communication Word Searches

Vocabulary Words 2025-11-21

9 Items: A digital audio program you can listen to online or through an appSpecific, teachable abilities that can be measured and demonstratedConduct, behavior, and attitude that meets the expectations of a workplaceA natural talent or ability that makes someone suited for certain tasks or careers...

NHOB 005 2025-01-28

10 Items: USED TO LOAD LARGE ITEMS ONTO THE CARTHE EXHAUST PIPE IS ADDED TO THE CAR ON THIS LINETHE ACCESS POINT TO THE REAR CARGO AREA ON THE CRVTHESE ALLOW PASSANGERS TO GET IN AND OUT OF THE CARA METAL RING USED TO DISTRIBUTE PRESSURE OVER A LARGER AREATHIS IS ONE OF THE METHODS WE USE TO ENSURE A COUPLER IS FULLY SET...

NHOB 005 2025-01-28

10 Items: USED TO LOAD LARGE ITEMS ONTO THE CAR.THE ACCESS POINT TO THE REAR CARGO AREA ON THE CRVTHE EXHAUST PIPE IS ADDED TO THE CAR ON THIS LINE.THESE ALLOW PASSANGERS TO GET IN AND OUT OF THE CAR.A METAL RING USED TO DISTRIBUTE PRESSURE OVER A LARGER AREA.THIS IS ONE OF THE METHODS WE USE TO ENSURE A COUPLER IS FULLY SET....

MOCA 2025-07-01

10 Items: This word describes how we show care in our communication.These help us stay efficient, balanced, and focused in our work.What it takes from every role to complete a project successfully.The role focused on supporting internal systems and training the team.The person who gives a final polish to every project before it’s sent....

The Role of Nurse Residency Programs in Supporting New Graduate Nurses 2025-11-21

4 Items: What key workforce outcomes do nurse residency programs try to improve by helping new nurses stay in their jobs longer?What emotional risks do nurse residency programs help reduce by offering support, mentorship, and a positive practice environment?...

Resume 2025-10-28

1 Item: Employer, Employee, Resume, Soft Skills, Volunteer, Contact, Communication, Teamwork, Professional, Strengths, Responsibility, Career, Education, Reference

Chp. 3 Review for final 2022-12-13

23 Items: one layercolumn shapedmultiple layersanchoring junctionscube shaped like a diceflattened and fish scalebinds cells together like a zippermoves materials across the surfacevoluntary and striations and multinucleatefunction is to protect and support the bodyinvoluntary and no striations and one nucleus...

Critical Incident Management Word Search 2025-04-30

25 Items: Device used to clear blocked airway.PPE worn to protect mucous membranes.Used when scene has multiple victims.Sterile material used to dress wounds.Temporary shelter for displaced athletes.Personal defense against disease exposure.Severe blood loss leading to tissue death.Organization responsible for EMS dispatch....

Vocab Word Search 2022-10-18

20 Items: The product life cycle stage in which sales rise rapidly.The particular group of customers a business seeks to attract.People who personally use a good or service to satisfy their own wants.Goods and services purchased quickly and without much thought or effort.The product life cycle stage when the product first appears in the marketplace....

8th Grade Science Word Search 2023-05-17

23 Items: heat energyform of energy in the sunused in night vision gogglesenergy of an object in motionatom or compound with a chargesubatomic particle with no chargeused for cell phone communicationform of energy in food and batteriesform of energy resulting from motionpositively charged subatomic particlenegatively charged subatomic particle...

Week 8 Thursday 2023-10-06

25 Items: course of studyTo buy somethingMario's occupationWorthy of attentionwritten communicationto support with evidenceHappens at the same frequencyBelonging to a particular personFirst in the order of importancea math sentence with an equal signA number that is not a whole numbersharing an edge or boundary; touchingConvert waste into a reusable material...

The internet 2025-09-18

30 Items: To find somethingA software programSolving math problemsApp to access websitesA single page on the webA set of connected partsUseful tools or materialsU.S. military headquartersData entered into a systemTo enter numbers on a phoneCode used to make web pagesA series of steps or actionsLinked or connected togetherA machine that processes data...

