behavior Word Searches

Manteca Day School 2019 / 20 2020-05-08

64 Items: DeanGillHartKaurRosaBlackFinchFrankGuptaHoodsMarieNancySousaCovertDudleyFablabFriendMarthaSeguraTeresaTorresVichetWhytryWrightAndradeKennedyMilerunBehaviorBookclubCeramicsDJFridayFielddayGameroomHomeroomTapeitupWegotyouAcademicsCareerdayDetentionHomiefadeKingsgameMdssweatsOpenhouseStormroomWaxmuseumAttendanceBrokenfootCounselingTurkeytrotWorkdetail...

3B vocab 2024-02-27

20 Items: rudeadviceapologyto harmbehaviorto judgeto praisecomplaintssuggestionunbearableforgive meto complainto apologisethe lack of...social networki cant stand itwrong impressionto pay attention, listento stop talking to each otherla voz to raise ones voice

Skill Search 2025-10-10

66 Items: FocusPrideLogicCaringDesireCopingHonestyRespectControlEmpathyCourageBalanceSympathyYeildingThinkingFairnessKindnessTeamworkNobilityNeatnessPatienceHumilityYearningResearchStrategyBehaviorListeningIntegrityAwarenessEnduranceJudgementEtiquetteKnowledgeGratitudeReflexiveReasoningWillpowerCreativityCuriousityDisciplineGenerosityMotivationTemperance...

k 2025-11-17

12 Items: — Kept private; not disclosed to others.— Step in and address the situation yourself.— A step-by-step method for handling an issue.— A tendency or prejudice that affects judgement.— Temporarily pause to assess safety or get help.— Differences among people that enrich a workplace.— Create a diversion to interrupt harmful behavior....

Week 14 Word Search 2025-10-31

10 Items: HatedPromoteTalent; abilityClearly; obviouslyImportant; criticalMake low, crying soundsDetermination; initiativeBurned a dead body to ashesPromotes the growth or development ofExperts who study the human mind and behavior

Discomfort Word Search 2023-10-03

7 Items: minor future moneyintense eustress sudden schoolstress alarm chronic copesupport hassle denial good...

Experimenting In The Unknown 2025-04-06

11 Items: First antibioticDeveloped the atomic bombItalian physicist discovered atomic fissionScottish scientist that discovered penicillinPolish-born French scientist that worked in radioactivityFreud’s method of studying the unconscious and its effect on behavior.Splitting of the nuclei of atoms in two to create a huge burst of energy...

Social Etiquette 2025-03-31

69 Items: TactHonorDecorumModestyDignityMannersDecencyRespectCivilityProtocolUrbanityCourtesyHumilitySubtletyPrudenceCeremonyChivalryBehaviorProprietyDeferenceEtiquetteFormalityPolitesseDiplomacyGallantryReverenceToleranceComposureObedienceGentilityEtiquetteDiscretionAffabilityDeportmentRefinementAmiabilityObligationCordialityObservanceCompliancyDiscretion...

1 2024-05-25

10 Items: The highest class of nobility and landed gentry.The highest circle of fashionable society in London.Conformity to accepted standards of behavior or morality.Grand hall where high society gathered for elegant dances.The class of landed property owners ranking below nobility.The traditional process of romantic pursuits before marriage....

All vocab 2024-02-09

73 Items: bugtryapexfeatlooptripetunicgenesuntilcandidrecedeslakesreposeholderplacidenigmateeterfringetiraderepeatpromptdefineprogramrummageassuageovationincensecommandpreparereflectbehaviorquagmiregumptiondecibelspedigreediscreetnebulousmediocrerenouncefunctionvariablefor-loopalgorithmdebuggingveraciousmandatorycontagionexpulsionpervadingevolutioninherited...

Religious Vocabulary 2025-05-15

10 Items: Judgement of what is important in lifeA follower or believer in a religion/causeNot connected or related to religion/religious beliefsThe beliefs/accepted standards of individuals or groupsAbrahamic, monotheistic, religious tradition, has a popeBehavior that is sanctioned or approved by particular groups...

The Bigger One 2022-09-30

72 Items: agendacinemaabandonabolishadviseralcoholarrivalarticleaveragebenefitcabinetcapitalcenturycharitycuriousdeficitdeliverdensitydepositdevelopabsoluteactivateallocateambitionapprovalaudiencebehaviorchemicalclassifycomputerconsidercreationcustomerdatabasedecisiondefenderdesignerdialoguedirectoradmissionadvantageadventureafternoonapartmentapplicant...

