chinese new year Word Searches

Genetics Part 1 2024-10-16

18 Items: Genes that code for proteins.The genetic makeup of an organism.Genes that control gene expression.A sequence of DNA responsible for coding a protein.Extra copies of DNA found in bacteria and some fungiAll the genetic material (DNA) present in an organism.The process by which DNA is copied before cell division....

Kelley Florence Speech 2025-12-11

9 Items: A formal written request made to an authority or organized bodyOne such example in Kelley's speech is, "...pitiful privilege..."Rhetorical appeal Kelley uses in the sentence, "We do not wish this."To admit to the privileges of a citizen and especially to the right of suffrage...

U6 2026-01-15

12 Items: Title of a news articleForce applied or stress feltCareful and persistent effortExtremely large or impressiveLiving being, animal or personRival in a contest or businessMotivating or filling with enthusiasmThe final result of an action or eventExamine in detail to understand betterThe process of making or manufacturing...

Year 6 How We organise Ourselves 1 2016-04-06

5 Items: electelectioncandidatedemocracygovernment

ellies wordsearch 2023-12-18

16 Items: to create lighta pattern of starsthe study of planetshas the north star in itfor light to bounse of itthe study of constellationsa rock that falls from spacea person that travels in spacea spoon made of made of 7 starslight in the sky from a meteoroidapath in space around a planet/starwhen night and day are the same length...

IYTC January Games 2025-01-26

5 Items: Type of event NorCal will be hostingWhere will Arizona's fundraiser be held?What country has IYTC traveled to in the past?The new platform to view IYTC's latest social media updatesWhat food will be available to purchase at Maryland's fundraiser?

Vámonos de Viaje 2024-02-20

54 Items: the travel mode by aira pass to a location and backtraveler who visits new placesthe place the trip is going tothe place airplanes are landedthe item needed to board a flightthe list of activities for a tripthe vehicle needed to travel by airto accidentally not get on a flightto get to one's desired destinationthe time when tourism is busy or not...

Unit II Review - Early River Valley Civilizations 2024-10-07

23 Items: Seasonal windsRanked by statusA Mesopotamian templeImportant Egyptian riverAnother word for farmingTaming plants and animalsNatural barrier in northern ChinaAnother name for the Huang He RiverOne of the first written legal codesAnother word for a "complex society"One of two important Mesopotamian riversOne of two important Mesopotamian rivers...

Ch. 6 - The Zhou Dynasty and New Ideas, Section 2 - vocabulary 2020-09-24

10 Items: lordLaoziethicsDaoismpeasantLegalismConfuciusZhouDynastyConfucianismMandateOfHeaven

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

GAP YEAR UNLOCKED: Goal setting for success 2024-09-12

5 Items: FocusAttainSpecificProgressMilestone

9 weeks 2 test review 2023-12-07

31 Items: japan.- Factories and farms produce more goods than people can buy.Young women of the 1920s that behaved and dressed in a radical fashionNew Deal program which gave electricity and jobs to rural Appalachia, including ALGovernment programs passed by Congress to help the U.S. get out of Great Depression...

Countries 2025-05-18

98 Items: FasoChadRicaFijiIranIraqLaosMaliOmanBeninChileChinaCongoEgyptGabonGhanaHaitiIndiaItalyJapanKenyaLibyaMaltaNepalNigerAngolaBelizeBrazilCanadaCyprusFranceGambiaGreeceGuineaIsraelJordanKuwaitLatviaMalawiMexicoNorwayAlbaniaAlgeriaAustriaBahamasBelarusBelgiumBoliviaComorosCzechiaDenmarkEcuadorEstoniaFinlandGeorgiaGermanyHungaryIcelandIrelandJamaica...

