current events Word Searches

Science Olympiad Word Search 2026-02-20

100 Items: LawDNAAtomMassCellDataLensWaveAcidBaseForceOrbitModelGraphPrismSoundLightVirusVolumeEnergyMotionFossilGalaxyTheoryCarbonOxygenHeliumProtonEnzymeElementMixtureDensityGravityCircuitCurrentVoltageHabitatNucleusErosionVolcanoClimateControlNeutronIsotopeNeutralMoleculeCompoundSolutionFrictionVelocityOrganismMembraneSedimentRotationVariableSpectrum...

100 Earth Science Terms 2026-04-27

96 Items: axiscorehailheatlakelavarainsoiltidewindcloudcrustdeltafaultfloodfrontmagmaoceanozoneriverauroradesertenergyfossilgeyserislandmantlereliefstreamvalleybedrockclimatecurrentdensitydroughteclipseerosiongeologyglaciergravityhabitatmineralmonsoontsunamivolcanoweatheraltitudehumiditylandformlatitudemountainpressuresedimentsolsticebiosphereelevation...

Night of the Ninjas Chapter 8 2023-06-05

10 Items: What can't they see?What knocked Jack over?What is the mouse's name?What is the sister's name?What water did they go to?What is the brother's name?What do they have to follow?What did Jack try to be like?Who were on both sides of them?What was the mouse using to cross the water?

SWEtacular Word Search 2025-09-12

5 Items: Hosts an annual STEM conference for high school girls.Maintains and improves SWE’s website, dashboard, and digital tools.Organizes events like shadowing, resume reviews, and mock interviews.Plans SWE’s networking dinner connecting students with company representatives.Coordinates the Big/Little program, SWE Connect, and bringing members together.

National 4 Physics Wordsearch 2025-04-01

20 Items: The rate of change of velocity?The number of waves per second?The emission on alpha, beta or gamma?Another term for Potential Difference?The rate of flow of charge in a circuit?The name given to the Sun and the planets?Component used to measure the temperature?The only particle in an atom that can move?Quantity that is often simplified to speed?...

Amazon founded 2026-05-08

21 Items: AndyCurrent CEOThe year it was foundedBezos- The founder of AmazonWashington- Where Amazon was foundedElectronic reader developed by AmazonThe original workspace for the companymillion- current monthly Amazon app usersCloud based AI assistant created my AmazonAmazon developed the Kindle, Echo, and AlexaA smart speaker that was developed by Amazon...

#NotCom Word Search 2015-08-24

112 Items: .DOG.RUN.BIKE.CAFE.CAMP.CARE.CITY.COOL.FARM.FISH.FUND.GOLD.GOLF.GURU.LAND.LIFE.PLUS.TEAM.TIPS.TOYS.ZONE.COACH.GIFTS.GLASS.GUIDE.HOUSE.LEASE.LEGAL.MEDIA.MONEY.PARTS.PIZZA.PLACE.SHOES.SOLAR.STYLE.TIRES.TODAY.TOOLS.WATCH.WORKS.WORLD.AGENCY.CAMERA.CENTER.CLAIMS.CLINIC.COFFEE.DENTAL.ENERGY.EVENTS.EXPERT.HOCKEY.PHOTOS.REPAIR.SCHOOL.SUPPLY.TENNIS.VISION...

18 2025-08-16

15 Items: Controls speed.Round brake component.Old way to start engine.Gauge displaying engine RPMRear light signaling brakingEngages and disengages power.Keeps bike upright when parked.Blinking light indicating a turnInstrument showing current speedFront light used for night ridingProtective sticker on the fuel tankThe motorcycle’s main fuel container...

-Chron, Decim, Dec words 2026-05-25

14 Items: a period of ten consecutive yearsa number that is not a whole numbermetric unit of length equal to one-tenth of a meterclosed geometric shape with ten straight sides and ten anglesdestroy, severely damage, or kill a large proportion of somethingconstantly, habitually, or over a long and persistent period of time...