Recovery Word Search 2025-04-01

76 Items: GodpraymoodcalmplanPAWSlovebillwfocusfaithjoyousskillsfamilycopingstressstrongpurposesponsorsupportcontactfreedomhealingsuccesshonestysharinginsightreadingtherapyhopefulservicerecoveryemotionstriggerssolutionprogressdopaminethoughtsbenefitsbehaviorhumilityselftalkcravingspossibleserenitymeetingsaddictiontreatmentcommunityawarenessstabilityassertive...

gen alpha test 2025-09-03

20 Items: – Talking way too much– Flirty charm or smooth talking– Meme word for weird, cursed things– Something average or disappointing– Opposite of rizz; fails at flirting– Robotic or background character behavior– Doing something perfectly or confidently– Delusional, living in fantasy (but funny)– Nonsense meme trend with toilet characters...

Justice & Law 2024-01-12

9 Items: laws seek ______ order and clarityto treat someone in an honest and free-of-judgment waygiving evey person the opportunty he/she needs to reach a goalgiving every person the exact same opportunities to reach a goala purpose of laws; orders _______ by setting and dividing authoritya purpose of laws; orders _______ by establishing proper procedures...

English Vocabulary 2025-06-03

75 Items: TieBondFondGrowbackMindPeerRateAdoptCloseRivalTrustPhaseSkillStageEndureNatureRelateStableClumsyHeightMasterMatureMemoryPeriodRemindDevelopInheritNurtureSiblingAbilityAcquireConceptGestureImitateInfancyPatientToddlerConflictInstinctInteractMaternalParentalPaternalPregnantRelativeResembleAbstractBehaviorImmatureRememberTolerantAdulthoodCharacter...

Can You Finish This 2023-09-05

76 Items: asatbyaddageagoairallandanyarmartaskbadbutbuycanablealsoareaawaybabybackcalladmitadultafteragainagentagreeaheadallowalonealongamongapplyarguebeginbringbuildaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistbeforebehindbudgetcameraabilityaddressagainstalreadyanotherarticlebrotheractivityactuallyalthoughamericananalysisanything...

skz iconic lines 2023-11-26

32 Items: hani.nstaaafelixleeknowhyunjinbangchanchangbinseungmini'm.foivei’m.hungrywakey.wakeytch.hairbandi/love/darkeuice.creeeeeemstray.kiss.woohey/brownie/boyi/can/speak/koreanbangchan/is/so/oldthis/is/so..not.yummyinto/the/aloooooooooneoi.felix!come.here.broyour/behavior/is/so/ughamericano/joa/joa...joamy/lovely../ew/…memberstiny/hand...it's/so/tiny...

English Vocabulary 2025-06-03

75 Items: TieBondFondGrowMindPeerRateAdoptCloseRivalTrustPhaseSkillStageEndureNatureRelateStableClumsyHeightMasterMatureMemoryPeriodRemindDevelopInheritNurtureSiblingAbilityAcquireConceptGestureImitateInfancyPatientToddlerConflictInstinctInteractMaternalParentalPaternalPregnantRelativeResembleAbstractBehaviorImmatureLookbackRememberTolerantAdulthoodCharacter...

Acronyms 2023-11-16

20 Items: benefit Groupchild supportearned incomelong term carebehavior healthdate of serviceAccess to Recoveryfederal match codeAffordable Care ACTfair hearing BureauBureau Indian affairsdepartment of justiceBlue cross blur shieldAutomated teller machineindividual education planProtected health informationmedical assistance department...

Abrasive Word Search 2025-09-06

7 Items: intensely embarrassingto scold someone severelya shortcoming or imperfectionhaving several possible meaningsexhibiting hostility and combative behaviorusing only a few words to say something importantshowing little concern for people’s feelings; harsh

Week 9 Word Search 2025-09-04

10 Items: ObservationsAn understandingRecognize and admitRecognize; point outChallenge the accuracy ofReason for doing somethingCustoms of a group or communityVariety, as of groups or culturesCustoms, as of a social group or cultureGradual change in behavior to adjust to accepted norms in society

Workplace Incivility 2025-08-01

7 Items: What is essential for effective teamwork and open communication? TrustWhat is required for a group to work effectively toward a common goal? TeamworkWhat quality allows someone to understand and share the feelings of another? EmpathyWhat is the term for rude or unsociable speech or behavior in the workplace? Incivility...