London Word Search 2025-10-27

99 Items: RicaCubaIranIraqLaosMaliOmanPeruChileChinaEgyptGhanaHaitiIndiaItalyJapanKenyaMaltaNepalKoreaQatarKoreaSpainLankaSyriaBrazilCanadaCyprusFranceGreeceIsraelJordanKuwaitLatviaMexicoMonacoNorwayPanamaPolandRussiaArabiaSerbiaAfricaSwedenTurkeyAustriaBelgiumBoliviaCroatiaDenmarkEcuadorEnglandEstoniaFinlandGermanyHungaryIcelandIrelandJamaicaLebanonMoldova...

JIL MISSISSAUGA WEST 2ND YEAR ANNIVERSARY 2025-09-27

4 Items: onlyfourdaysleft

50 most common Ukrainian adjectives. 2025-01-19

50 Items: bignewoldbadlowsaddrywetgooddarklongtallwidedeepfullweaksamerichpoorsourloudwarmcoldsmallreadyyounglightshortemptybravescaryhappysaltycleandirtyquietnarrowsimplehungryjoyfulstrongbittercomplexcorrectbeautifulnecessaryimportantdifferentincorrectfull (satisfied in terms of hunger)

109 Power Words 2026-02-02

109 Items: aIoftoinisitheonasatbeorbyweanifdoupsonomygotheandyouforwasarehisonehadnotbutallcanhowoutshehashertwohimseeitswhonowdidwayusemaygetnewthatwiththeythisfromhavewhatwerewhenyoursaidwilleachthemthenmanysomeintomoreliketimemakethanbeenmadeoverdownonlyfindlongveryjustmostknowbackmuchgoodtherewhichtheiraboutthesewouldothercouldfirstwaterafterwordswhere...

American Football 2025-09-14

20 Items: Dallas team nicknamed “America’s Team”Chicago Bears running back nicknamed “Sweetness”Pittsburgh team with six Super Bowl championshipsGreen Bay team that won the first Super Bowl in 1967New York team that beat the Patriots in two Super BowlsFamous stadium in New Orleans hosting multiple Super Bowls...

Bo 5.0 2025-01-26

17 Items: מִצְווֹתPlague #8Plague #9“come”, Hebrew“good” in Hebrew“Mitzvah” Hebrew“Hello” in HebrewThe king of Egypt.“Let My people ____”The Holy One’s calendar.Nothing new here…. Ecc.1:9The letter ‘mem’ pictures??The ‘sign’ on the doorposts.“We’ll done, good and faithful _______”These had light during the plague of darkness....

New year's day 2024-02-16

2 Items: tenmonkey

World History 2023-07-17

20 Items: 29 CE _____ _____ crucified.1299 CE Osman I established the _____ Empire.1799 CE _____ Bonaparte takes control of France.1215 CE John of England sealed the “_____ _____”.570 CE Prophet Mohammed (the founder of _____) born.1492 CE Christopher _____ discovered a route going to the New World....

03 2025-08-16

15 Items: Planned club ride or eventGroup motorcycle trip or outing.Local division of a motorcycle club.Custom bike with extended front forks.the bags on the side of the motorcycleSlang for a Harley-Davidson motorcycle.the bike of choice of most outlaw bikersMain hangout or meeting place for bikers.Motorcycle style built for relaxed riding....

ww4 u 11 2024-06-18

18 Items: eyesightgreat; largea long, deep cutraw and unrefinedhappening every yeardull and uninterestingthe state of being boredto make or have a change into come or mix together into oneto feed; to support and make growto make or become larger; to add toto give up something or to surrenderthe leaves of trees and other plants...

Enginnering A-Z 2023-01-17

7 Items: improve the manufacturing processresponsible for building new exhibitshelp find oil and gas for the country's energy needs.Implement utility network monitoring and alarming systeminstall, repair, and perform routine maintenance on x-rayAnalyzes, troubleshoots and repairs diagnostic or ultrasound imaging equipment...

Aiden 7th grade 2024-05-16

15 Items: the driest of all the biomesthe biological variation that occurs within speciesa ridge of rock in the sea formed by the growth and deposit of coral.the variety of different habitats, communities and ecological processesthe variety of life in the world or in a particular habitat or ecosystem....

