittenFavorite MLB teamFavorite NFL teamYour age currentlyFavorite MiLB teamYour mom and caregiverBlack and White kittenName of your sisters catSister and Physics studentMiddle school you attendedFavorite Disney movie franchiseFriend you play Basketball withFriend you play Poly Hockey with...

Lost 2025-11-13

129 Items: jinsunekovanconrumconjackwaltkaterosealexjohnyemifatetarpraftswanhugogolfboargunsbookfilmjeepwinesayidjameslockeboonerogerpennyjacobaaronlibbycagessharkhorsehatchflamepearlstaffhydrapurgeknifekeamymilesnaomibonesfaithplanecabinwaterheartjulietsawyerclaireeloisehurleyharperpylonsbuttonstatuetempleorchidcoffinhoraceotherspriestmichaelvincentgoodwin...

SCIENCE 2025-06-10

1 Item: STOMACH OESOPHAGUS MOUTH SMALL INTESTINE LIVE PANCREAS LARGE INTESTINE PREDATOR PRODUCER CONSUMER SECONDARY TERTIARY PRIMARY CARBOHYDRATES PROTEIN SUGAR FAT OBESITY HEART DISEASE CARNIVORE HERBIVORE

Science 2026-02-27

1 Item: Photoperiodism Bacteria Virus Multicellular Unicellular Zygote ecosystem consumer producer Asexual Sexual Carbohydrates Protein Fat neurons nephrons traits inheritance gene migration

Mechatronics 2025-07-13

23 Items: A mechanism that turns energy into a controlled motion.A small programmable computer that is able to run code.A procedure used for solving or performing a computation.A description of the ways in which a user interacts with a system or product.Writing in plain English line by line (step by step) what you want the computer program to do....

Science 2026-05-11

1 Item: sun, light, planets, rotation, Earth, continent, time zone, clock, sections, hour, minutes, spin, sunrise, sunset, gravity, shadow, patterns, seasons, orbit

Galen Faculty Word Search 2024-06-28

14 Items: Dean of FAST.The newest dean.Dean of Business.Email him if you can't access Moodle.Very knowledgeable on indigenous rights.Environmental science students know her well.She has a long history and experience in tourism.He's another tourism teacher with vast experience.He's criminal justice students' favorite lecturer....

Spanish Vocab 5 2024-10-30

51 Items: heweforwhosheeasylunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthI needboringI haveenglishseventhto teachto studyyou needfavoriteyou haveart classdifficultpracticalcalculatordictionarythey(fem.)mathematicsinterestingyou(formal)they(masc.)the class ofthe schedulethe homeworkamusing, funspanish classscience classsocial studies...

Science 2026-01-20

1 Item: laboratory experiments research chemicals maths space elements biology chemistry physics solar system inventions medicine

Vocab 2 Word Search 2025-12-15

20 Items: Famous for something badLasting a very short timeSly or cunning intelligenceIncapable of making mistakesLacking in flavor or interestShowing Steady, earnest effortOne who attacks cherished beliefsHaving or showing great knowledgeOpen to one or more interpretationTo persuade by flattery or promisesThe quality of being open or honest...

Miro Birthday Word Search 2026-03-23

150 Items: AMPDNAERGAPIPermMiroCodeRoleFoodDataOpenEMEAAPACTeamDoerGraphCanalMusicBoardRetroModelCloudAsyncFocusTrustAdaptScaleVenueBriefParisTokyoCanvasAustinGrowthEventsStreamAndreyStickyVotingSprintSpacesNeuralServerSystemRemoteHybridGlobalImpactEnergyMeetupSummitDesignBerlinLondonSydneyLeaderPlayerNetworkMindsetDiagramMappingClusterDotvoteRoadmapJourney...

Science investigation 2025-09-10

1 Item: Model, Matter, Mass, Weight, Inertia, Density, Deposition, Sublimation, Freezing, Condensation, Melting, Vaporization, Recombination, Ionization, Plasma, Mixture, Compound, Element, Atom, Molecules, Physical Science, Earth Science, Life Science, Objectivi

iphone 2024-01-27

150 Items: feeacppaykeytextesimcasefreekyopbagscashbyodsignbilliconmsrphomesafecodedatasnapdemoblockplansglassauditmotogtotalratesspeckfortyfiftysixtydebitprintpixelpixarlinesvaluephoneaddonultratoolstaxescallsusagespeedchainiphonesavingcashinswitchveriffmobilegalaxycreditmobileflyersgooglemarvelcanadamexicorefilldividelabelsfamilyincomeroutercashoutvidapay...

One City 2026-06-02

19 Items: Hobbs' "Mom"Moved from TurkiyeCuddly large canineLast name of Ms. DJYoungest teacher in OCPADaughter is in 4th gradeLoves to blow his whistleLoves kayaking and fishingYou can find him in the gymThis teacher has great rhythmCan play instruments and singBrazilian Math and Science TeacherVery likely to say "Howdy Partner"...

Python 2025-03-19

15 Items: A reusable block of code that does a task.A command that displays text on the screen.A code structure that repeats instructions.A rule used in programming to make decisions.A set of instructions written for a computer.A computer program that can talk with people.When something happens without a set pattern....