Week 2 Academic Vocabulary Words 2 2023-11-05

8 Items: A long fightRolling over and overWhere a fight takes placeThin streaks of somethingMoves gently over somethingThin shapes that looks like featherTook a sharp breath in a surprised wayA time of great excitement and wild behavior

LFPL main library word search! 2024-07-23

15 Items: 641.5976.9Need help?Unlock thisDon't forget!Room in the basementWho built our libraryWhere to find microformA newer way of printingRules of behavior line 18Main Information ServicesMIS3 used to be home to thisSeven day checkout, no holdsVanessa Coleman is the expertWe originally shared a building with this Kentucky society

Invisibleaudience Word Search 2024-09-11

7 Items: Bigtrunkstripshas finscat with maineMan's best friendThe trail of informaitn avout us that we leave online. This includes the websites we visit, personal information, and our online behavior. It can heavily impact how other view us

Unit 5 ~ 6 for the 3rd graders 2022-11-08

86 Items: taxsonairbornfastleadsaltnewsporkcoatsoldbeefrupeefighttoughangryreachmarchchinaclothwastereadyglobetradedailylegacygandhipersonlawyerfreelyacceptunfairarrestcolonyalmostleadergrowthprettybeyondborderunusedsupplydonatedependimportdependrespectgreatlyprotestbillioninsteadimaginereceiveserviceviolencesidewalkmovementfollowerpeacefulpopulouspowerful...

Economics Department Word Search 2023-09-18

91 Items: taxwagerentdavistreessienalaborpricetrademandalbookerkirwanethicsincomewealthbubblebudgetsupplydemandmarketprofitimportexportsavingtariffpacittipovertycapitalrealgdputilitysurplusdeficitdasguptaequalitybehaviorquantityresourcersquaredcurrencyscarcityshortageshukrallakhatiwadaeconomicshappinessinflationasymmetryincentivecommunityrecessioninflation...

Deutsch IV Quiz 1.3 und 1.4 2025-09-14

25 Items: proofpublicsupportbehaviorto shrugto avoidimpoliteprejudiceunpleasantoriginallyeye contactcounterpartcitizenshipto feel tornsmile, smilingmisunderstandingto be in use, on dutyimmigration backgroundcustomary, normal, typicalto resume, proceed, continueto be understanding about sthto be embarrassing to someoneprivate life, personal privacy...

Find the words and learn them 2025-12-14

90 Items: fogviabandcoalwavyhailplotlackvastjudgestorefrankcarvewastesharplakesmeagerlyricsturnoncustomalmosttinselinvainlyricscottonbridgelookupputoutcinematakeonlookinloathenearbytightslookfornaughtywhereasbesidesworshipsupportdroughtleatherbesidestakeoffputawaybicycleEverestthirstyviolentqualityleisureharmfulmiraclesteppesmoreovertakeawayreliableprevious...

chapter 6 2023-05-22

40 Items: sadcalmlazycoldpainhappyangrytiredfevercoughpulsenurseenergypolitehealthstressdoctorannoyednervousconductmannersdynamicpatientto openbehaviorpancientstubbornpleasantheadachedepressedenergeticinpatiententhusiasmpersonalityopen-mindedsore throuthard-workingin a bad moodstomache achedoctors office

Animal Behaviors for Reproduction 2025-09-24

28 Items: One female mates with one maleOne male mates with multiple femalesOne female mates with multiple malesThe behavior patterns related to how animals mateAmphibian larvae that develop into adults without parental helpThe amount of time and resources given to the care of offspringSome animals migrate to a better environment for _____________....

Philosophy and Ethics 2025-04-14

10 Items: Epistemology : The study of knowledge—its nature, origin, and limits.Virtue : Behavior showing high moral standards or admirable qualities.Integrity : The quality of being honest and having strong moral principles.Autonomy : The right or condition of self-government or personal independence....

Workplace Incivility 2025-08-01

15 Items: Which word means having bad manners?What type of abuse involves words that cause distress?Which word means showing a lack of respect for someone?Which behavior involves refusing to acknowledge someone?What nonverbal gesture can indicate annoyance or disrespect?What word describes a tone or attitude that shows lack of respect?...