Abundant Word Search 2025-08-21

20 Items: To surroundHaving many ofShockingly unacceptableContrary to or forbidden by lawA ghost or figment of the imaginationPause before saying or doing somethingGo somewhere with someone as a companionThe principal method of human communicationThe envelope of gasses surrounding the earthThe whole system and structure of a language...

BSFDE S 70 2025-11-12

20 Items: A global streaming company exampleAdapting a product to fit a local marketA company that operates in multiple countriesThe main technological driver of globalizationA major benefit of globalization for consumersA positive impact of globalization on educationtrade Global business cooperation between regions...

CHAPTER 1 2025-05-01

183 Items: MEDIASTYLEUSAGEREGIONMEDIUMNGỮ-ÂMSTRESSMEDIUMFORMALVARIEDCONCEPTVARIETYPRESENTDIALECTGRAMMARLEXICONTỪ-VỰNGUSED-INNGỮ-VỰCTOWARDSA-STYLELEAD-TODICTATEBIẾN-THỂATTITUDEGẮN-LIỀNREGISTER"JARGON"AUDIENCEINFORMALCHÍNH-TẢCHỈ-ĐỊNHENCOMPASSLÕI-CHUNGSHARED-BYPHONOLOGYBIỂU-HIỆNEDUCATIONVĂN-PHONGCHUYỂN-ĐI"CORRECT"IS-WANINGNĂNG-ĐỘNGPHƯƠNG-NGỮPARTICULARVOCABULARY...

Life Skills 2022-12-02

1 Item: solving, thinking, organization, empathy, communication, resolution, management, planning, focus, Listening, Meditation, Connections, Connections, overcoming, Perspective

Internet Word Hunt 2024-05-12

12 Items: This is the most visited website as of nowOn average, internet users spend 6.5 _____ online each dayThe government used an internet system in order to share ___________The first operational computer network developed by the Department of DefenseThis application allowed users to easily connect to websites and browse the internet...

Focus on Greek Roots 2024-03-04

19 Items: Study of living organismsEarly sound-reproducing machinePerson trained for space travelA person's signature, often as a mementoA sudden event causing great damage or lossVisual representation of data or informationAn account of someone's life written by someone elseAn account of a person's life written by that person...

Deaf Appreciation Month Word Search 2025-03-11

15 Items: Not completely deafDeaf Awareness MonthTo have loss of hearingA device that can help people hearA famous deaf inventor and businessmanThe last name of the inventor or hearing aidsA famous deaf disability rights activist and an authorThe past of deaf or hard of hearing people and cultureA famous deaf composer and pianist in the 1700s and the 1800s...

GRIDLOCK 1 2025-08-12

15 Items: Harmless treatmentMemory reserved area in SASSAS function for current system dateOption in PROC FORMAT to create multilabel formatsGraph type is typically used for time-to-event dataSDTM variable which indicates study treatment groupMacro variable that stores the current system date in SAS...

GRIDLOCK 1 2025-08-12

15 Items: Harmless treatmentMemory reserved area in SASSAS function for current system dateOption in PROC FORMAT to create multilabel formatsGraph type is typically used for time-to-event dataSDTM variable which indicates study treatment groupMacro variable that stores the current system date in SAS...

ELA and Technology Word Search 2025-04-16

15 Items: Describes content or tools that exist in electronic format.Comments or evaluations that guide improvement and learning.Tailoring instruction to meet the varying needs of students.The ability to understand and make meaning from what is read.The act of interpreting and understanding written or visual texts....

Chp. 3 Review for final 2022-12-13

23 Items: one layercolumn shapedmultiple layersanchoring junctionscube shaped like a diceflattened and fish scalebinds cells together like a zippermoves materials across the surfacevoluntary and striations and multinucleatefunction is to protect and support the bodyinvoluntary and no striations and one nucleus...

Most Common Words That Start With C Part 2 2025-05-02

185 Items: copcowcrycupcutcoalcoatcodecoldcomecookcoolcopecopycorecorncostcrewcropcoachcoastcolorcouchcouldcountcourtcovercrackcraftcrashcrazycreamcrimecrosscrowdcyclecoffeecolumncomedycommitcommoncookiecornercottoncountycouplecoursecousincreatecreditcrisiscriticcustomcollectcollegecombinecomfortcommandcommentcompanycomparecompetecomplexcomposeconceptconcern...