A New Government 2015-02-26

2 Items: JohnAdamsWilliamJohnson

A New Government 2015-02-26

2 Items: JohnAdamsWilliamJohnson

Agape Family Health 2022-07-06

100 Items: newwccuhcpcpdobiudhivobersheakingpainadhdTestlabskingdunnnameraceShotbcbsevanstolerVisitcovidagapeErroradultaetnacignapearlphonevisitemailpillshipaachartnursesnyderkocherfamilyhealthannualvisioncancelHealthhumanaathenacriollowittmanpatientdiseasefloridanewbornexpiredmerrillselfpayaddressflushotexistingpapsmearphysicalvaccinesfollowupschedule...

Site words 1 2023-01-13

113 Items: hegoinismetoitmyweonatasofifambedonousuporcanyouseegetnotanddidrunforwasareallbigboybutcardayeatfunhadhasherhimhishownewnowoffoldoutransawshewhywhooneusetwoanysaidhavelikeawaybestcomedownfromgirlgivegoodherelookmademakeoverplaysometellthatthemtheythisthemwantwhenwhatwentwillwithyourweregirleachbeenwordmanyintodoesafteraboutcan’thousetherethingwould...

cari kata 2023-11-04

25 Items: bineroktalgenerikdesimalkata.......format gambarmenangkap layardokumen tambahanformat powerpointfitur untuk menutupalat komunikasi 2 arahperangkat keluaran suarafitur untuk menyalin datamenempelkan hasil salinanfitur untuk membuka dokumenfitur untuk mencetak dokumenfitur untuk menyimpan dokumenxlsx adalah format microsoft.......

New year's day 2024-02-16

2 Items: tenmonkey

New Project Title 2025-09-24

2 Items: sacredoctober

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

Constitution and First Five Presidents 2025-04-10

11 Items: 1st President of the U.S.2nd President of the U.S.3rd President of the U.S.4th President of the U.S.5th President of the U.S.Novel by Harriet Beecher StoweThe government's powers are restrictedThe turning point of the American revolutionPolitical group that wanted a new constitutionis a 3-letter abbreviation of our first constitution...

Totalitarianism 2026-02-11

19 Items: a ruler with absolute poweropposing ideas are silencedloyalty and devotion to a nationuse of force to silence oppositiononly one political party is allowedmilitary is emphasized and glorifiedused to spy on and intimidate opponentsgovernment controls newspaper and radiolaws made by the leader without approvalbiased info used to shape public opinion...

Bride & Groom Trivia Wordsearch 2025-06-11

16 Items: Groom's sun signBride's sun signAnother wedding colorAnother wedding colorOne of the wedding colorsCity where the groom proposedTheme of the wedding receptionThe year the bride and groom metThe store where bride and groom metBride and groom's first date restaurantThe name of the bride and groom's first cat...

Cookie Quest - Use the clues below to find the words hidden in the word search below 2025-01-28

10 Items: Jejune (6 letters)rapid new growth (7 letters)fallen or cut off (5 letters)inner lining of the chest (8 letters)to steal like a thief (7 letters)a large crowd of people (8 letters)small wooden wheel or caster (7 letters)the study of voting patterns (10 letters)Modern latin word meaning ‘everywhere’ (10 letters)...

Rapunzel pgs. 2-7 2023-06-07

11 Items: Where is the tower?Whose garden was it?What was in the garden?Who stole the lettuces?What color is the girl's hair?What is the little girl's name?What does the witch come to take?What place is the girl's new home?What did the husband do up the wall?What does the husband promise to give?What kind of baby did the man and his wife have?

Republic Word Search 2024-10-23

16 Items: new townHannibalRoman general27 BCE to 180 CEmember of roman plebsmilitary orginizationtransport fresh waterwar between 264 and 146founder of roman empirea leader and protector of the peoplegroup of three people who share powerA group of wealthy land owning familiesupward movement of prices for goods and services...

