books Word Searches

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

Botanist 2022-05-25

1 Item: plant,grow,latin,genus,phylum,classify,ecosystem,sample,study,schooling,reference,books,file,catalog,identify

Grade 5 Lesson 6: What Will You Do This Summer? 2026-07-01

14 Items: I i/l/w/l go to Busan.Have a d/g/o/o e/i/m/t!I will g/o/w/r potatoes.I will a/e/l/n/r Chinese.I will i/i/s/t/v my aunt.I will a/d/e/r many books.I will go to the a/b/c/e/h.I will grow a/e/s/o/o/m/t/t.I will w/a/c/h/t many movies.I will visit my g/a/a/d/r/n/p.I will learn t/a/d/e/k/n/o/o/w.I will i/j/n/o an English camp....

Middle Ages 2026-05-27

17 Items: A piece of landA Muslim leaderA system of mathThe inventor of algebraA small, self sufficient settlementSomeone bound to land to pay off a debtA transfer of power down the Feudal PyramidSomeone who works in exchange for land/royalty"Father of Europe" and the leader of the FranksA library with 400,000 books located in Baghdad...

PLACES TO GO 2026-04-08

13 Items: an artificial area of water for swimminga special place where land meets the oceana place where people pay to sit and eat mealsa building used for public Christian worship.you take take this to learn how play the pianoland outside towns and cities, with fields, woods, etca large public green area in a town, used for recreation...

Words with oo 2023-04-01

1 Item: books, foot, hoof, cook, nook, hood, wood, stood, hook, crook, cookbook, look, good, crooked, bookcase

Hub, Word Search 2026-05-20

1 Item: TRUCK,BUSES, HORN, SAND, WATER, FRUIT, MARKET, RAIL, TRAIN, PORT, SHIP, TOMB, KARACHI, BOOKS, HALL.

History 2022-10-18

5 Items: If these brothers hadn’t been so persistent, they may never have invented the airplane.If this person hadn’t invented the printing press, not many people would have had access to books.If this ruler had defeated Cortes, Spanish may not have become the most common language in Latin America....

Hiragana Word Search 2025-07-24

10 Items: the japanese writing system for japanese wordsthe Japanese art of flower arranging that emphasizes form and balancea gambling device resembling a pinball machine but with automatic payoffJapanese comic books and graphic novels considered collectively as a genreone of a line of military governors ruling Japan until the revolution of 1867–68...

Hatcho Elementary School 2025-10-05

15 Items: What animal is Mr. Tomono afraid of?The groups made from all grades are called what?What disaster experience did you do in 4th grade?What is the name of the 5th grade English textbook?What sport did the 5th graders practice in PE class?What famous Toyohashi food did you make in 3rd grade?Teachers read books to students during Story __________....

Famous Brands 2024-03-15

25 Items: "Just do it."Makers of the CorvetteThe main competitor of Coca-ColaScandinavian building block brandThe world's most-used search engineCreators of MS-DOS operating systemCoffee chain with a green siren logoCompany with a doughboy for a mascotstore chain owned by the Walton familyKnown for their animated musical films...

Ezra LA gr 3 301-305 2024-12-03

189 Items: actboyjoylieowltrywhobabybornbullbusycalfcopydatedeerdovedrewdustdoneearsfeelfearfellgermgonehearheldhoodhookhornisntJulyJunelambleadmeanMissnewspaidpastpawsroserulesizesoaptiretookwrenAprilbegunbooksbreadbracebrookbrokebuiltbuildcarrychairchainchartcheercrawlcriesdrivedrowneaglefinchfifthfixesfoggyfrontfrowngiftsgloveglobegracegraveguesshatchheard...

Global II Review 2025-05-22

24 Items: "Gold, God, and Glory"Heroes in a half-shellLouis XIV's fancy house.Earth-centric solar systemSeafaring Scandinavian warriorsA region of religious significanceThe capital of the Byzantine Empire.The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever....

EXERCISE 170326 2026-03-17

20 Items: In which century did magazines emergeA newspaper that is published every dayMagazines became a platform for targetedA newspaper that is published once a weekA type of book based on imaginary storiesA newspaper format known for serious reportingIn which century did the first newspapers appearNewspapers became a mass medium influencing public...