Corporate Body Language 2025-02-24

10 Items: Non-verbal cues used to emphasize points during a speech or discussion.(g)The way you sit or stand during a meeting can convey authority or openness.(p)Key to showing engagement and sincerity during presentations or conversations.(e)A simple expression that fosters positive rapport and approachability at work.(s)...

Literacy and Learning across the Curriculum 2024-04-09

5 Items: journals A journal in which students record their responses to a text as they read.Which of the following instructional strategies does NOT promote exploratory writing?journal A journal in which students role-play characters by writing from the perspective of a given figure...

Neuron Word Search 2025-09-17

14 Items: Basic nerve cell that transmits electrical and chemical signals.A neurotransmitter linked to reward, motivation, and movement control.Fatty insulating sheath around some axons that speeds neural conduction.— A neurotransmitter involved in muscle activation, attention, and memory....

GRIDLOCK 1 2025-08-12

15 Items: Harmless treatmentMemory reserved area in SASSAS function for current system dateOption in PROC FORMAT to create multilabel formatsGraph type is typically used for time-to-event dataSDTM variable which indicates study treatment groupMacro variable that stores the current system date in SAS...

Famous Inventions and Discoveries 2025-04-14

10 Items: STEAM ENGINE : A machine that uses steam to power mechanical work.TELEPHONE : A device used to transmit sound over distances for communication.ELECTRICITY : A form of energy resulting from the movement of charged particles.MICROSCOPE : An instrument used for viewing very small objects by magnifying them....

word search 2025-04-23

1 Item: desire communication pressure niche believe focus mind education sharpen courage memorize research studies work overcome leaning goal sacrifice information

Consentement, Word Search 2025-11-08

1 Item: contrainte, pouvoir, fantasme, transgression, confiance, vulnerabilite, domination, soumission, scenario, limites, communication, controle, resistance, intensite, sécurite, complicite, erotisme, negociation, agentivite

Adoration, Word Search 2024-02-13

25 Items: a in acts 1c in acts 2t in acts 3s in acts 41st in 7 sacraments 82nd in 7 sacraments 93rd in 7 sacraments 104th in 7 sacraments 115th in 7 sacraments 126th in 7 sacraments 137th in 7 sacraments 14latin of Our Father 17communication with go 5tagalog of Our Father 18is an "action" of the whole Christ 151 of the 3 mysteries of faith starts with 7...

blah blah blahah 2025-07-25

200 Items: CRULAXRueBayJetNerdEXAMLAUXGoldSageTofuAloeShipGrayPondOZZILionRockPENSPineTramALANACreekTruckBINGOYuccaBOOSTPeachCOATEOnionTrainOasisMulanMopedDonutEAGLEDANCEEZONERobinBrownWoodySlothWINGSWENTZKhakiPlaneLilacGreenSteakGERMANStitchLizardPurpleGliderBronzeDISTEMCanyonBadgerBurgerUrsulaGrapesMaroonJessieBucketYellowForestCraterDEGREEGENEDSViolet...

Textile Word Search 2026-01-15

20 Items: Reason that attracts people to a new placePower source that drove locomotives and boatsReason that forces people to leave their homelandKnown as the 'Father of the American Factory SystemPolicy favoring native-born citizens over immigrantsMachine that rapidly removes seeds from cotton fibersPerson who moves to a new country to live permanently...

The Expert Conference 2025 2025-04-26

200 Items: WINIDEAPEERPLANSYNCTASKTEAMCARELEADGROWHELPALIGNBUILDDRIVEFOCUSGOALSGROUPIDEASROLESSHARETRUSTUNITEUNITYCLIMBEXCELSOLVEBRIDGECREATEEFFORTENGAGEEQUITYEXPERTGROWTHLISTENMANAGEMENTORMUTUALOUTPUTRESULTSHAREDUNISONVALUESVISIONDESIGNENABLEEVOLVEFOSTERFUTUREGATHERTHRIVEADJUSTUPLIFTACHIEVEBALANCECLARIFYCLARITYCOMBINECONNECTDEVELOPDYNAMICEMPOWERENGAGED...