Room 30 Word Search 2025-11-14

100 Items: artAdambookmathgluedeskquiztestgametrayJordyYusufDaisyMercyBellaLlanaErikaDiegoswingslidecubbychartpaperrulerchairgradenursestorychalkpainteaseltimerLanderKaydenNathanCarlosEsthercrayonmarkerpencilrecesseraserfolderbindertabletbottleleaderhelperpickupanswerrewardpostercarpetDeborahSadiqinstudentteacherreadingwritingsandboxhallwaystickerscience...

Leached Word Search 2025-01-07

10 Items: unreasonably highprevented or turned awaychanged direction suddenlydissatisfaction with the situationpredicting what will happen in the futureunclear, inexact, or having double meaningan official order issued by a legal authoritygroup of people surrounding an important personsudden and unaccountable changes of mood or behavior...

Unit 3 2023-10-05

10 Items: My dad was f_______.she is a mean b_____.The movie was a______.The plan was a s_______.L______ we arrived in time.Don´t tell anyone your p_______.I don´t like sharing my c_________.I gave the deleveriy man a t______.Almin doesn´t have good b__________.he couldn´t solve the math homework because it was d___________.

Neurodevelopmental Disorder 2025-03-16

10 Items: - A condition that affects brain growth and function, often diagnosed in childhood.– A learning disorder that makes reading and spelling difficult despite normal intelligence.– A treatment approach that helps modify actions and responses, often used for ADHD and autism....

Roswell Pedo Word Search 2025-10-15

100 Items: PaJawLowEliPanoHighCoryToothTeethXraysLeydaStacyDentalParentCariesPlaqueScalerMirrorCrownsSpacerBracesMesialDistalBuccalFacialMolarsMissedDeniedTraumaDrLisaBlancaBrendaJeanneDentistPatientExploreSealantLingualIncisalCheckinAbscessMelanieEsbeydiYajairaAnxiousRoswellBehaviorCavitiesCleaningBleedingCalculusCavitronStainingFluorideExpanderRetainer...

4-5 grade 100 words 2025-10-27

100 Items: auditabruptassessbicepsboughtburialabdomenangrilyarmoredbandagebaptismbedrockbegrimeberserkbombardbonanzaboulderbreathebrutishbuffoonbulgingcalciumabrasiveabridgedacquaintactivateactuallyaddendumaerobicsairbornealarmistallocateamethystamputateanecdoteapproachbachelorbandannabankruptbarracksbaselinebecomingbegrudgebehaviorcarnivalcarouseladvantage...

ET 5 VOCABULARY 2025-02-03

100 Items: ofeathittaskplanbusyviewsavesafeverywalkrudetripeasyfarmshowliveparkcitynursecoachtraintrashshoutcheatqueuetruthupsetallowbringwritetradewatchvisitsincemusictowerdriverlistenontimeadvicehonestbehavefarmermarketplantsmosquetemplechurchmuseumstatueteacherbereadyprepareprotecthappilyrubbishchewgumcuriousrespectproblemsuggestconfuseopinionfactory...

Word Search 2025-03-11

100 Items: taxzooskyseadaypetbeelegssinkshipwrensocktankroomsignpearauntantsbabyplothairmealyearsailsodateamideadesktripbaittalkknotswimyardwinecaveprosesheetburstscaleskatebooksfleshnightforcewatchwatersteelscarfknifeactorskirtgeeseframesongschessgrainsnakequiltslopejewelcoughscenemusclesneezeattackpowderchancezephyrwealthcloverlocketbucketrecordmarbledegree...

Roswell Pedo Word Search 2025-10-16

100 Items: LowEliPanoHighCoryToothXraysLeydaStacyDentalParentCariesPlaqueScalerMirrorCrownsSpacerBracesMesialDistalBuccalFacialMolarsMissedDeniedTraumaDrLisaBlancaBrendaJeannyDentistPatientExploreSealantLingualIncisalCheckinAbscessMelanieEsbeydiYajairaAnxiousRoswellFlossingBehaviorCavitiesCleaningBleedingCalculusCavitronStainingFluorideExpanderRetainer...