Spelling Lists 6 and 8 2026-05-13

20 Items: Preposition meaning "opposed to”.Noun meaning “area of open land”.Verb meaning “to come to a decision”.Noun meaning “series of related things”.Noun meaning “a complex human community”.Adverb meaning “completely” or “extremely”.Adverb meaning “in reality”, “truly” or “very”.Adjective meaning "belonging to the distant past”....

Fill in the gaps wordsearch 1 2026-09-10

25 Items: “I brush my teeth _ _ _ _ _”“The fish is still _ _ _ _ _”“The sun rises in the _ _ _ _”“Do dinosaurs still _ _ _ _ _?”“The sun goes down in the _ _ _ _”“The school is just _ _ _ _ _ of us”“We took a _ _ _ _ _ across the river”“I _ _ _ _ you to jump into the water”“There are _ _ _ _ _ books on the table”“Australia is to the _ _ _ _ _ of Japan.”...

Hub, Word Search 2026-05-20

1 Item: TRUCK,BUSES, HORN, SAND, WATER, FRUIT, MARKET, RAIL, TRAIN, PORT, SHIP, TOMB, KARACHI, BOOKS, HALL.

Hobbies and Free Time 2026-02-20

25 Items: – Riding a bicycle.– Making food at home.– Playing video games.– Moving fast on your feet.– Moving your body to music.– Sleeping outside in a tent.– Running slowly for exercise.– Making music with your voice.– Walking a long way in nature.– Growing flowers or vegetables.– Taking pictures with a camera.– Using colours to make pictures....

Exhibition Word Search 2026-04-27

21 Items: The tu for irThe yo for irA place you go eatThe nostros for irYou watch a sport on tvThe el Ella usted for irA place with are displaysSomewhere you go to see a filmA place where you can read booksThe ellos, ellas, ustedes for irSomething you do for fun or watchA place where you go watch sports in real life...

Vocab 15 2024-04-23

12 Items: Despite his _____, behavior he got a date to prom.The witness's testimony helped _____ the suspect's alibi.after winning the lottery I had a _____ or a lot of money.She was able to ____ information from her old history books.At the funeral a girl wore a _____ red dress which made others upset....

the giver 2025-12-03

1 Item: giver receiver task books library snow sled runner career assign job courage wisdom release release setting

Focus on Greek Roots 2024-03-04

19 Items: Study of living organismsEarly sound-reproducing machinePerson trained for space travelA person's signature, often as a mementoA sudden event causing great damage or lossVisual representation of data or informationAn account of someone's life written by someone elseAn account of a person's life written by that person...

Where Did the Funds Go? 2025-07-09

15 Items: You will not find gossip here—just numbers that tell the full story of what came in and what went out.In fund accounting, this term is like the final score—it tells you what is left after the spending game ends.If someone gave you $1,000 to fix potholes, this concept would be why you better not spend it on a taco truck....

Ruby's Sunflower 2026-04-09

10 Items: The old rubber band ____________ suddenly when I pulled it too hard.I __________ playing the piano every afternoon so I can improve my skills.Dad is ____________ all the books by putting them neatly on the shelf in order.The kittens ___________ quickly up the tree when they heard a loud barking dog....

Departmentstore Word Search 2025-06-29

14 Items: A field where corn is grown.A place where people go to eat meals.Having existed for a long time; not new.A piece of land planted with fruit trees.A place where films are shown on a large screen.Not existing before; recently made or discovered.A building offering lodging and other services to travelers....

;) 2026-05-29

17 Items: 你老师Which place do people swim in? (p+3)Which place do people go to watch movies? (c+5)Which place do people go to take a train? (t+12)Which place do people stay when they travel? (h+4)Which place has trees, grass, and playgrounds? (p+3)Which open public area is often found in a city? (s+5)Which large ship is used for travel and holidays? (c+5)...

;) 2026-05-29

17 Items: 你老师Which place do people swim in? (p+3)Which place do people go to watch movies? (c+5)Which place do people go to take a train? (t+12)Which place do people stay when they travel? (h+4)Which place has trees, grass, and playgrounds? (p+3)Which open public area is often found in a city? (s+5)Which large ship is used for travel and holidays? (c+5)...