Izaac's Word Search 2026-05-12

21 Items: A comedianA Mother's boy_____ BearcatsIzaac's field eventThe day he was bornRolling on 4 wheelsFindlay First EditionA spicy red condimentThe month he was bornWhere he graduated fromHis loud rhythmic hobbyWhat he did on May 23rdHis late night past timeHis next chapter in lifeMove and groove to the beatA sport divided into events...

the ocean 2025-02-06

100 Items: SeaBayReefWaveTideSandClamTunaCrabRaysKelpSealGulfDockPierBoatShipOceanCoralBeachShoreShellSquidWhaleSharkSquidAlgaeStormCanoeYachtScubaDiverMusselSalmonShrimpDugongWalrusTurtleLagoonHarborStraitIslandVesselCruiseCurrentOctopusScallopDolphinLobsterSeaweedManateePenguinSeaLionTsunamiCycloneTyphoonEstuaryChannelSnorkelAquaticSeafoamSandbarStarfish...

100 Word Science Monster 2026-03-26

98 Items: atommassrockcelldatamodelcycleforcespeedorganorbitinfermatterenergyvolumesystemmotionmagnetfossiltissueoxygencarbonrunoffplanetgalaxydensityelementmixturegravityinertiacurrentcircuitvoltagethermalweatherclimateerosionmineralcrystalspecieshabitatsurvivefoodwebeclipsecontrolobservepredictanalyzecompoundsolutionparticlemoleculefrictionpressuremagnetic...

100 Word Science Monster 2026-03-26

98 Items: atommassrockcelldatamodelcycleforcespeedorganorbitinfermatterenergyvolumesystemmotionmagnetfossiltissueoxygencarbonrunoffplanetgalaxydensityelementmixturegravityinertiacurrentcircuitvoltagethermalweatherclimateerosionmineralcrystalspecieshabitatsurvivefoodwebrevolveeclipsecontrolobservepredictanalyzecompoundsolutionparticlemoleculefrictionpressure...

8th grade vocab 2026-04-29

100 Items: AtomMassWorkCellGeneDataOrbitForceSpeedLeverPowerOrganTraitModelCycleFossilVolumeEnergyMotionPulleyTissueTheorySystemErosionIgneousGravityEclipseElementMixtureDensityGravityInertiaCircuitCurrentVoltageHabitatFoodWebControlPredictAnalyzeSedimentRotationMoleculeCompoundVelocityFrictionProducerConsumerHeredityVariableFunctionEvidenceBiosphereGeosphere...

Technician Class License Study 2024-11-19

24 Items: Radio signal measurementPower output measurementElectrical pressure unitComplete electrical pathNoise reduction mechanismTwo-way communication modeSignal transmission methodCommunication signal rangeSignal frequency generatorFrequency measurement unitSignal transmission boosterSignal strength measurementSignal information encoding...

your sanity 2026-03-03

100 Items: ifrubtipjamdruglandsolobaldkillsafelampraidslowtermbootstepskipcallmazepoemburstgraceidealshocklimitratiocleanheavytermsspellproudfeastshinedraftlightshowersellersleeveprayeradvicesermonmurderrocketrejectrotatepoetryignoremarginpleasenaturechancepocketstrolltemplemiserydignitycurrentfantasyvolcanoglassesfeelingoutlinedivorceexpressmusicalprinter...

Spring fling 2026-03-17

99 Items: EGGNESTLAMBTHAWKITEBLOOMROBINTULIPMUDDYBUNNYCHICKCROSSSEDERMATZOCOMALFLOATTEXANAGGIEMULCHPORCHPUDDLEBREEZEPOLLENPASTELEASTERBASKETBONNETEXODUSTASSELTUBINGRAPIDSCOOLERGRUENERAIDERBOBCATFIESTAWARMTHSPROUTGARDENTROWELFEEDERCOCOONPICNICBLOSSOMALLERGYDIPLOMACURRENTSANDBARUNICORNMUSTANGBEARCATEQUINOXSAPLINGCOMPOSTMONARCHTADPOLERENEWALREBIRTHFRISBEE...

Civics Test Review 2026-05-13

15 Items: — rejection of a bill— first ten amendments— advisors to the President— highest court in the U.S.— legal member of a country— change to the Constitution— the supreme law of the land-- Last name of 1st President— government where people vote— money paid to the government— leader of the executive branch— war between the North and South...

Unit 3: Spelling Quiz 2 2022-11-08

25 Items: to fill with lifeto exert the musclesto hypnotize; to enthrallto treat as less than humanto describe the qualities ofto catalog as separate itemsto fill with energy; invigorateto decompose by electric currentto place something under pressureto make helpless or unable to moveto put to use for a certain purposeto become completely aware of something...