3rd Grade Sight Word - Word Search 2023-08-24

108 Items: bynotoarebuyi'mitsnewoffoneourtootwowaswhowonalsocityhaveholeintoit'sknewknowsaidthentheyyourverywantwearwentwhenwithaboutagaincan'tcoulddon'tfirstlet'srighttheirtherethrewuntilwe'rewherewholewon'twritealmostalwaysanyonebeforedidn'tenoughexcepthiddenmyselfpeopleprettyreallyschoolthat'swinneryou'reanotherbecausedoesn'tgettinggeneraljournallaughed...

Eight Months 2025-06-26

26 Items: catreaddrinkdiscordboardgameice creamcurrent dayyou make me?overachieverour call timefast hedgehogyou live in..the one i loveHappy birthdayi see that townwhere you going?explosive expertyou do that oftenyou say that oftenhope you get it todayfrom that friend bookin my restless dreamsyour favorite activitythey give us items to do...

VocabMan 2 2024-09-17

63 Items: inpendaymayhotbookyearweekjunejulycoldfallmonthtodaymarchaprilwindyfolderpencilmondayfridaysundayaugustpleaseseasonwinterspringsummertuesdayjanuaryoctoberhowmanyrainingsnowingnotebookthursdaysaturdayfebruarynovemberdecemberHacesol.classroomtommorrowwednesdayseptemberyousay...itmeans...studentdeskwhatdayisitLaestudiantestudent(male)teacher(male)...

American Football 2025-09-14

20 Items: Dallas team nicknamed “America’s Team”Chicago Bears running back nicknamed “Sweetness”Pittsburgh team with six Super Bowl championshipsGreen Bay team that won the first Super Bowl in 1967New York team that beat the Patriots in two Super BowlsFamous stadium in New Orleans hosting multiple Super Bowls...

Anticorruptionpolicy Word Search 2026-02-26

22 Items: Teaching employees new or advanced skills.Poor use of time or resources in administration.delivery Provision of public services to citizens.Modern; relating to current administrative practices.Honesty and strong moral principles in public office.To keep skilled civil servants in the administration....

OUR LOVE WORD SEARCH 2026-02-13

17 Items: When did we first met?Where did we first met?What is symbol of love?Where was our first trip?What is my favorite drink?Which month is my birthday?What is our favourite food?What nickname did I give you?What nickname did I gave you?What small action shows big love?What do we feel every time we hug?What is our relationship built on?...

2K6-UNIT1 2023-09-27

9 Items: knowing somethingto keep something safeto accept or use something newnot harmful to the environmentto make something smaller in size or amountgo to an event such as a meeting or a classa device or machine that is used in the houserubbish that people have left in a public placefootpint The amount of carbon produced by human activities

Julia's sky science word search 2023-12-18

20 Items: we live on onelight bounces off ita rock covered in icethe galaxy we live onpeople who go to spacealso called ursa majoralso called ursa minorthe study of the planetsa rock floating in spacealso called the big dipperstars arranged in a patternalso called a shooting staralso called the little dippera lot of solar systems together...

Audrey Heycock - 90 years of memories 2025-05-12

23 Items: My church?My last job?My first home?My first friend?Where do I live?My first school?My sister's name?20 year church group?Twins I have looked after?Who do I share my house with?Time running Monday HomegroupTime helping with Sunday_SchoolHow many God-Children do I have?Godchild's name beginning with SA Royal Family member I have met?...

All About Helena 2025-07-18

20 Items: The dark daysHumbling Jess DSeasick inducingHelena’s homebodyHelena’s sloppy messHelena’s secret loverThe accused trip copierLovergirl but …… at heartUnleashes chaos with 1 sipHelena’s acting debut & endHelena’s iconic granny shoeMadison’s creative stories outletYear 11 ultimate threat against MadsA fiery character with a heart of gold...