;) 2026-05-29

17 Items: 你老师Which place do people swim in? (p+3)Which place do people go to watch movies? (c+5)Which place do people go to take a train? (t+12)Which place do people stay when they travel? (h+4)Which place has trees, grass, and playgrounds? (p+3)Which open public area is often found in a city? (s+5)Which large ship is used for travel and holidays? (c+5)...

Words Search 2026-05-27

13 Items: → I am the largest land animal with a trunk. Who am I?→ A set of lessons you study over weeks or months is a…→ A large body of salt water smaller than an ocean is a…→ When someone breaks the rules, the teacher may need to…→ You use me to write on the blackboard, but I’m not a pen.→ A piece of writing in a newspaper or magazine is called an…...

Fifth, Word Search 2025-08-19

1 Item: FRIEND, FUN, TEACHER, RECESS, BOOKS, MATH, SCIENCE, DREAMS, BLACKBURN, PRIBBLE, SPADER, SPADERTOTS, READING, WRITING, SPELLING, EMERSON, GYM, STEAM, MUSIC, RECESS

Kinder 2026-02-12

208 Items: bincuppenrugtoyballbellcubeglueyarnapronbookschalkchairchartclockeaselgamespaperrulersongstimerabacusblocksbucketcolorspuzzlerecessshapessmocksballoonbeanbagcrayonsfriendslibrarymarkersmobilesnumbersorigamiplaymatreadingsandboxshelvesteacherwritingabcchartbackpackbooklistcalendarclasspetdaysweekexercisefeathersfloormathomeworkmealtimepainting...

Kinder 2026-02-12

208 Items: bincuppenrugtoyballbellcubeglueyarnapronbookschalkchairchartclockeaselgamespaperrulersongstimerabacusblocksbucketcolorspuzzlerecessshapessmocksballoonbeanbagcrayonsfriendslibrarymarkersmobilesnumbersorigamiplaymatreadingsandboxshelvesteacherwritingabcchartbackpackbooklistcalendarclasspetdaysweekexercisefeathersfloormathomeworkmealtimepainting...

A Half Century of Grateness 2026-04-27

50 Items: UsChattyNeat nickProud fanIrmo lakeHalf fullBeloved mom"Irish" catBrit's footyFriends fratLover of wordsLover of books1940's "stems"Guardian angelA party "dress"ARD's EnneagramSweaty badassesPlace of respiteReflective hobbyIrish photo posePD's short pantsFood is my vesselWho passes a bar?Her "better" halfBig & little whipsUnfortunate hairdo...

Nick&Jess 2024-08-26

40 Items: Best Man's nameTheir first dateThe couple's dogBride's middle nameFather of the GroomFather of the BrideThe Groom's hometownMaid of Honour's nameHoneymoon DestinationThe Brides professionDating app they met onGrade Jess is teachingNick's favourite storeBride's birthday monthNick's favourite hobbyJess's favourite hobbyThe month Nick proposed...

Kinder 2026-02-12

208 Items: bincuppenrugtoyballbellcubeglueyarnapronbookschalkchairchartclockeaselgamespaperrulersongstimerabacusblocksbucketcolorspuzzlerecessshapessmocksballoonbeanbagcrayonsfriendslibrarymarkersmobilesnumbersorigamiplaymatreadingsandboxshelvesteacherwritingabcchartbackpackbooklistcalendarclasspetdaysweekexercisefeathersfloormathomeworkmealtimepainting...

Sopa de letras by Knightlee 2026-04-27

20 Items: "Mom says we need to___home."Place to have fun and celebrateA big and has multiple shops insideA place you go to buy gas and snacks"They___to the park to have a picnic"A place Where do you go to watch plays?"They/They all want to___play football."A place Where do people go to buy books?A Place where do people go to eat dinner?...

1-5 2026-06-11

1 Item: GRATITUDE, LEARNING, ADVENTURE, TEACHER, MEMORIES, BOOKS, ACHIEVE, SUCCESS, EXAMS, HAPPY, RECESS, KINDNESS, GOALS, LAST DAY, SCHOOL, FUN, GROWTH, CLASSMATES, SUMMER

Unit 13 Word Search 2026-01-31

29 Items: a five-pointed stara shape with four sidesa shape with five sidesa shape with three sidesa period of three monthslikely to argue or fightoccurring every five yearshappening four times a yeara vehicle with three wheelsa solid shape with five facesmade in three identical copiesa musical scale with five notesan animal that walks on four legs...