HOMOPHONES 2014-12-14

97 Items: besoarkbuyduedyeewefluforlednewwonseesumtoewaraideislebearbeatburyblewbuoyseedsellcordfarefeethairheelliarmademaleneedpailpeekpourpreywrapringrollroseseemsoresoultalewailwaitwornaloudaltareightbirthbreakbreadbuildsensesightqueuedoughflourgrownwholepeaceplanereignwritesteeltheretongswastewitchborderbrowsechoosecorpsecourseelicitgreaselessonceiling...

Goal 14: Life Below Water (100 Words) 2025-11-17

100 Items: PaySeaCareDeepDiveFishFoodHelpHopeLifeLookMeetPlanSafeSaveSwimWaveCleanCoastColorCoralEarthFreshOceanShareShineWhaleWaterAccessChangeCreateMarineNatureStrongCarbonReduceThriveReformGlobalEngageFutureGrowthEthicsAnimalsAquaticCurrentProtectSupportSpeciesMonitorHabitatPreventHealthyEnhanceConnectRespectSupportActionsHarvestEconomyDeclineConserve...

Goal 7: Affordable and Clean Energy (100 Words) 2025-11-17

100 Items: AidAirGasPaySunUseCostHeatHelpHomeIdeaNeedSafeTeamWindWorkMoveRiseFlowRateCityCleanGreenHydroLightOfferPowerSolarTrashWasteTrustShareSolveCycleGoalsFullyAccessEnergyNatureSourceSwitchInformDesignImpactEvolveSafetyPolicyBatteryBiomassInstallNuclearThermalBatterySupportConnectEducateImproveAdvanceDevelopPurposeCurrentExploreProtectBelieveJourney...

Aquatic Science: Year in Review 2026-05-11

100 Items: GillPreyAlgaeAtollBiomeCoralDeltaLarvaMarshTidesElninoEnergyLagoonNektonRunoffAbioticAquaticAquiferBenthosClimateCurrentDensityDroughtErosionEstuaryFisheryFoodwebGlacierHabitatMolluskOsmosisRecycleSpeciesWetlandBacteriaBrackishConsumerLatitudeLittoralMangroveMutationOrganismParasitePredatorProducerSalinitySedimentSpawningCarnivoreEcosystemEvolution...

Freedom Word Search 2026-02-06

10 Items: - a happy feeling about the future- to understand new ideas and facts- being kind and sharing with others- being able to live and make choices- a march with people, music, and smiles- people who love and care for each other- people who live, work, and help together- to have a happy day for something special...

North Korea 2026-05-14

5 Items: Who is the current leader?Language that North Koreans speak?What can North Koreans not go on on their phones?What can women not do in North Korea for transportation?Economic penalties imposed on a country to change their behavior?

SERIAL VOCAB 2025-11-12

16 Items: Clear and makes sense.Wanting to get revenge.Lasting for a long time.To break someone’s trust.To record events in order.Impossible to prove wrong.Full of problems or stress.A strong feeling of worry or fear.To make up or lie about something.To show that something isn’t true.When something gets dirty or unsafe.A person or thing that causes danger....

Chettinadu Puzzle 2026-01-03

16 Items: Simple onion gravy side dishFinely woven palm-leaf basketStainless steel coconut slicerOrnate and proud doorway designTiny silver rattle for childrenCrispy and soft white snack itemAuthentic crunchy rice flour snackHand-box used to keep money safelyCentral open courtyard of the homeUnique address for a sister-in-law...

SWEtacular Word Search_1 2025-09-12

5 Items: Hosts an annual STEM conference for high school girls.Maintains and improves SWE’s website, dashboard, and digital tools.Organizes events like shadowing, resume reviews, and mock interviews.Plans SWE’s networking dinner connecting students with company representatives.Coordinates the Big/Little program, SWE Connect, and bringing members together.

Beyond Agents 2024-11-07

20 Items: LegalDelinquencyStipulationRemove DebtsAdding DebtsFunds requiredBetter Life PlansName of a CreditorName of a CreditorPayments in ProgressSystem to take chatsRequired DelinquencyAbove Graduation LoanResolution In ApprovalAuthorization to communicateCrossroads Financial TechnologiesResource to use to open client's programs...

Macroeconomics Wordsearch 2024-04-24

14 Items: total amount gainedassets of a businessCreator of Capitalismthe amount of a productthe makers of a productthe buyers of a productwant of a certain productfounder of a new businessa greater demand than supplyamount gained after all expensesthe current price a product is sold atwhen a business fights another for customers...