Poker Activity Word Search 2023-07-07

10 Items: deviation from a standardH-D#1 principle to pursue the simplest path to each outcome(cause) The fundamental reason for the occurrence of a problemDiagram tool used to identify root cause, usually resembling a fishH-D#1 principle that allows to communicate with purpose, structure, facts and inspiration...

Pathways Word Search 2025-09-12

20 Items: Skills needed to obtain and maintain employment.Organizing your schedule to complete tasks on time.Working effectively with others toward a common goal.A trained professional who provides therapy for clients.A worker who provides care and supervision for children.A professional who advises people about money decisions....

Haley & Adam 2025-09-18

30 Items: Adam's favorite colorAdam's birthday monthHaley's birthday monthHaley's favorite singerAdam's favorite cuisineThe color of Haley's jeepDating app the couple met onAdam's favorite football teamHow old the couple's cats areThe couple's beloved dog's nameAdam's favorite alcoholic drinkThe month the couple got engagedThe make of the groom's race car...

Algorithm Word Search 2023-04-06

10 Items: What is the study of meaning in language called?What is a spoken word, phrase, or sentence called?What is a group of similar data points or objects called?What is a set of step-by-step instructions for solving a problem or performing a task called?What is a system of communication used by humans, including spoken, written, and sign, called?...

Chapter 9 Special Education 2025-03-11

10 Items: What is an AAC device used for?What has two requirements for assessing students with disabilities?What kind of assistive service is provided to special education students?Representation, expression, and engagement are the three key principles of what?What kind of tools like crutches, wheelchairs, joysticks, and alternative keyboards fall under?...

WORD SEARCH PUZZLE IN THE ADSO INFORMATION 2025-09-22

10 Items: To identify, analyze, and fix errors (bugs) in code.To perform tasks or processes automatically, without manual intervention.To run a program, script, or instruction so that it performs its intended function.To improve the performance, speed, or efficiency of code, an algorithm, or a system....

PE Terms 2025-08-15

1 Item: Leadership, Sportsmanship, Challenge, Trust, Exercise, Movement, Coordination, Energy, Collaboration, Encouragement, Leadership, Problem-solving, Cooperation, Respect, Communication, Strategy, Balance, Fitness, Endurance.

Service Standards and check holds 2023-07-13

20 Items: we should be asking ____ to membersmembers should feel respected by us makingwe do not accept these type of insurance checks____ a member who has been with us for >30 daysconnect 4 more is about going beyond the ____ needassociates should always ___ a member with their ID____ are only accepted when used for a loan payment...

Light 2024-01-07

12 Items: The smallest possible packet of energy.The distance between successive peaks in a wave.The rate of vibration measured in Herz; one Herz is one vibration per second.The rate at which an object or wave travels; the basic unit is meters per second.High-frequency, high-energy photons generated by the nucleus during radioactive decay....

Neuro Word Search 2025-01-16

12 Items: this can cause both tension-type and cluster headachesthe phase of a migraine that involves tingling and blind spotsthis type of stroke is manifested by sudden severe headache and HTN__________ Sclerosis is characterized by a demyelination of nerve fibersa partial loss of speech or swallowing that puts a stroke patient at risk for aspiration...

EDU 200 Chapter 3 Vocabulary 2024-07-01

15 Items: a person's ancestrytechnology that adapts to support students with disabilitiesa rigid, simplistic caricature of a particular group of peopleimmigrants who are fleeing unsafe conditions in their home countriespart of the inclusion process whereas you work with other professionals...

Unit 4: Spelling Quiz 2 2022-12-01

30 Items: skillfulentirelysacred; set aparta book of synonymsboundless; limitlessone who writes psalmsa slothful, idle personto tear down or demolishlazy; indolent; sluggisha shortened form of a wordprotection and preservationmisrepresentation; falsenesslacking moisture; parched by heatan island; especially a small onehaving subtly penetrated or spread...

LINGUISTICS 2025-11-11

1 Item: – MORPHOLOGY – SYNTAX – SEMANTICS – PRAGMATICS – DIALECT – SOCIOLECT – IDIOLECT – ETYMOLOGY – LANGUAGE – COMMUNICATION – DISCOURSE – TRANSLATION – GRAMMAR – PHONOLOGY – ORTHOGRAPHY – MORPHEME – LEXICON – CONNOTATION – DENOTATION – INFLECTION – DERIVATION

Safety Wordsearch 2024-02-27

10 Items: Safety events should be documented in ____ _____.____ is the acronym for Situation Background Assessment Recommendations.The best way to prevent the spread of infection is by performing ____ ____.______ Precautions should be used by all staff in the care of all patients....