School 2026-01-19

14 Items: The person in charge of a classroom (7)The person in charge of the whole school (11)A pause in work or during an activity or event (5)The sound that happens to signify the end of lesson (4)The object you use to create permanent lines on paper (3)The hard, flat surface you lean on while writing or drawing (4)...

Aardvark Word Search 2022-11-13

222 Items: pialfbltdiyelfentpbjpieteabangbeesfetafoodgeekikealegolovenerdplaypoolswimtestxboxyeetanisebaconbookscajuncatancurryettinfrogsgumbohollyhowdyjesuslarvalaughmanicmorbsoreospizzapunnyskatesmilesmitesteakurmomwalkswandsapiaryapplesastrosbahlerbogglecheesecoffeecowboydawdleescheweuchrefamilygardenhobbithummusmatrixmidgetmoviesnubbinobtuseohdearrapier...

Max The Mighty Word Search 2026-03-18

20 Items: The place where Rachel's dad had died.Appears in front of Max and flies away.The town Rachel thinks her father is at.Max's old friend that sadly passed away.What Max becomes at the end of the book.What Dip gives Max and Rachel as a treat.Beginning of book what Max calls himself.Dip wears this type of shirt while driving....

SIMPLY READ SUPER STUDENTS 2025-08-21

1 Item: ROSALIE, ASHER,SCARLETT,KINLEY,COMPREHENSION,DAVID, READING, ANDREW, BOOKS, TOM, WORDS, CAROLINE, MAIN IDEA, KAYDEN, EVERLEE,EMMA I,EMMA W,FUN,EVAN,SYLLABLE

library 2025-08-23

1 Item: biography, bookmark, books, borrow, catalog, chapter, cover, dictionary, encyclopedia, fiction, illustrator, librarian, library, spine, pages, nonfiction, novel, reading, barcode, shelf, return, story, title

Library 2025-08-23

1 Item: biography bookmark books borrow catalog chapter cover dictionary encyclopedia fiction illustrator librarian library spine pages nonfiction novel reading barcode shelf return story title

library 2025-08-23

1 Item: biography bookmark books borrow catalog chapter cover dictionary encyclopedia fiction illustrator librarian library spine pages nonfiction novel reading barcode shelf return story title

T2W8 Commonly Misspelled Words 2026-05-10

12 Items: a point or period of timeThe librarian is ____________ for the books in the class library.Building a complex LEGO model requires a lot of ____________ and a very steady hand.to act, move, or proceed in a quiet, cautious, and secretive manner to avoid detectionEvery student in the choir ____________ enthusiastically in the National Day performance....

OT Books of the Bible 2024-08-16

1 Item: Exodus Leviticus Numbers Deuteronomy Joshua Judges Ruth Samuel Samuel Kings Kings Chronicles Chronicles Ezra Nehemiah Esther Job Psalms Proverbs Ecclesiastes SongofSolomon Isaiah Jeremiah Lamentations Ezekiel Daniel Hosea Joel Amos Obadiah Jonah Micah Nah

Books of the Old Testament 2025-01-06

1 Item: Exodus, Leviticus, Numbers, Deuteronomy, Joshua, Judges, Ruth, 1 Samuel, 2 Samuel, 1 Kings, 2 Kings, 1 Chronicles, 2 Chronicles, Ezra, Nehemiah, Esther, Job, Psalms, Proverbs, Ecclesiastes, Song of Solomon

Test 2025-12-11

244 Items: MACIOSNFCGPSELFBOWJOYIPADIPODIMACTVOSMAILMAPSSIRIOLEDWIFIXMASNOELYULESTARSNOWCOZYGIFTBOWSNICEMILKLOVEMACOSMUSICBOOKSNOTESLIDARMERRYANGELMAGICHOLLYELVESVIXENCOMETCUPIDBELLSFROSTGIFTSSANTACANDYFEASTCHEERPEACEIPHONEMACPROIPADOSICLOUDSAFARIPHOTOSFINDMYRETINAAIRTAGCAMERAADVENTMANGERWREATHTINSELBAUBLEDASHERDANCERDONNERSLEIGHJINGLECAROLSFROSTYICICLEWINTER...