Vocabulary - Kids Box 6 | Page 78 2024-10-05

11 Items: They spoke Latin.An ancient language from Rome.A way to show events in order.The Normans spoke this language.A tribe whose name starts with "J."To enter and take control of a country.The name 'England' comes from this group.People from France who invaded England in 1066.Areas of land with their own names and leaders....

Remember Word Search 2025-12-30

10 Items: – a symbol of hope and remembrance.– being caring and gentle to others.– to gain knowledge so we can do better.– to look after others and show concern.– a time when people live without fighting.– showing care for people and their feelings.– to think about people and events from the past.– believing good things can happen in the future....

Greek Roots Week 3 2025-09-09

10 Items: join togetherextremely activeof the same kind; alikegather into a crowd or massdiverse in character or contentan organism that cannot produce its own fooda group organized for purposes other than generating profitexaggerated statements or claims not meant to be taken literally...

Elements Word Search 2024-01-17

19 Items: one cycle per minuteouter ring of electronssmallest units of an elementthe steps necessary in a processpositively charged elementary particleselementary particles with no electrical chargethe flow of electrons from atom to atom in a conductorthe movement of electrons being directed through materials...

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

Energy Science Efficiency & Systems 2026-03-31

15 Items: What element is the primary component of coal and oil?Which Law of Thermodynamics states that energy is conserved?What is the unit of energy often used to measure heat in food?What is the unit used to measure the flow of electric current?What is the ratio of useful energy output to total energy input?...

The World on the Turtle's Back 2025-08-27

9 Items: Truffles are considered a ________ .The new deck of cards wasn't very ________.The woman __________ searched for her missing dog.___________ the literary devices used in this poem.___________ the author's meaning in this paragraph.The knights swore to __________ the enemies of the king.Authors often employ ____________, to hint at future events....

4과 단어 2022-07-07

3 Items: board steponto become calm events visible weightnecessarily particular culture lasting effect impression swelltraditional trip national impressive huge princess appear destiny geton servant setoff wave pourdown calmdown faraway soon shore

Shakespeare - Impact on Language 2025-08-01

15 Items: "Blue."Iambic pentameter.A group of singers.English playwriter and poet.Main events that in a story.Conversations between characters.An indirect reference to a person.A long speech given by a character.A joke exploiting different meanings.Brief instructions followed by actors.Things that happen in a play or story....

Compound Words Unit 10 2026-04-14

10 Items: Pain in the abdomen.A chair fitted with wheels.Feeling a great sense of wonder.For all future time; for always.A broadcast of current news reports.In a foreign country across the ocean.Satisfactory, acceptable, or in good health.Noisy excitement, confusion, or public outrage.An expression used at the end of a conversation....

29 2025-08-17

15 Items: Illegal tradingOrganized drug group.Addictive opioid drug.Crystal methamphetamine.Another name for Marijuana.Anthem or theme sung by a motorcycle clubA ride exclusively for female club membersSweet treat often shared at biker gatheringsA celebratory cheer shared among club membersA group motorcycle journey organized by the club...

English Discovery Words 2025-09-22

15 Items: an animal who barksthe king of the junglea white drink from a cowsomething you use to drinkto move your body in watera place where the doctor worksa place in school with many booksa big room for meetings or eventsa long yellow fruit that is sweetsomething you use to sweep the floora place where children playing around...

Non-Fiction Text Structures 2025-01-28

5 Items: / Topic word,explanations,and fact of a topicand Contrast / Same and different between two topicsand Solution / Something that's wrong and how to solve it& Effect / Reason something happens and,or the result of somethingChronological / Events told in the order they later(F,S,T,etc order), one after the other

Posties 1016 Kongcept 2023-09-26

6 Items: Kowloneon is a _____ light workshopthe art or practice of designing buildingsdescribes something different to everything elsea record of past events of a particular period or placethe habits, traditions, and beliefs of a country, society, or group of peoplean event at which a group of people meet to learn more about something by discussing it

7.11 Spelling Words 2025-04-15

10 Items: An animal that eats only meat.To make someone lose hope or confidence.Unable or unwilling to believe something.The right to vote in political elections.The state of being unsure or not knowing.Living by killing and eating other animals.To be too much to handle; to crush or overpower.Made or done without method or conscious choice....

Lesson 24 2026-02-09

10 Items: to manage to avoid or evade,the location of any action or event.a complete, often detailed list of thingsestablished by custom or usage; traditional.income obtained from investment or property.an undertaking or enterprise that involves risk orsuitable and easily turned to one's needs, purposesnot marked by interesting or unusual events; routine....