67 Days of School 2025-12-05

70 Items: AtomDataPlotCellForceThemeEnergyMotionPlanetGalaxySystemAlgebraBiologyPhysicsIntegerDecimalHabitatGravityWeatherClimateErosionVolcanoCultureHistoryEconomyPolygonFictionGrammarSettingProblemDigitalCircuitProteinNervousGeometryEquationVariableFractionOrganismMoleculeVelocityUniverseLatitudeResearchSentenceConflictSolutionBehaviorChemistryEcosystem...

"Expectations" Word Search 2025-09-07

16 Items: avoid __ __be ready to __be __ to learnbe __ __ to classraise your hand to __bring all __ materialsbring all necessary ___listen when others are _____ when others are speakinguse kind, ___ language in classtreat others with kindness: Be ___Put in your best ___ on all assignmentsfollow ___ the first time they're given...

Roswell Pedo Word Search 2025-10-15

100 Items: PaJawLowEliPanoHighCoryToothTeethXraysLeydaStacyDentalParentCariesPlaqueScalerMirrorCrownsSpacerBracesMesialDistalBuccalFacialMolarsMissedDeniedTraumaDrLisaBlancaBrendaJeanneDentistPatientExploreSealantLingualIncisalCheckinAbscessMelanieEsbeydiYajairaAnxiousRoswellBehaviorCavitiesCleaningBleedingCalculusCavitronStainingFluorideExpanderRetainer...

Recovery 2022-10-15

12 Items: non-use of any addictive psychoactive substance.A dysfunctional state resulting from the use of psychoactive substances.A state in which an increased dosage of a psychoactive substance is needed to produce a desired effect.A process of withdrawing a person from a specific psychoactive substance in a safe and effective manner....

Neurodevelopmental Disorder 2025-03-16

10 Items: Disorder- A condition that affects brain growth and function, often diagnosed in childhood.– A learning disorder that makes reading and spelling difficult despite normal intelligence.– Teaching individuals and families about a disorder to improve understanding and coping strategies....

The Olympics 2025-02-27

15 Items: a country’s official songsomeone who is in the same team as yousomeone who competes in sports competitionssomeone who has won a medal in a competitionto achiehe best result in a sport, competition, etc.fair, honest, and polite behavior in a sports competitiona small platform on which someone stands in front of an audience...

Workplace Incivility 2025-11-29

4 Items: Disrespectful behavior that harms teamwork and safetyExhaustion caused by chronic workload and stress in nursingA structured communication tool that reduces miscommunicationEthical responsibility to act, speak up, and support a respectful workplace

First Semester Psychology Vocabulary Word Search 2024-01-08

106 Items: biaslenspupilsensetheorysurveysampleethicscortexretinaplaceboNeuronsneuronscochleaclosurebehavioramygdalaprinciplecasestudyvariablessensationthresholdthresholdblindspotproximitypsychologyconstructshypothesisreplicatedcerebellumspinalcordperceptionadaptationafterimagegatetheorysimilaritycontinuitycommonfateassociationbehaviorismcorrelation...

Public Health Word Search 2025-02-22

8 Items: What acronym is frequently used to help develop outcome measures?What stage involves the behavior having been changed and sustained over time?What term describes factors that promote or facilitate behavior based on availability?What role do school nurses serve in relation to children and families, ensuring their health needs are addressed?...

Vocab 4 word search 2025-09-25

20 Items: indisputableto put up withharsh criticismto pass on, giveextremely skilledto soften in temperto stick to somethingincorrect, misleadingan emotion of sympathyquiet, modest, reservedvaried, diverse in characterbrief and direct in expressiondeceitful, cunning, sly behaviorto wipe out, obliterate, rub awaylogically consistent, intelligible...

Late 19th Century vocabulary 2023-03-16

12 Items: complete avoidance of alcoholbusiness that rewards loyaltylimiting the earth's resourcesdishonest or deceitful behaviorowner of a manufacturing businesssomeone that invests in a new businessto deprive someone of the right to votecitizens proposing a new law by petitiongive variety and difference to something...

. 2025-05-20

105 Items: CartelBurglarCautionCustodyFreedomJusticeMarshalProbingAssaultsAttorneyBehaviorBombingsBorderedBriefingCitationCoercionCriminalDetaineeDetainedDistrictEnforcerEvidenceFeloniesFirearmsFugitiveHandcuffHarassedHomelandHomicideImmunityIntercomInvestedJudicialLawgiverLawrenceLegalityManpowerMistrialMobstersOffenderOfficersParoleesPerjuredPrecinct...