Find the words! 2025-10-02

1 Item: teacher lecture assignment participation scholarship presentation mathematics deadline literature books language physical education attendance achievement test notes physics school subjects experiment revision lunch weekend art choir

Finding Purpose: Word Search for Brain Health 2025-10-29

29 Items: Feeling cheerful and positiveExploring new places and culturesMaking handmade projects or giftsAppreciating the good things in lifeShowing care and compassion for othersPreparing and sharing meals with othersTaking classes or learning something newFeeling joy and contentment in daily lifeTaking care of physical and mental health...

S2 Mega Wordsearch - Find the ENGLISH translations 2026-04-21

120 Items: ététhéfootgolfvélotéléboismielpaincafélaitthonkiwichoubœufporcyeuxgrisjeanpulljuperobepoloroserugbymusicpianohivermangeglacepizzapommepoirepêchepruneradisnavetbleusbrunsvertsnoirslongsbarbevestegantsjaunetennishockeyvolleybasketrollerlivrescartescinémajamaisbeurrecitroncassisfraisementheorangeananasjambonpouletfritesbananeraisintomateceriseoignon...

Global II Review 2026-05-26

24 Items: "Gold, God, and Glory"Louis XIV's fancy house.Seafaring Scandinavian warriorsThe capital of the Byzantine Empire,The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever.The 1054 split within the Christian Church.A major Mesoamerican capital built on Lake Texcoco....

Global II Review 2024-06-03

24 Items: "Gold, God, and Glory"Louis XIV's fancy house.Seafaring Scandinavian warriorsThe capital of the Byzantine Empire,The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever.The 1054 split within the Christian Church.A major Mesoamerican capital built on Lake Texcoco....

Digital Literacy 2026-03-16

15 Items: Also called programs, use the platform to perform tasks.Equal to 1,024 GB, approximately equal to trillion bytes.A sequence of instructions that can be executed by a computer.A pattern or picture on the screen background that you can choose.The plural for the Latin word datum, meaning an item of information....

All About 3rd Grade! 2022-06-08

1 Item: Chapter books, Animal Research, Poems, Opinion Writing, Jump Rope, Multiplication, Division, Clocks, Fractions, Area, Perimeter, Geometry, Invertebrates, Vertebrates, Photosynthesis, Mystery Science, Life Cycles, Weather, Pilgrims, American Revolution, Ma

Linguistics 2024-2025 2025-06-06

1 Item: cologne, cats, Pumpkin, laughing, rgrdotfun, dairy queen, hedgehogs, donuts, giggles, quinceanera, LawandOrder, football, basketball, wrestling, ElSalvador, stealing books, where's Gianni, braids, gymnastics, cheer, proposals, Archie, track, mountain, who

90 ~ ALL ABOUT BARBARA ~ 90 2025-01-10

1 Item: Alexander Amber Atlast ATJohnson AZavier Barbara Baseball birds Bloomington blueberries Bobbie Bogota books clamchowder colorfulflowers Colin Cooke crabcakes creamedspinach Doris earrings education Ellen elephants Europe Farm fishroe Gaithers garden games

Cat Word Search 2024-01-04

10 Items: Counted among the most dangerous of all animals (Isaiah 11:8)The practice of this is condemned in the Bible (Deuteronomy 18:10)Malchus lost one when Peter struck him with his sword (John 18:10)The greatest one of all human history takes place at Har–Magedon (Revelation 16:14, 16)...

Marbles Word Search 2025-09-22

1 Item: beach pokemon quarters staples books bank money cheeseburger torta tacos bills appointment checkbook statement utility plant math variable payment candy luxury tiktok instagram facebook tape colors marker notes phone

Our free-time activities 2026-09-05

1 Item: to music, entertain, go for a walk, go shopping, go roller skating, play the violin, read books, ride the bike, surf the Internet, take photo, water the flowers, watch a cartoon

Spring 2026 - Unit II & III 2026-04-21

25 Items: Muslim empire that ruled much of IndiaMachine that allowed books to be mass producedArt technique that creates the illusion of depthA revolt that helped overthrow Mongol rule in ChinaPalace complex in Beijing where Ming emperors livedPayments made to the Church for forgiveness of sinsEmpires that used gunpowder weapons to expand power...