Lender Placed 2023-10-25

12 Items: Who is the insured on an LP Policy?LP insurance covers protection for what?The Level numbers help us identify the ______ on the loanIf the coverage for LP shows WO that means it's for what risk?What's the acronym of the agency that regulates LP requirements?The status of the LP when there's no current preferred coverage on file...

ELD-2 Unit 1 2025-09-12

17 Items: writingaction wordsthe events of a storythe problem in a storythe words a, an and thea person, place or thingwords that describe nounsa type or class or writingthe time and place of a storythe people or animals in a storythe lesson or main idea of a storywords that show emotion like "Wow!"a type of story about a person's life...

National Word Search 2026-03-30

4 Items: GDP measured using current pricesGoods Products used to make other productsThe total value of all goods and services made in a countryIncome Accounting A system that tracks a country’s total economic activity

Pencils, Papers and Puzzles 2025-06-12

12 Items: Assignments done after schoolThe person who leads the classThe class you use a calculator inA place full of books and researchOne of the school's primary colorsThe school's top-level sports teamThe mascot of Wayne Hills High SchoolTime off from school where you can relaxThe ceremony marking the completion of HS...

Literary Terms 3 2025-12-07

25 Items: Brief overview.Hinting future events.Using humor to criticize.Systematic investigation.Asking questions to learn.irony Unexpected outcome.Speed and rhythm of a text.Combining multiple sources.Distinctive way of writing.Scene set in an earlier time.Restating in different words.Line continuing without pause.Revising text for correctness....

Mysteries and Investigations 2022-10-19

24 Items: lowlyaboutsectionsomewhatrecordedpanickedcompletepresent daylooking afterpeople in chargelet out blood fromarea under controlhung in one positionstayed close togetherin direct contact withperson serving militaryone-celled living thingstowns without people leftspoke without making sensesubstance that kills germswidespread attack of a disease...

Malaysia vocab 2026-04-21

10 Items: – The power to affect something.– The original people of a place.– The design and style of buildings.– Related to formal events or rituals.– A main or basic food eaten regularly.– A wide variety of plants and animals in an area.– A skilled craftsperson who makes things by hand.– When one culture blends into or adopts parts of another....

Physics Challenge 104 words 2025-07-14

104 Items: ohmlawsungastimeAtomBetaloopheatmarsstardustraysForcespeedForceWavesHertzAlphaGammavoltsgraphspaceearthvenusplutopolesNewtonProtonGMtubeampereseriesEnergyjouleschargesaturnuranusnebulacometsgalaxyGravityDensityNeutronIsotopecurrentvoltagecircuitkineticnuclearelasticaveragecoulombdisgrammercuryjupiterneptunemagnetsVelocityMomentumdistanceFriction...

Sorry Word Search 2026-02-05

10 Items: - being kind and gentle to others- treating people nicely and fairly- to understand new ideas and lessons- people who care for and love each other- the ground and places where people live- to pay attention when someone is speaking- stories about people and events from the past- being kind and helping one another as a group...

Latin and Greek Word Roots 2025-04-14

10 Items: Soph : Wisdom, knowledge, and insight.Anthrop : Human, relating to humans or mankind.Phil : Love, affection, or fondness for something.Bibli : Book, pertaining to books or written works.Chron : Time, relating to time or chronological events.Metri : Measure, relating to measurement or dimensions....

Flag Word Search 2026-02-02

10 Items: - words used to show appreciation- a place where a person is buried- to show respect and say thank you- a march with people, music, and flags- being strong and not afraid to help others- a person who serves and protects the country- a time with no fighting and people feel safe- to think about people and events from the past...

Eight Months 2025-06-26

26 Items: catreaddrinkdiscordboardgameice creamcurrent dayyou make me?overachieverour call timefast hedgehogyou live in..the one i loveHappy birthdayi see that townwhere you going?explosive expertyou do that oftenyou say that oftenhope you get it todayfrom that friend bookin my restless dreamsyour favorite activitythey give us items to do...

Ellie is 30! Sip & Solve 2026-04-08

30 Items: NicknameStar SignShoe SizeMiddle NameWorst HabitBiggest FearFirst ConcertGo-to PerfumeFavourite SongFavourite FilmFavourite DrinkMost Used EmojiFavourite ColourFavourite AnimalFavourite SeasonFavourite DessertCurrent Dream JobFavourite TV ShowFavourite TakeawayGo-to Karaoke SongChildhood Dream JobBest School SubjectFavourite Girl Dinner...