Globalization 2025-08-05

1 Item: Tariff, Economic, united nations, Cultural, Transportation, immigration, import , export, world bank, liberalization, international, business, company, urbanization , communication, trends, Market , supply, technology

Leadership 2025-09-02

1 Item: communication, confidence, empathy, accountability, adaptability, vision, delegation, motivation, resilience, patience, courage, creativity, dependable, positive, inspiration, fairness, determination, , teamwork, intelligence, leadership, transparency, tr

Core Values 2023-08-04

222 Items: funjoycalmworkhopeloveriskclearsensedrivefocusgracehonorlogicorderpeacepoisepowerrigorskillsmarttrusttruthunityvalorvigorbeautycandorcleverenergyfamilyfamousgeniusgivinggrowthhealthlawfulreasonspiritstatustalentvisionwealthwisdomwonderbalancebraverycapablecarefulcharitycomfortcontrolcouragedignityempathyempowerethicalfreedomharmonyhonestyjustice...

The first 3 words you see 2025-05-05

1 Item: loved honesty shine warm worthy nourishing luxury dream thoughtful stability goddess communication simplify pleasure joy enjoyment ground resourced soft attractive beauty natural bondaries

Secret Word Search 2025-07-15

25 Items: Spy’s encrypted message or dataSpy’s clandestine courier or messengerTerm for a covert listening device (short)Term for an agent who feeds false informationHistorical espionage agency of the Soviet UnionThe act of secretly intercepting communicationsHAVENS Secret agent’s physical hideout (plural)DROP A clandestine meeting for exchanging secrets...

VOCABULARY UNIT 1 - INTERESTS 2025-02-21

21 Items: SportsGeneral Interests- Physical activities involving skill and competition.- A winter sport involving sliding on snow using skis.- A sport where players roll a ball to knock down pins.- Popular styles of clothing, accessories, or appearance.- Activities or subjects that someone enjoys or finds engaging....

BrightSide 2025-08-21

1 Item: goats, waffles, hot fuss, delightful, coffee, plants, mimosas, sunshine, happy hour, brunch, speakers, internal comms, headshots, balloons, community, employee experience, culture, communication, omaha

Behavior Word Search 2025-09-26

1 Item: Intervention, PBIS, Reinforcement, Antecedent, Consequence, Triggers, Function, Behavior, DEescalation, Calm, Support, Strategy, Prevention, Communication, Safety, Resilience, Emotion, Regulation, Crisis, Antecedent, Response, Environment, Escalation, Rei

Spatial PhenoSearch! 2023-08-10

10 Items: Proteins that are activated in the same cell.Natural emission of light by biological structures such as tissues.Overlapping excitation and emission wavelengths of two or more fluorescent dyes.Emission filters that capture the peaks and part of fluorophore emission wavelengths....

WORD SEARCH- TLE 4 2025-08-09

1 Item: Minicomputer, devices, supercomputer, communication, information, recordkeeping, software, hardware, components, operations, techniques, internet, virus, authentication, word processor, microsoft word, powerpoint presentation, microsoft excel, document

Workplace Incivility 2024-11-30

10 Items: an authoritative rule dealing with details or procedure.relating to relationships or communication between people.the person who leads or commands a group, organization, or countrythe action of working with someone to produce or create something.a state of emotional, physical, and mental exhaustion caused by excessive and prolonged stress....

Chapter 5 Media Name: _________________________ 2025-12-01

8 Items: The apparatuses that bring networks of technology into existence.Media produced by and for indigenous communities often outside of the commercial mainstream.One-to-many communication that privileges the sender and/or owner of the technology that transmits the media....

Espionage and the spy game word search 2025-07-15

25 Items: Spy’s encrypted message or dataSpy’s clandestine courier or messengerTerm for a covert listening device (short)Term for an agent who feeds false informationHistorical espionage agency of the Soviet UnionThe act of secretly intercepting communicationsHAVENS Secret agent’s physical hideout (plural)DROP A clandestine meeting for exchanging secrets...