Helena 2025-07-18

20 Items: The dark daysHumbling Jess DSeasick inducingHelena’s homebodyHelena’s sloppy messHelena’s secret loverThe accused trip copierLovergirl but …… at heartUnleashes chaos with 1 sipHelena’s acting debut & endHelena’s iconic granny shoeMadison’s creative stories outletYear 11 ultimate threat against MadsA fiery character with a heart of gold...

All About Mortgages and Escrow 2024-03-18

17 Items: FHA stands for _______This is an example of a lender.Escrow analysis are done on a ________ _______.These are the consumers looking to finance residences.Financial Protection Bureau CFPB stands for _______.,Typically the cushion will be _____ ______ of escrow paymentsthe company to whom borrowers pay their mortgage loan payments....

Miss B's end of term quiz - Year 3 & 4 what have we learnt, Summer 2020? 2020-06-19

55 Items: OboeTubaHarpLionSwanMinimStavePulsePitchBrassVoiceFluteViolaCelloDrumsPianoPromsElgarQuaverRhythmMelodyViolinClavesGuitarStringsBassoonTrumpetTimpaniMaracasFossilsFanfareCrotchetBassClefOstinatoWoodwindClarinetTromboneTriangleElephantAquariumTortoiseKangarooOvertureSymphonySemibreveKeyboardsSaxophoneBeethovenHenryWoodOrchestraTrebleClefPercussion...

Find the Missing Word – Past Tenses & Superlatives 2025-10-16

10 Items: While she ____ , her phone rang.That was the ____ day of my life.He ____ a new bike last Saturday.I ____ a long email this morning.While I ____ , it started to rain.They ____ dinner at 8 PM last night.She is the ____ student in the class.This is the ____ story I’ve ever heard!They ____ a movie when the lights went out....

School Word Search 2026-02-06

10 Items: - to gain new knowledge or skills- a person who helps students learn- a table where students sit and work- a tool used for writing and drawing- a place where children learn and play- pages with words and pictures to read- a backpack used to carry school items- a group of students learning together- someone at school who plays and shares...

CPPI Team Building June 2023 2023-06-27

12 Items: (USDA Innovation Hub)(Diabetes Prevention Program)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(Illinois Public Health Institute)(Building Resilient and Inclusive Communities)(State Physical Activity and Nutrition program)(Coalition founded, managed and staffed by IPHI with a new name)...

Yom Yerushalayim 2023-05-04

17 Items: What is the Kotel?What do we do to celebrate?Who did Jordan team up with?What year did the war happen?What did the Jordanians stealHow many days did it last for?How many tanks did Israel have?What did the Jordanians destroy?What Arab country invaded Israel?What month did the war happen in?What did the Jordanians take over?...

Korean Word Search 2026-01-26

12 Items: where we first met hehecute nickname for eachotherwhen did we become official?your favorite spot to give me kisseswhat was our very first broadway show?this is where we had our very first kisstype of food we ate on our first ever datefavorite gift of your commitment to me and uswhat did we go see on our second valentines together?...

Space 2023-11-09

14 Items: Has supersonic windsWhat is lemon shapedWho grow taller in spaceOrbits the Sun on it's sideThe Moon was once a piece ofHas 82 known Moons and countingIs now considered a dwarf planetHottest planet in the solar systemMost what have a central black holeThe largest planet in our solar systemWhat planet has reddish sky but bluish twilights...

Henry's Sky Science Word Search 2023-12-18

14 Items: a small rock in spaceto discharge somethingthe study of the universedebris from an object in spacewhen light bounces off another objecttrain their whole lives to go into spacea big rock made up of dust and particleshappens when the sun crosses the equatora smaller constellation of the big dippera famous constellation that resembles a big bear...

Enero Word Search 2023-03-03

20 Items: not bad butnot good butopposite of sadopposite of youngcolor of the cloudsmonth of graduationnumber after nineteenhaving a lot of moneyfirst month of the yearhe wasn't handsome he waswhere you go to make moneyif something isn't true it'show you feel after a long daywhen you have a lot to do yourat diez y acho i am still very...