301a Magnetic Particle Inspection 2023-12-07

22 Items: Portable electromagnetic __________Ability of a material to RETAIN magnetismNumber of flux lines per cross-sectional areaPass electricity directly through a ferrous partImaginary lines used to visualize magnetic fieldsForce required to reduce flux density to near zeroEvery part subjected to magnetism must be ___________...

ELIZABETH AND JACE 2025-05-31

40 Items: Jace's hometownJace's first carWhere Jace proposedMonth Jace proposedElizabeth's hometownMonth of the weddingHoneymoon destinationJace's degree programJace's favorite colorElizabeth's favorite foodJace's favorite accessoryElizabeth's favorite bandElizabeth's favorite colorElizabeth's favorite craftThe best box brownie brand...

Iya, the Camp-eater 2025-08-27

10 Items: "Wazzup?" is an example of __________.The house was built ________ the ocean.The Air BnB the family stayed in was a _________.The camel carried his _________ across the desert.The doctor will ________ what disease the patient has.Authors often use ___________ to hint of future events._________ the types of literary devices used in this poem....

electrical circuits 2025-04-21

11 Items: measures resistanceelectricity flows one way onlymix of parallel and series circuitsmeasures how much energy is flowingmeasures how much energy is being useda particle that carries electric chargewhat circuit is it when the switch is onwhat circuit is it when the switch is offthe circuit is connected with single loop...

Senior spelling list 2 2025-12-11

8 Items: A rodent with a fluffy tailTo adapt to someone's needsA person who works in an officeAn adverb with a clear and determined mannerHaving a mark left by a healed wound, sore or burnAn object or weapon for throwing, hurting or shooting at a targetknowledge gained from doing/feeling things or specific events that happen...

JCAHO Readiness- General Info 2026-03-24

14 Items: Code blackCode red procedureSevere weather threatWho is Kathy Wareham?Hostage or active aggressorWhat does a code yellow mean?Esclatation of concerns first stepNo food or drink at the __________.Reporting system for colleague injuryProcess for using a fire extinguisherYou must wear your badge above your __________....

Journalism Vocabulary Words 2024-09-25

15 Items: believabletrustworthythe most up to dateone's personal opinionPersuade Inform Entertaininformation that isn't truewhy the author wrote the text itselfsources that aren't direct or originalthe goal or purpose of an organizationthe website domain ending of a companysources directly from the original sourcethe website domain ending of an organization...

Newtons laws and forces 2026-05-12

15 Items: mass1st lawanother word for fasthow high the sound ispulls you towards earthnegative charge in an atomtwo things rubbing on anotherwhat a magnet used to attractthe amount of matter in an objectamount of electricity in somethinga south end is_____ to a north enda south end is_____ to a south endhow fast the object changes position...

Word Search ELA 1/7/25 2025-01-08

15 Items: to keep saferefuge, sanctuarycareful, meticuloushaving little to no rain; drykind, generous, compassionateto complete or to end somethinga close friendship; companionshipa time when a country isn't at warsetting someone or something separately from otherscombine something with another so they become a whole...

27 2025-08-17

15 Items: Lesser crime.Taken into custody.Short-term detentionFound guilty in court.Long-term jail facility.Punishment ordered by court.Organized set of riders traveling togetherEmblem showing affiliation with a motorcycle clubMetal container for fuel or oil carried on long ridesMeeting place for a specific branch of a motorcycle club...

Word Search 2026-03-03

7 Items: Extremely great in amount, scale, or intensityEasily perceived or understood; clear, self-evidentPertaining to the preparation, use, or sale of medicinal drugsCapable of persuading others of the truth or validity of somethingIn the end, especially after a long delay, process, or series of events...

23 2025-08-17

15 Items: Rules bikers live by.Serious loyalty pledge.Ink showing club loyalty.Process of proving loyalty.Common outlaw biker symbol.Seasonal ride to welcome warmer weatherTribute ride held to honor a fallen riderYearly organized motorcycle ride or eventGroup ride organized to raise funds for a causeHigh-speed motorcycle competition on a paved track...

Science Word Search - Trisha 9B 2024-06-11

15 Items: NADNcioiAbtathiTsiceengOlvatencTulaiopopnDaptiaotnaRosommeochused to measure voltageused to measure currentare the basic particles of the chemical elementsis the process by which a liquid turns into a gasthe energy that moves from one place to another in a form that can be described as waves or particles...