One Word Search 2024-10-06

250 Items: eggpanwaxboxsipsixflyskicubkeynewpopnodcardadyarnpinewoolharmkneewrenzoombuzzlewdmilkblowpinklovetrayslimfilmdimestemsailwoodlookantsrailclambabychopedgenosyneststopfoldwailshutlickusednameteamruinpasthalfmeltsucksighcoalcornnicetablebrassjollyflakyflashstarthauntquilttrampsmashcrimeerectdrinkbikescolorjumpymilkyclothducksspicywearycruelquicktense...

Activities Word Search 2026-03-12

250 Items: ARTBEDBIBCUPMOPMOMMUGNAPZOOBABYBATHBIKECAKEEGGSFOODGLUEHATSHOMEHUGSKIDSMEALMESSMILKOVENPARKRESTSANDSOAPTIDYTOYSTRIPWALKYARDAPPLEAPRONBOOKSBROOMCLOCKCOATSDRYERFLOORFRUITJUICELUNCHMEALSPAINTPAPERPIZZAPOTTYSHOESSLEEPSNACKSOCKSSPILLSPOONSTAINSTORYSTOVESTUDYSWINGTABLETEDDYTRASHWATERWIPESBAKINGBANANABLOCKSBOTTLEBUCKETCARPETCEREALCHORESCLOSETCRAFTSDINNER...

90 ~ ALL ABOUT BARBARA ~ 90 2025-01-10

1 Item: Alexander Amber Atlast ATJohnson AZavier Barbara Baseball birds Bloomington blueberries Bobbie Bogota books clamchowder colorfulflowers Colin Cooke crabcakes creamedspinach Doris earrings education Ellen elephants Europe Farm fishroe Gaithers garden games

WORD SEARCH (KIDS) 2025-01-25

20 Items: One of Nabi Muhammad’s sons.There are ____ pillars in Islam.The belief that there is only one God.The ninth month of the Islamic calendar.The place where Masjid an-Nabawi located.The full name of Nabi Muhammad’s first wife.The sura we are encouraged to read every Friday.The name of the month Nabi Muhammad was born in....

Vgvgvgv 2026-03-13

250 Items: CATJAMMUGNAPPIETEACAKEHUGSLAMPLOVEOVENSOFASOUPWALKYARDAPRONATTICBOOKSCANDYCHAIRCHESSCHINACLOCKCOCOACOUCHDOILYFENCEHONEYJELLYPIANOPORCHQUILTSTOVESUGARTABLEBAKINGBASKETBUTTERCARPETCOFFEECRAFTSDINNERDRAWERFAMILYFRIDGEGARDENPANTRYPILLOWRECIPESCONESSEWINGSUNTEATHREADTREATSWARMTHWINDOWBLANKETBUTTONSCANNINGCOBBLERCOOKIESCOOKINGCOUNTERCROCHETDOORMATDRAWING...

The Books of the New Testament 2023-08-02

1 Item: seven, gospels, epistles, apocalypse, canon, apostles, inspiration, letters, church, acts, epistles, deacon, romans, Corinthians, Galatians, Ephesians, Philippians, Colossians, Timothy, Titus, Philemon, Hebrews, James, Peter, John, Jude, revelation

90 ~ ALL ABOUT BARBARA ~ 90 2025-01-10

1 Item: Alexander Amber Atlast ATJohnson AZavier Barbara Baseball birds Bloomington blueberries Bobbie Bogota books clamchowder colorfulflowers Colin Cooke crabcakes creamedspinach Doris earrings education Ellen elephants Europe Farm fishroe Gaithers garden games

Books of the Bible Old Testament 2026-07-30

1 Item: Exodus Leviticus Numbers Deuteronomy Joshua Judges Ruth Samuel Kings Chronicles Ezra Nehemiah Esther Job Psalms Proverbs Ecclesiastes SongofSolomon Isaiah Jeremiah Lamentations Ezekiel Daniel Hosea Joel Amos Obadiah Jonah Micah Nahum Habakkuk Zephaniah Ha

Abrir Word Search 2023-04-27

26 Items: What you do to a boxwhat you do on a bikea pet related to a wolfTo actively do a sport .How you refer to yourselfin a small amount of time.how you refer to someone elseHow you refer to multiple peopleA place where you can rent books.to contact somebody on a telephoneto lift something up and to move itHow you refer to a female object or somebody,...