Parts of a Computer 2024-10-26

17 Items: The hard disk drive.gives the computer powerstores data not being used.also known as the audio card.Also known as volatile memory.port for using USB accessoriescamera attached to the monitor.displays the video, image, and text.often called "the brain" of the computer.cord to connect the computer to ethernet....

Star Trek Species 2025-12-30

147 Items: DataFarnGornMenkVothWadiYangZeonZyloBreenGekliHumanJnaiiMokraNakanOghenPaxanPoneaQomarSelayTrillUtaniUxaliVortaXindiBarzanBolianBoslicBrikarDeltanDrellaGarrenGomtuuHazariJaradaJikaruKaelonKrenimKzintiLothraLurianLutaniMyleanNaceneNapeanNuvianOcampaOrionsPareinPelianRotcivSakariUllianUndineVulcanWompatXaheanXoxianYatthoZaldanZevianAntaranBajoran...

POSTIES 0729 COVER 2024-06-26

6 Items: another word for "smartphone"The Yellow Crane Tower is located in _____.a formal talk that someone gives to a group of peopleIBEL helps disadvantaged ethnic minority students learn ______ after school.a building where you can look at important objects connected with art, history, or science...

École 2023-04-25

2 Items: apprendrescience musique gymnase français histoire bibliothèque amusant élève autobus livre pupitre chaise art enseignant directeur travaille papier crayons règle test écrire gomme à effacer

Careers in languages 2026-01-05

15 Items: Investigates stories globally and interviews people in their native tongue to get the most accurate "scoop."Develops the technology that allows machines to speak clearly and naturally in many different languages and accents....

AMS Word Search 2025-06-24

16 Items: The city of AMSThe mascot of AMSThe state we live inThe school district of AMSThe subject where you use numbersA class where people learn to actA class where people learn to singThe colors of AMS are red and _____?The subject where you do experimentsA place where you can check out booksThere are two of these in a school year...

Elementary School Life 2025-06-28

2 Items: ChatGPTpencil recess teacher library desk eraser lunchbox playground crayons math reading music glue scissors chalk notebook science hallway principal friends swings giggles stickers fieldtrip

Review Unit 1 and Unit 2 2025-10-04

2 Items: gym, reading, science, math, English, art, computers,homework, grade, flowers, rice, fruit, bike, camera, markers, building, bricks, guitar, robot, skateboard, tablet, cool, old, new, borrow

Infographic: Word Search 2025-03-06

12 Items: The smallest unit of information in a database.used in word processing, desktop publishing, or other software that produces text.A visual representation of information or data, such as a chart, diagram, or graphic.In a database file, several related fields (e.g., all the information on one person)....

Experimenting In The Unknown 2025-04-06

11 Items: First antibioticDeveloped the atomic bombItalian physicist discovered atomic fissionScottish scientist that discovered penicillinPolish-born French scientist that worked in radioactivityFreud’s method of studying the unconscious and its effect on behavior.Splitting of the nuclei of atoms in two to create a huge burst of energy...

Vocab blast - translate French and find the English 2024-01-08

38 Items: je fais...........écouter.............j'écoute.............jouer.................faire.................il est................souvent...............parce que..............elle est...............regarder................je regarde..............la lecture..............c'est....................normalement..............j'ai fait du vélo...........

Cyber - Technical words 2 2025-06-27

12 Items: A system that actively blocks detected threats.A tool that captures and analyzes network traffic.Software that detects and removes malicious software.A framework for managing digital keys and certificates.A server that acts as an intermediary for requests from clients.A solution that collects and analyzes security data in real time....

December Final Review Word Search 2025-12-08

15 Items: Stored energy.What a design should do.Opposite magnetic poles do this.Technology exists to solve these.Unit used to measure force/weight.Using science and math to solve problems.Starting materials in a chemical reaction.A type of change where a new substance forms.State of matter with tightly packed particles....

Find Me! 2025-02-23

3 Items: A report that describes what was observed or learned from a real-world visit or research.A report that explains a technical or scientific topic, including data, steps, and results.A report that shows the results of a survey, explaining the answers collected and what they mean.

Subjects 2026-01-19

15 Items: The official language of Mexico, Costa Rica and Spain.The study of past events, particularly in human affairs.An exciting, emotional, or unexpected event or circumstance.The science and study of quality, structure, space, change and numbers.The language of England, widely used in many varieties throughout the world...

Space Exploration People 2025-11-19

24 Items: First woman to travel into space.First American to orbit the Earth.First human to perform a spacewalk.First person to walk on the Moon during Apollo 11.First human to travel into space and orbit the Earth.Flight director who led the successful rescue of Apollo 13.First American woman in space and advocate for science education....

Elalmuerzo Word Search 2024-10-31

56 Items: ihewefunforwhoyousheeasylunchclassfirstthirdfifthsixthninthtentha lotsecondfourtheighthi needboringi haveenglishto talkseventhto teachto studyyou needfavoritelets seeyou haveart classdifficultpracticalmore thantechnologycalculatordictionarymathematicsin the hourinterestingthe class ofthe schedulethe homeworkyou (formal)spanish classscience class...