Wolves Word Search 2025-06-11

9 Items: A large vehicle that pumps water.Our district's mascot animal, plural.Someone who instructs children every day at school.The newest member of the woof pack serving at Central.A grocer in the area providing snacks at Protect the Pack.The full name of the Superintendent of Okemos Public Schools....

Week 5 Spelling Words 2024-02-08

15 Items: The EarthPresent time.The number after 12.When you want water.When you take a class.A beginning for a book.When you fix something.The engine that google has.When you are going far than usual.When you get rid of your sickness.To get ready for something important.When you’re doing something important.When you capture songs and you store it....

holocene 2025-06-09

10 Items: current geological agethe destruction of habitatthe variety of life on earthlong-term changes in temperatureage of humanity becoming a major forcethe natural rate at which species go extinctthe surge in human population in the 20th centurya time when most species go extinct in a short timeplants/animals in non-native environments which they harm...

Our story 2026-02-02

10 Items: Our favorite activityMy first gift from youOur first trip overseasThe month we made it officialThe day I knew that I loved youThe bar we had our first date atThe place we met for the first timeThe trip we when on after breaking upThe name of the boy that I love so deeplyOur current favorite song to jam to in the car

Ethans Spelling Word Search 2023-04-05

35 Items: lukejohnmusclesprintfitnesswarm-upstadiumworkoutathletehandballmuscularolympicsexerciseequipmenttreadmillgymnasiumstopwatchgymnasticsracquetballperspirationcoordinationcalisthenicscross-countryweighttrainingstationarybikea long race or contesthaving to do with the heart and blood vesselsthe power to stand something without giving out...

sopa de letras : nuestra vida social 2026-04-30

20 Items: Mardi grasTarget,MacysYo form of IRTu form of IrNosotros form of IRVosotros form of IRA place to buy devicesMovies on the big screenEl,Ella,Usted form of IRA place you go for a treatA place to shop with friendsA place to buy needs and wantsA place to listen to music liveA place you go to see artifactsA place to buy things to walk in...

Rebecca & Sam Tye the Knot! 2025-05-18

14 Items: Current locationSam is becoming aBecky is becoming aBeckys new last nameNicki is now beckys ...City where the wedding isThe Bride and Grooms Pet DogThe Bride and Grooms Police DogFemale hair accessory worn by a brideWhat the bride wears on her wedding dayThe reason the couple are getting marriedLegal paper document showing proof of a marriage...

WHAT IS THIS? 2025-07-10

12 Items: The first child in a familyA building used for worshipA prize given for achievementThe time a king or queen rulesA man who fights for a king or queenA place where a dead person is buriedA long, sharp weapon used for fightingA statement that you will do somethingTo put something/someone under the ground...

electricity 2026-03-10

12 Items: the units of currentto measure the voltageallows electricity to passthis wire completes the circuita type of circuit with many loopsdoes not allow electricity to passa type of circuit with only one loopthis wire allows electricity to passthis wire is striped yellow and greenthis is a device with a thin filament wire...

UIE Newsletter Word Search 2024-12-17

6 Items: Test used to determine direction of current flowResistance in transformer windings causes _____ lossesRenewable energy source derived from heat within earthA type of load that if it fails can cause harm to peopleThe _____ factor needs to be considered during cable sizingMaintenance that occurs after 12000 working hours of a gas turbine

ESOP Month 2025-10-01

11 Items: Price The value of the share.Rules established to receive shares.Market Value Value of our stock at open market.Owner Employee with financial stake in company.Process by which you earn rights to your shares.Valuation Company's appraisal done by third party.Pool The "Bucket' of available distribution shares....

Fire Extinguishers 2022-11-01

14 Items: Not the fire trianglePrevents accidental dischargeContains the firefighting agentDelivers the firefighting agentClass A fires generally produce thisThis class extinguishes kitchen firesThe number of fire extinguisher classesUsed for combustibles like wood and paperUsed on flammable liquids, greases, and gases...

BJ 2024-04-11

20 Items: A lover of books.Calm and peaceful.Calm and unemotional.Walking in one's sleep.Done without preparation.A playful or fanciful mood.Keeping watch with alertness.Lasting for a very short time.A sentimental longing for the past.Impossible to understand or interpret.(Of a person) determined and persistent.Happening by chance in a beneficial way....