Grade 3 Wordsearch 2025-11-18

20 Items: IntentionNight of PowerBeing Pure/CleanTalking to AllahThe call to prayerBeing Impure/UncleanWhat is healing called?What is a "gift" called?Asking Allah for forgivenessWhat is a sick person called?Cleaning/Washing before PrayingSomething that is allowed is called?Giving 20% of our savings every yearWhat is it called to holy person/place?...

EMMA & CRAIG 2025-11-29

20 Items: Where was Emma born?Where was Craig born?What is their dog called?Name of Emma's first pony?Where did they get engaged?Which farm do they live on?What is their BMW Z4 called?What is their BMW X3 called?Where was their first holiday?Their favorite reality TV show?What instrument does Craig play?Their first Grand Prix together?...

Happy Birthday Tom ! 2025-09-28

47 Items: touch me babehad paul anka's babychuck berry's only #1 songmade anita ward a one-hit wondermormon answer to the Jackson Fivefirst music group to win an oscar1989 dystopian/utopian stage productiontwo music groups named after continentswe tumble to the ground and then you saythese four music groups named after cities...

The GTN Gazette Word Search 2025-05-30

5 Items: Who is May's Employee of the Month?Where is the Top Accelerators trip going?Where is the team fun day being held? Jetton ____ HallWhat is the new weekly GTN blog newsletter title? The ___What should you bring to the strategy meeting? Your ___ number results.

education 2025-10-27

19 Items: Synonym of test.The study of numbers.To study for an exam.A mark on an exam or course.School after primary school.The opposite of public school.The days and times of classes.The opposite of pass (a test).After an exam, you get the _____.University graduates have a _____.A period of time in a school year.The study of novels, plays, poetry....

Great Depression 2026-03-11

5 Items: Little town consisting of shacksOffered free or low cost food andLines of people waiting to receive foodCash payments or food the government provides to the poorDrought plagued by dust storms and evictions, Kansas, Texas, Oklahoma, New Mexico, and Colorado were hit hardest

Groundhog Word Search 2026-01-19

10 Items: - a guess about what will happen next- the cold season with snow and short days- a hole in the ground where an animal lives- the bright light in the sky that makes shadows- something people do every year in the same way- to do something special for a holiday or event- a dark shape made when something blocks the light...

Barefoot Dreams of Petra Luna 2025-09-20

10 Items: A symbol of Petra's dreams and hopePetra's last name, meaning "moon" in SpanishWhat she holds onto,even during her hardest momentsThe brave 12 year-old girl who is the main characterWhat Petra and her family are searching for in AmericaThe violent conflict that causes Petra's family to fleeSpanish word for grandmother, who guides Petra's journey...

1/22 Level 2 VR P60.62.64 2025-10-14

15 Items: latera place fora place to sitsoft hair on animalsbefore the usual timenew,clean,good to eat or usewant something good to happensomething has happened before nowin a short time,not long from nowbecome part of a group or activitya big green animal with many teethcannot sleep and keep moving in bedlike someone or something very much...

Vocabulary List 9 Word Search 2026-02-18

15 Items: Put an end toDisperse throughoutHold back or restrainIntimidating to deal withAble to work successfullyGive new strength or energyMessy or disheveled appearanceTending to avoid issues or answersA confidence that something is trueHinder or prevent from doing somethingAchievement that requires courage or skill...

Frozen Dreams 2026-02-26

15 Items: – To stay alive.– A strong snowstorm.– Given credit or honor.– Items needed for a journey.– Unfair treatment of someone.– Unfair treatment based on race.– A heavy sled pulled across snow.– A shelter made of blocks of snow.– A person who discovers new places.– Native people of the Arctic region.– A large icy land near the North Pole....

AMS Word Search 2025-06-24

16 Items: The city of AMSThe mascot of AMSThe state we live inThe school district of AMSThe subject where you use numbersA class where people learn to actA class where people learn to singThe colors of AMS are red and _____?The subject where you do experimentsA place where you can check out booksThere are two of these in a school year...