IBDP Language B Identities Vocabulary Word Search 2025-09-04

25 Items: Usual ways of behaving in a cultureFeeling accepted and part of a groupThe country a person legally belongs toPrinciples or beliefs that guide behaviorJudging others unfairly before knowing themA group of people born around the same timeMoving from one country or region to anotherShowing your thoughts, feelings, or identity...

City Word Search 2025-04-14

1 Item: Year provides service, volunteering, community, education, youth, schools, support, mentoring, tutoring, development, skills, experience, growth, impact, opportunities, leadership, teamwork, communication, collaboration, students, learning, engagement, Am

A Word Search Across Borders 2025-02-25

1 Item: Language, Culture, Hofstede, Communication, Individualism, Multilingualism, Identity, Ethnicity, Language Barriers, Globalization, Expressions, Body Language, Respect, Hierarchy, Directness, Tone, Translation, Interpretation, Self-expression, Harmony, Co

WEDNESAY WORD SEARCH 2025-10-09

1 Item: COMPLIANCE REGULATORY QUALITY INSPECTION MORTALITY CULTURE OF SAFETY, INFECTION CONTROL, PROCESSES, AVOIDABLE, OUTCOMES, RISK MANAGMENT, VALIDATION, VALUE, COMPLICATION, PATIENT RIGHTS, PERFORMANCE, OPPORTUNITIES, COMMUNICATION, EFFICIENCY, DATA DRI

Nervous System 2025-03-14

17 Items: Specialized cells that transmit nerve impulses.Nervous System (CNS) Comprises the brain and spinal cord.Nerves Nerves that carry commands from the brain to muscles.The part of the brain that coordinates movement and balance.The junction between two neurons where signals are transmitted....

WHAT I VALUE 2025-01-28

238 Items: FunJoyCalmDutyFameHopeLovePlayRestRiskDepthDriveFaithFocusLogicMeritOrderPeacePowerPrideTrustTruthUnityValorValueVigorBeautyCandorCaringChangeFamilyGrowthHealthHonourImpactPeopleGrowthSafetyHumourStatusTalentUsefulVirtueVisionWarmthWealthWisdomWonderAgilityBalanceBraveryCapableCarefulCharityComfortCourageDecencyDignityEmpathyEthicalFitnessFreedom...

Stay Aware, Stay Compliant 2024-10-15

5 Items: Intrusive software designed to infiltrate a computer system without the owner’s informed consent.Is defined as an uncontrolled unplanned fire that spreads rapidly through areas of combustible vegetation, such as forests, grasslands or brushlands....

Modules 2 & 3 Review 2025-02-06

11 Items: Domain in which motor skills are included.These are detailed, objective, and accurate.Can be informal, formal, and can track benchmarks.Domain in which language and literacy are included.Domain referring to a child's ability to think & reason.Domain in which children develop autonomy or independence....

Five Themes of Geography 2024-06-11

19 Items: a locationhighways...etc.)a place where a particular point or object exists.measures the distance north or south of the equatorways that people interact with space, and vice versameasures the distance east and west of the Prime Meridianthe four main compass directions; north, south, east, and west...

Memorial Day, A&G NEWS. 2022-05-30

232 Items: awejoykinmayWarbanddutyflagfoodherohomehopejoinkeenlifelovepompwaveZealzestbatonbirthblastciviccorpsdreamfeastfree,glorygoalsgravemarchmusicpeacepridequickquietstarsunifyunionunitevalorYearnanthemardentcombatcommonendureenergyequinefamilyheraldhoorayIdealsjoyfuljoyousmutualnationnativeparadepicnicprayerpublicquaintrightssaluteshrineslogansolemn...

tester23 2023-03-18

245 Items: codaâmeartbiochidayareaauraautoâyurbachbodycampcodecoldcropdéfidéjàdénidheaalphaamwayangesappelarchebaccibiaisbiblebijoubonneboulebrainbrownbyrnecayceclarkcordecorpscourscultedabicdébutakashaanoxieapportarchéoashtarastralavatarbamboubarnumbarronbetterbrightbunyipbuttarcabalecannoncartescasquecécitéchaînechampscharmecherrychopraclimatcônagecrânes...