Abrir Word Search 2023-04-27

26 Items: What you do to a boxwhat you do on a bikea pet related to a wolfTo actively do a sport .How you refer to yourselfin a small amount of time.how you refer to someone elseHow you refer to multiple peopleA place where you can rent books.to contact somebody on a telephoneto lift something up and to move itHOw you refer to a female object or somebody,...

Find 3 Things You're Grateful For... 2022-11-23

1 Item: gravy, pie, sky, sun, family, air, dogs, cats, hamsters, trees, flowers, kids, friends, love, peace, books, breath, space, water, kindness, hugs, blankets, pillows, birds, string lights, laughter, music, incense, chocolate, ham, salad, cheese, cookies, ca

Propaganda 2026-07-13

13 Items: a false notion or belief; an error in thinkingthe use of symbols to represent ideas or qualitiesa false, spoken statement that is damaging to a person's reputationa false, written statement that is damaging to a person's reputationtrying to prove something by saying it again and again; argument by repetition...

norse mythology 2023-01-18

15 Items: Many slain in battle will end up here.The Nine Realms all cling to this ash tree.The day Tuesday is named after this Norse God.After the Ragnarok cataclysm, these two re-populated the world.This monstrous wolf and problem for the gods is somehow Loki's offspring.We know so much about Norse Mythology because of the writings of this man....

norse mythology 2023-01-18

15 Items: Many slain in battle will end up here.The Nine Realms all cling to this ash tree.The day Tuesday is named after this Norse God.After the Ragnarok cataclysm, these two re-populated the world.This monstrous wolf and problem for the gods is somehow Loki's offspring.We know so much about Norse Mythology because of the writings of this man....

EXERCISE 130326 2026-03-13

30 Items: Differences that weaken an analogy argumentAn error in reasoning that weakens an argumentUsing someone else's work without proper creditKey factors that strengthen arguments by analogyThe main argument or claim presented in an essayEvaluating the author's expertise or credentialsRestating an author’s ideas using your own words...

3B 0726 2022-07-23

25 Items: unwisegreatly surpriseda very large expanse of seafeeling or showing surprisehighly pleasant to the tasteknown and recognized by many peoplea piece of land surrounded by waterfeeling fear or anxiety; frightenedcome or go back to a place or personcoming before all others in time or orderpursue in order to catch or catch up with...

Let's review verbs in the simple past tense! 2023-07-03

26 Items: Ana _____ (sleep) early on his vacation.Camila _____ (have) so much fun last summer!Alejandro____ (do) his their homework last week.Esmeralda ___(go) to the supermarket last weekend.My students ___ (forget) their homework last week.Randall ______ (watch) movies on Netflix yesterday.My mom _____ (find) the money I lost on the street....

Escape Room 2025-07-31

5 Items: When darkness falls and shadows creep, I help brave heroes take a peep. I shine a beam both strong and bright, What am I? I’m a _________!A magician waves a wand with flair, Hides a secret right in the air. With a puff and a swirl, you can’t believe— Watch closely now, as they ______!...

Profession wordsearch 2026-09-10

40 Items: A person who creates artA person who puts out firesA person who performs songsA person who flies airplanesA person who works at a bankA person who works on a shipA person who designs buildingsA person who treats sick peopleA person who serves in the armyA person who travels into spaceA person who works in a libraryA person who writes news stories...

TechnoTangle 2025-09-22

18 Items: I’m the memory that sips power like tea but runs like a sprinter—guess my name!He balances the books and the future—Dublin roots, Silicon Valley fruits. Who is he?I don’t guess—I prove! I’m the logic lawyer who makes your design airtight. Who am I?I mix virtual dreams with real machines—your system’s simulation playground. Who am I?...

ntro to Arts A/V Tech and Comm Weeks 13 - 14 2025-12-03

24 Items: A unit used to measure the intensity of sound.The art and technique of motion-picture photography.The written text for a play, film, or broadcast production.A public display of art, objects, or information for viewing.The process of repeating a segment of audio or video in production....