Spanish Chap. 2A 2026-01-20

56 Items: IheweartforsheeasyWho?lunchclassfirstthirdfifthsixthninthtentha loty'allsecondfourtheighthI needboringI haveSpanishscienceEnglishto talkseventh...classschedulehomeworkto teachto studyyou needfavoriteyou havedifficultpracticalLet's seecalculatordictionarymathematicsamusing/funinterestingmore... thanyou (formal)social studiesin the... hour...

Spanish vocab man 2026-01-27

56 Items: Iheartfunforyoushemathtecheasyhaveyalllunchclassfirstthirdfifthsixthninthtentha lotquiensecondfourtheighthI needboringI havewe allspanishscienceenglishto talkseventhschedulehomeworkTo teachTo studyyou needfavoritelets seelaclasededifficultpracticalmore thancalculatordictionaryyou formalinterestingsocial studiesyou all formalin the ... hour...

Oxford Word Search 2025-01-27

11 Items: His third childHis second childHis first of three childrenThe disease that immobilized himHis Wife which he divorced in 1990Where Hawking was born and was an undergraduateHis first publish that became a popular science book and best-sellerThe topic of his thesis which explains the beginnings of the universe...

All of Third Grade CKLA Words 2022-01-18

157 Items: vowshedcastcelldefyvastawrydataaridhindleadurgetrekapexchaosadaptscaleeagertauntdensemournroguesurlycraftwearyfurrowmodesthuddleinjectexpandflinchhollowbrutalenergyopaquesourcesymboldaintymasterdebrisfrigidtheoryblazedhumbleimmunemethodvoyagedevourintendrevealeffectmightydepriveattractobservestatelysurviveposturecomplexdeclineparchedrivalrydistort...

May 2024 Safety Word Search 2024-05-01

10 Items: PPE stands for Personal Protective (9).Ensure that PPE fits each associate (8).Keep human food items in (10) areas only.Always (4) your hands after handling patients.Remember to keep cuts and scratches covered with a (7).Never attempt to treat open wounds without wearing (6).(8) is a common zoototic disease we see at the hospital....

Most Common Words That Start With D 2025-05-02

163 Items: dodaddaydiedigDNAdogdryduedaredarkdatadatedeaddealdeardebtdeckdeepdeerdenydeskdietdirtdishdoordowndragdrawdropdrugdustdutydailydancedeathdelaydepthdirtydoubtdozendraftdramadreamdressdrinkdrivedamagedangerdealerdebatedecadedecidedeeplydefeatdefenddefinedegreedemanddependdepictdeputyderivedesertdesigndesiredetaildetectdevicedevotedifferdiningdinner...

ACT Aspire - Just the Words 2026-04-08

152 Items: DNAGasCellGenePreyMassAtomWaveDataAxisMeanModeOrganNicheTraitSolidForceSpeedFaultOrbitModelClaimTrendScaleRangeChartTissueMatterVolumeLiquidPlasmaMotionEnergyFossilMedianNucleusFoodWebHabitatDensityElementProductGravityCircuitWeatherClimateErosionIgneousVolcanoAnalyzePatternAverageOutlierDiagramProducerConsumerHeredityMutationPredatorMolecule...

All about the Lab Word Search 2025-04-08

15 Items: AlarmingThe name of our labThe platform we analyze raw data onThe last master mix that is made is_Name of the folder .txt files go into_ process has Molecular Inversion ProbesAn equipment that fluctuates temperaturesCompare these on the tubes and worksheetsThe machine needed to spin down a plate is a _SOP version of the document we use for Analysis...

Unit 1 and 2 2025-11-12

20 Items: Close sessionLook for informationMake a simple drawingApply a special effectDisplaying data on the screenHurt yourself or someone elseOrder food from a mobile devicePut something special to a pictureWhen a lot of water covers the landA big fire that spreads through treesSearch for information on the internetWhen your mouth pushes air/to move air...

Estadistica inferencial 2026-03-14

20 Items: Valor central / The middle valueSelección al azar / Selection by chanceNivel de seguridad / Level of certaintyMedida de dispersión / Measure of spreadValor de la población / Population valuePromedio aritmético / The arithmetic averageFunción de valores / Function showing valuesMétodo de recolección / Method of collection...

CNA Review 2023-08-31

30 Items: to widenfaintingto urinateChest painheart muscledeath of tissuelow blood sugarhappens suddenlycapable of walkinga patient advocatethe act of vomitingdifficulty swallowingcentral nervous systemthe absence of breathingproduced by the pancreasperipheral nervous systemtemperature taken at the earsystolic bp greater then 130...

Math Vocabulary Crossword 2025-11-21

16 Items: means out of 100the top half of a fractionEx: 4, 8, 12, 16, 20, 24...the bottom half of a fractionthe answer to an addition problemthe answer to a subtraction problemthe best 5th grade math teacher everthe best 5th grade reading teacher everthe best 5th grade student teacher everthe best 5th grade science teacher ever...