WHAT I VALUE 2025-01-28

238 Items: FunJoyCalmDutyFameHopeLovePlayRestRiskDepthDriveFaithFocusLogicMeritOrderPeacePowerPrideTrustTruthUnityValorValueVigorBeautyCandorCaringChangeFamilyGrowthHealthHonourImpactPeopleGrowthSafetyHumourStatusTalentUsefulVirtueVisionWarmthWealthWisdomWonderAgilityBalanceBraveryCapableCarefulCharityComfortCourageDecencyDignityEmpathyEthicalFitnessFreedom...

Nursing Shortage 2024-04-07

15 Items: What primary focus guides the efforts of nurses in healthcare settings?What term describes the insufficient number of available nurses in healthcare settings?What strategy aims to keep nurses in their current positions within healthcare institutions?What paramount concern guides the actions of nurses and healthcare providers in their duties?...

Socioeconomic Disparity Word Search 2023-11-29

4 Items: What type of disparity refers to the unequal distribution of economic resources and opportunities among different individuals or groups within a society?What is the communication model discussed in the presentation that helps determine the extent of a patient’s understanding of health information and instructions?...

ANIMAL TRAITS 2025-09-09

1 Item: cats, cleverness, communication, Cunning, danger ,Deception,dog, dolphin, fox, friendship ,grace ,hard ,horse, Independence, Intelligence, leadership, lion, Loyalty, Memory, mystery, owl, patience, Playfulness ,snake, Speed Strength ,Teamwork, tiger, wis

BRAIN DISSECTION 2025-08-04

12 Items: Fold or curve on the surface of the brain.Groove or crevasse on the surface of the brain, creating the gyri.Three membranes around the brain that provide protection and support.Bulb Neural structure responsible for olfaction, or our sense of smell.This lobe controls our sense of hearing and is important for language because it processes sound....

Topic 6 DEVELOPMENT OF HARDWARE, SOFTWARE & TELECOMMUNICATIONS SYSTEMS 2024-05-02

21 Items: The brain of a computerSemiconductor materialsThe delivery of computing servicesMaterials that have a conductivityA set of recognizable and verifiable dataThe capacity of a device to hold and retain dataPhysical components of a computer that you can touch and see.Set of instructions and programs that tell a computer what to do...

Words related to Culture 2024-05-02

20 Items: The study of past events (7).A group of people living in the same area (9).Written works, such as novels, poems, and plays (9).A celebration or event, sometimes involving music (8).Moving the body rhythmically in a pattern of steps (5).An artwork created by applying colour to a surface (8).The sense of self and belonging to a particular group (8)....

2408 HVAC 2026-02-07

23 Items: The CO in HPCOThe "A" in BAS.The "H" in HVAC.NEC article 424.19 covers this.Another name for an airflow switch.An alloy of steel containing 36% Nickle.another name for a semi-hermetic compressor.Another name for a Freeze Protection ThermostatA high temperature limit switch helps prevent this.In a thermostat this is the cooling control wire color....

Diesel Laptops Call Training 2024-12-16

16 Items: platform used to make callscustomer support direct phone numberday of the week Technical Support is not openwhere you do in SF to find a list of all past ticketstimeframe standard for customer outreach on new ticketin SF this is where you would go to find related pictures on your case...

My Honey Bunches Word Search 2025-02-14

1 Item: bunches sunshine Texas salad love redneck lesbian love deposits love languages trust commitment truth communication calm, harmony respect dependability optimism together equal workitout emotions cuddle touch share happiness kindness integrity boundaries p

Culture Word Search 2024-05-02

20 Items: The study of past events (7).A group of people living in the same area (9).Written works, such as novels, poems, and plays (9).A celebration or event, sometimes involving music (8).Moving the body rhythmically in a pattern of steps (5).An artwork created by applying colour to a surface (8).The sense of self and belonging to a particular group (8)....

Definition Report Words 2026-02-06

12 Items: a person or thing equal or similar to anotherThe emotions or conduct of friends; the state of being friendssomething that manifests, embodies, or symbolizes something elsea succulent plant with a thick, fleshy stem that typically bears spinesAn unintended hole, crack, or the like, through which liquid, gas, or light enters or escapes...