22 2025-08-17

15 Items: Paved road.Sharp mountain turns.Smaller country roads.Local branch of a club.New recruit in trial periodLarge national highway system.Division of a motorcycle club.Regular gatherings of club membersAttendance check at a club gatheringMain structural body of a motorcycleDecision-making process among membersComponent that connects forks to the frame...

POSTIES 0224 BIG READ 2025-01-24

6 Items: how good or bad something isfar away from places where other people liveknowing that something exists and is importantMany young children die each year from _____ because they drink dirty water.People in some parts of Africa have to walk _____ kilometres every day to get water...

SDS Fall Wordsearch 2025-09-18

7 Items: Our new athletics director.The name of the school play.The theme of the homecoming dance.Where the trip taking place during fall break is.The entire school signs pledging not to cheat and stay honorable.The book of the Bible being read in bible study with Dr. Michael.A standardized multiple choice college exam registered by CollegeBoard.

Tigris Word Search 2024-01-24

17 Items: The first Emperor of Rome.The Romans built these to carry water.Huge Chinese wall built for protection.A series of rulers from the same family.The large mountain range where the Inca lived.Ancient sporting event held in Olympia, Greece.The Inca were famous for these connecting paths.A step-like type of temple found in Mesopotamia....

Unit 1 Key Terms 2025-05-30

22 Items: A person who designs any of a variety of things.An idea that produces a similar idea or an enhanced idea.A limit to a design process. ; A limitation or restriction.The ability to make or bring a new concept or idea into existenceA person using the services of a professional person or organization....

91.The first transcontinental commercial flight took place in 1953, from Los Angeles to New York. 2023-03-07

30 Items: jetfoodfarespeedtravelsafetyairlinenewyorkcockpitcomfortluggageaviationdistancebeveragescheduleindustrypassengerboeing707cabincrewlosangelestechnologyinnovationnavigationflightcrewairtrafficentertainmentcommercialflighttranscontinentaltranscontinentalin-flightservice

TCB Operations Puzzle 2025-10-07

15 Items: Bank CEOAccount Opening SystemEmails we should reportDTA is used for this purposeSystem used to book new loansTeam who handles fraud claimsDay-to-day contact at the bankOrganization led by Trish HookerCreditNow is used to access theseSupport team who handles treasuryRequired for manual money movementSigners have these assigned by KYC...

Cards Word Search 2023-11-13

15 Items: _____ at places like food banks or shelters to help others.Make cookies or treats and give them to your neighbors or _____.Spend time with _____ people who might be alone during the holidays.Go for a walk outside and think about all the amazing things in _____.Write About _____: Write an essay or poem about what you're thankful for....

PYL3 2025-08-31

7 Items: people.clever, intelligent, or quick to learn.objects or equipment used to do a task or job.to share information, ideas, or feelings with others.to know the meaning of something or to grasp an idea.different from others in a good way; unique or important.the careful study of a subject to discover new facts or information.

East Asian Cultural Elements 2026-01-04

25 Items: A popular condiment in East Asian cuisine, including Chinese.A sacred animal in China, one of the four benevolent animals.China's national animal, recognized for its black-and-white-coloring.In China, it's not just used for illumination, but also symbolizes peace and good fortune....

Dribbles Word Search 2026-01-19

15 Items: Stretched all the way out.In a way that is angry or unkind.In a careful way to not get hurt.Water ____ slowly from the faucet.Things that make a good combination.A person you know, but not very well.Signed up or officially written down.The sad, poorly dog had been _____ by his owner.Choosing carefully instead of picking everything....

Final Cold War Word Searchizzle 2023-03-15

11 Items: USSR Economic ReformA conflict that went hotUSSR Political Freedom ReformRivalry between the US and the USSRNo private property and classless societythe government sets production and pricesUSA policy to stop the spread of communismindividuals determine production and pricesLeader who tried to save the USSR with new reforms...