∞ Official Big Mountain Word Search ∞ 2025-06-01

25 Items: How you made it back homeThe ___ Deconstruction plantThe X-2 Transmitter ___ ArrayA scientist aware of his flawsMobius' home; Forbidden to you!The honorifics of the Think TankThe leader and head voice of the DomeThe programmed fate of the Think TankA loyal companion, through and throughThe third piece removed from your body...

Electricity & Magnetism 2023-06-20

8 Items: metallic threadparticle with a negative chargetype of electricity that requires a wirethe transfer of electrons from one atom to anotherwhen two or more things are not in equal proportionsmagnet made from electricity and a metallic materialtype of electricity produced when you rub a balloon on your head...

unit 10 2024-05-01

17 Items: breaks up meteorsaborbs UV radiationcontains ozone shielddebated by scientistsall weather events occur herephases of warm and cool climatethickest layer of the atmospheresurfaces that reflect insolationlong term pattern of temperatureinclude water vapor, methane,CFCs, etc.short term temperature and precipitation...

EXERCISE 130326 2026-03-13

30 Items: Differences that weaken an analogy argumentAn error in reasoning that weakens an argumentUsing someone else's work without proper creditKey factors that strengthen arguments by analogyThe main argument or claim presented in an essayEvaluating the author's expertise or credentialsRestating an author’s ideas using your own words...

steal a brainrot events 2026-03-13

2 Items: Glitch-SecretPlaceLuck-ChangesBrainrots

Genres 2026-01-12

12 Items: A love storyStories written for young adultsFiction about investigating crimesImagined futures with new technologiesA children's story, usually involving magicThe story of someone's life, written by themFiction that makes you feel shock, fear, or dreadThe story of someone's life, written by someone else...

Greek Roots Week 3 2025-09-09

10 Items: not absolutely necessarybring (something) to an endextremely or unusually activediverse in character or contentconsisting of parts all of the same kindhaving the same relation, relative position, or structurehaving extreme physical sensitivity to particular stimulibring together or into contact so that a real or notional link is established...

Cat Word Search 2025-12-31

10 Items: - to look at words and enjoy a story.- to move, imagine, and have a good time.- something that makes you laugh and smile.- a happy face made when something is funny.- a funny name for a character who likes to play.- words that tell about fun characters and events.- a small animal that swims and gives advice in books....

Section IV & V -- The Alchemist Vocabulary 2026-04-20

10 Items: A person who practices alchemy.Embarrassed, disconcerted, or ashamed.A sheath for the blade of a sword or daggerScrape or wear away by friction or erosion.a passionate expression of grief or sorrow.Ask (someone) urgently and fervently to do somethingThe action of foretelling or prophesying future events....

Patient Safety 2026-04-28

8 Items: To express or convey informationDemonstrating competence, respectful and ethical behaviorCovered accesses is one of the organization’s _____ eventsReduce patient anxiety by providing comfort and building confidenceProvide information so patients understand what’s happening and what to expect...

University 2024-07-18

15 Items: - Academic field of study pursued by students.- Academic credential awarded upon completion.- Focus area within the broader field of study.- Courses and requirements specific to the major.- Practical work experience related to the major.- Investigation and exploration within the discipline.- Professors and instructors specializing in the field....

Electrical Circuits 2025-04-21

15 Items: unit of powera part of an elementthe opposition to flowone path in a circuitbomultiple paths in a circuitbase unit of an electrical unitboth series and parallel circuitsomething that can deliver energyallows electrical current to flowa circuit with a break in the pathhow hard it is for electricity to flowthe flow of electricity in one direction...

Science Word Search 2025-10-16

15 Items: educated guesshole hhghfhrghrfnfto test a hypothesisthe energy sound carriesenergy stored in nuclear atomsenergy that's in a electric currentobject in motion will stay in motionenergy due to motion and interactionanother name for the first newton lawstored energy of an object or materialenergy carried by electromagnetic waves...

City 2026-01-28

138 Items: zoosblockmetrobakerybrunchcameracoffeecondoscrowdseventsstairsavenuesbalconybaristabenchesbicyclebuskerscommutefashionfriendsmarketsmeetupsmuseumsoutfitspigeonsposterspocketsrunningstreetssubwayssunsetstakeouttheatreticketstraffictransitwritersbackpackbusstopscalendardeliveryhallwaysmorningspastriespodcastsroutinesterracesweekdaysweekendsworkbags...