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

Language Word Search 2025-02-24

20 Items: a describing wordsimilar to Judgingthe study of spacea country in europeanother word for a cliffan army of roman soldiersrelating to, using, or resembling magic.long narrow hilltop, mountain range, or watershed.a soft, white or clear mineral that's made of calcium sulfatehaving or showing a mild, kind, or tender temperament or character....

International Business Etiquette 2 2024-09-05

22 Items: Avoid ___________________ and high pressure talk.Do not ___________________ touch your Chinese colleagues.As of 2008, Germany was global leader in ___________________.Most business meetings are conducted over ___________________.___________________ is the most widely spoken language in Europe....

The Boy Who Harnessed the Wind Vocab #1-3 2025-10-02

33 Items: very thinto mock or insultto produce or makeconfusion or disorderunstable or unbalancedto set up or to establishto control in order to usean extreme shortage of foodluck or chance in the futurean honor or a special benefitto be kept active or energizedto let loose or set into motionhaving a sweet or pleasant smellto figure out, solve, or plan ahead...

BF130 Chapter 10-17 Review 2025-10-13

13 Items: an intentional misrepresentation of a material factBreaking into a building with the intent to commit a felonyA legal doctrine indicating that parties meant to do what they did.Written defamation, or defamation published over radio or televisionan artificial, intangible entity created under the authority of a state’s law....

Hardware Unit Vocabulary 2025-12-11

19 Items: The "U" in "USB"A type of storage that keeps data without powerTransmits data at high speeds via light signalsCable that connects storage devices to the motherboardStores and manages files for other devices on a networkA piece of software that may need to be installed for a peripheral to work....

College Operations Policy Word Search 2025-07-19

8 Items: An unmanned aircraft is called a _________.__________ is the acronym for the student board that reviews parking appeals.The number of days after an event that posters must be taken down or they will be removed by SEC or Campus Safety staff....

October Security Summit Wordsearch (Harder) 2023-08-18

20 Items: What term means having permission or approval to access something?What is the unique address used to identify a location on the internet?What term refers to the ability to enter or use a system, service, or area?What term describes a widely accepted or established norm or specification?...

UPS Label Requests 2023-09-25

19 Items: A UPS label requires _________ _________ to be created.On the confirmation page, what should you copy for later use?UPS labels should be created in possible __________ situations.Box 3 - What are you shipping? - What is the correct Packaging Type?Box 1 - Where is this shipment going/coming from? - What should you click?...

Customer Engagement Hub Market: Trends, Growth Opportunities, and Regional Insights 2025-06-23

13 Items: playersdriversupdatesanalysissegmentationOpportunitiesthe rising trend of cloud-native engagement hubs and strategic partnerships among tech giants to deliver unified, data-driven customer interaction platforms globally....

Hospice Word Search 2025-08-03

28 Items: – The expected outcome or course of a disease.– Accurate recording of patient care and clinical decisions.– The process of evaluating a patient’s needs and condition.– A federal insurance program that often covers hospice care.– The act of directing a patient to hospice or other services....

Computer Vocabulary 2025-08-26

20 Items: The physical parts of a computer.It receives and sends data on computer networks.A computer that provides data to other computers.A type of memory card typically used in digital cameras.Programs that tell a computer what to do and how to do it.It stores data and instructions while the computer is working....

Switching and Routing Terminology 2023-03-29

34 Items: A port that allows traffic from only one VLAN.A logical grouping of computers through segmentation in a LAN.A set of computers and devices connected in one physical location.A naming system that converts human readable domain names into IP addresses.A security feature on some switches that filters out untrusted DHCP messages....

Agency Word Search 2026-01-28

25 Items: Basic self-care tasks such as dressing and eating essential for daily life.Complex tasks needed to support life in the home such as shopping or meal prep.A child's internal sense of power and control over their own choices and actions.A physical measure of hand power often evaluated using a specialized dynamometer....

Computer Hardware1 CAT 2023-07-24

24 Items: the computer works on the dataI am also known as optical mediaI measure your unique biological features.computer keeps a permanent record of our workPresenters use me to show their audience a presentationI am a small radio device that stores and transmit datacomputer gives feedback on the results of its processing...