Burning Word Search 2023-12-04

15 Items: means "in"means "out"heat is moving outchemical name of rustformed when magnesium burnsmeans the same as combustionice melting is this type of processwhen a substance combines with oxygenforms bubbles when magnesium is in acidtype of reaction that forms a new substancegiven out when metals react with water or acids...

Wonders of the Ancient and Modern World 2024-09-26

15 Items: A Mayan pyramid in Mexico.A famous Parisian monument.A famous mausoleum in India.An iconic Roman amphitheater.An ancient Incan city in Peru.The longest wall in the world.Guided sailors in ancient Egypt.A symbol of freedom in New York.A giant statue in Olympia, Greece.The rose-red city carved in stone.Once stood in the harbor of Rhodes....

80s Music 2025-05-30

15 Items: sang "Called Me"The "Material Girl""Purple Rain" artistGeorge Michael’s duoSinger of "Smooth Operator"New wave group with "Whip It"They blessed the rains in "Africa""Another One Bites the Dust" legendsBand behind "Dude (Looks Like a Lady)"German rockers behind "Winds of Change"All-female group who walked like Egyptians...

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

Sedimentary Rock 2025-12-07

10 Items: Sediment being squeezed togetherMoving sediment from place to placeSediment being glues together by mineralsWhat are small pieces of rock and mineralsRemains or traces of ancient living thingsWhat are layers of sedimentary rocks called?What process breaks rocks into smaller piecesWhat is a natural feature on Earth's surface?...

Freedom Word Search 2026-02-06

10 Items: - a happy feeling about the future- to understand new ideas and facts- being kind and sharing with others- being able to live and make choices- a march with people, music, and smiles- people who love and care for each other- people who live, work, and help together- to have a happy day for something special...

Bay Model 2024-07-06

11 Items: A problem solverThe creation of new ideasA mixture of salt and fresh waterThe proper use of natures resourcesThe protection of nature from damageThe system of rivers, lakes, and baysThe ocean that the SF bay drains intoThe body of water where rivers meet the seaThe wetlands where rivers flow into the bayAnimals or plants that came from another area...

generic wrod search 2024-04-26

12 Items: Having wisdom, like an owl!It means not giving up easily.a quick comeback to an insult.It is a sword from the old east.Bland and dry imagination.. sad.A formal agreement you can't break.Good luck in discovering new things.Not doing something for a long time.Silly and happy, innocent like a child.Harsh laws or rules, like the Soviet Union....

trs 5B W16 pt1 2022-05-25

10 Items: n. how much something costsv. give money to buy somethingadj. someone from the Netherlandsn. the money someone gets from a jobn. use it find places and directionsn. something that is made by a processn. a woman getting married at a weddingn. left, right, up, down, back, forwardn. a symbol that shows North, South, East and West...

TCW MLS LT2 2023-11-06

10 Items: think global act _____authored the world is flatone of the 10 survival skills- New ______ one of GB advantagesyou can _______ without having to emigrateMNCs adopt this to excel and achieve positioningthe global world makes use of this kind of connectivityallowing free movement of cultures economy and population...

Unaccented Final Syllables 2024-04-04

10 Items: A _____ is equal to four quarts.Please don't _____ me on Halloween!I want to see a _____ in the ocean.The Detroit Zoo has a _____ exhibit!Having pizza for breakfast is _____ .Can I please get water from the _____ ?If you are _____ then you know for sure!I have _____ , I didn't mean to say that!When I was _____ years old, I got a new bike....

Past/Present Tense 2025-05-07

12 Items: I wish I _____ my cookie.The car has been ______ up.I watched my Dad as he ______.I ________ all of my homework.I got a new dress which I _____.Yesterday I went home and ______.We ______ to the Ice Cream Store.I ______ my grandmother make cookies.I have ______ to him about the problem.She _____ if I could come to her house to play....