MIL CWP Review 2026-07-28

26 Items: What exclusive right is granted for an invention?What are systems of signs that create meaning in media?What type of learning allows people to learn anytime and anywhere?What type of content can be harmful or damaging to young people online?Which type of media includes books, magazines, newspapers, and brochures?...

4B 0609 2023-06-08

20 Items: In Taiwan, people use LINE to ______ with each other.There was an ______ in the building, call 119 for help !There are two ______ routes you can take to the library.Police believed the ______ got in through the kitchen window.The ________ walk around on the floor looking for food that people dropped....

Spelling 2024-05-27

15 Items: The day after today. It's like yesterday, but coming in the future!This is grown-up stuff like offices and stores. It's where people work to earn money.When you wish you had something someone else has, like a new toy or a friend's special skill.Feeling shy or uncomfortable because you did something silly or someone pointed out a mistake....

Unit 2 2025-12-23

51 Items: (n) a thingvery or a lotliving, not deadbut, even thougha trip in a planefind something newwhat you talk aboutno sound; very quietbefore; up to a timethe planet we live onsomething that happensasleep to start sleepingbeing safe, not in dangerhappening now, right awaylike to seem like somethingwhen two people get married(somebody) know tell someone...

Islamic Art Chapter 13 2026-01-15

40 Items: In what city was Muhammad born?What Arabic word means “the God”?What are followers of Islam called?What is the holy book of Islam called?What tall tower is attached to a mosque?What is a Muslim place of worship called?What term refers to a sacred religious text?Another name for the Koran is the __________....

Memoir Unit - Holocaust LIt 2025-10-09

20 Items: To give a false representation ofa state that is controlled and protected by another(of a person) not recognized as a citizen of any countryAn organized, state-sponsored attack on a group of peopleA person who carries out a harmful, illegal, or immoral act.To surrender often after negotiation of terms, to cease resisting...

Review 2 2026-05-18

60 Items: A male siblingA female siblingA large populated townA small town or villageMoving with great speedThe midday meal or lunchA male friend in SpanishThe Spanish word for dogThe Spanish word for catA room used for sleepingA male teacher in SpanishThe Spanish word for foodThe first meal of the dayThe Spanish word for birdThe evening meal or dinner...

Nonfiction Memoir VST 2025-10-09

20 Items: To give a false representation ofa state that is controlled and protected by another.(of a person) not recognized as a citizen of any country.An organized, state-sponsored attack on a group of people.a person who carries out a harmful, illegal, or immoral act.To surrender often after negotiation of terms, to cease resisting...

Ladies' Birthday Word Search 2026-01-12

54 Items: The end in GermanOma’s hometown in GermanyThe fatal blow to the DaytonaIssa’s automatic comfort foodPlace where you first met IssaSnack Katie says makes Issa happySimple soup the kids always cravedWord Katie most associates with MomPlace Katie says Issa goes to relaxWhat feels uniquely yours with IssaSomething that defined life with Mom...

Feverishly Word Search 2023-11-16

43 Items: a pouting expressioncontinues to exist; lastsgreatly astonished or amazedpursue or approach stealthilylasting only for a short timein a strange and frightening mannerbitterly disappointing or upsettingcapable of being precisely identifieddeep respect for someone or somethingin a frantically excited or energetic manner...

☆Echo Word Search!☆ 2024-04-22

30 Items: The scientific study of insects.The scientific study of language.The art of thinking. Translated from Greek into "the love for wisdom".French composer and pianist, known for his Gymnopédies and Gnossiennes.Fictional band, created by Blur frontman Damon Albarn and artist Jamie Hewlett....

1 Word Search 2026-01-20

42 Items: 23LAUREN: Ian! Ian! I have an idea!LAUREN: I told you! You were a great success![Lauren watches as Ian slouches onto his bed.]IAN: You have yourself a deal. Winner takes all![Lauren and Ian wait backstage at the talent show.]MOTHER: Ian, you’re running late. It’s time for breakfast!LAUREN: Do-re-mi-fa-sol-la-ti-do. DO-RE-MI-FA-SOL-LA-TI-DOOO....