Incivility Word Search 2025-11-26

4 Items: What improves when nurses feel valued and supportedA standardized communication tool used to reduce miscommunicationA negative outcome linked to understaffing, stress, and workplace incivilityDisrespectful low-intensity behavior that disrupts a healthy work environment

CAFFEINE AND CANINES 10/20/2023 2023-10-20

26 Items: RetrieveA dogs kneeA dogs ankleA dogs “fangs”Most famous dogThe third eyelidA pattern of footstepsmost popular male dog nameBroad head with short muzzlenarrow head with long muzzleMost popular female dog nameblack or blue patches on whiteThe flesh of the lips and jawsMost popular dog breed of 2023An extra claw on the inside of the leg...

CAFFEINE AND CANINES 10/20/2023 2023-10-20

26 Items: RetrieveA dogs kneeA dogs ankleA dogs “fangs”Most famous dogThe third eyelidA pattern of footstepsmost popular male dog nameBroad head with short muzzlenarrow head with long muzzleMost popular female dog nameblack or blue patches on whiteThe flesh of the lips and jawsMost popular dog breed of 2023An extra claw on the inside of the leg...

Vocabulary - 8A 2024-02-13

10 Items: All parts as a whole.A thing that may be chosen.A way of exchanging information.Easily understood or clear to tell.A limitation or restriction to something.A person engaged in a specified activity.A state of being different from something else.A discussion on a particular topic with others.A way of feeling shown through someone’s behavior....

ELA Word Search Quarter 1 (Shea and Keea) 2025-12-10

9 Items: Subjectivethe state of being successful and wealthy.a change that results from a specific action.to become aware of consciousness of something.to have an influence upon, to make a difference.talent, skill, or proficiency in a particular area.a person's nature, especially as it permanently affects behavior....

LOTF Vocabulary Review 2025-11-07

20 Items: To overcomeImportant; famousTo greatly horrifyHesitating or doubtingProper behavior; etiquetteAble to be seen or noticedUnable to be felt by touchTo provoke or annoy someoneAttempting to avoid attentionA feeling of intense annoyanceStraying from the proper courseUnderstood without being spokenRambling from subject to subject...

El Deafo 2025-04-14

8 Items: Very tiring (starts with 'e')Very annoying or rude (starts with 'o')Right or proper behavior (starts with 'a')Easy to see or understand (starts with 'o')Words on the bottom of the screen (starts with 's')Talks or exchanges between people (starts with 'c')In a way that is too much or showy (starts with 'd')...

Vocab Test 33-36 12/06/2025 2025-06-11

10 Items: To gain possession of something.To bring to completion or reality.Decrease in vigor, power, or extent.To stop oneself from doing something.Became less intense, violent, or severe.To be in an upright position on one's feet.Given or granted as a prize, reward, or honor.An innate, typically fixed pattern of behavior....

YLS3 practice 2025-07-06

10 Items: At first; in the beginning.Very unusual, special, or amazing.Wide; covering a large area or range.A person who trains people in sports.Feeling happy or satisfied about something.To understand or become aware of something.Happy and showing it in your behavior or voice.To move or make something move over a larger area....

Lesson 13 2023-11-15

6 Items: I will study for at least one hour every day before dinner is an example ofA type of rule governed behavior that is under control of socially-mediated consequenceWhen cooking, you might follow a recipe that tells you to preheat the oven to a certain temperature is an example of...

Thunderhawk Pledge 2025-08-26

17 Items: our principalpublicly displayour school mascotour male counseloryou are all ______our female counselorour male vice principalour female vice principala solemn promise or undertakingthe state or fact of having a dutyrelating to education and scholarshipshowing regard for abilities and worthrequired or expected to justify actions...

Module 1 Vocabulary 2025-08-13

14 Items: Clearly or obviously.To form an idea or plan.The act of increasing speed.To be very good at something.A sudden urge to do something.A bit odd or unusual in behavior.Going beyond a limit or boundary.Having strong emotions or feelings.Famous and respected due to achievements.To hold someone in high regard and respect....

Cat Word Search 2024-10-10

8 Items: Battery-operated vaping device.Plays a role in memory and learning.The primary addictive chemical in tobacco.Is the residue left after tobacco is burned.Smoking tobacco is the leading cause of this disease.This increases consumption and reinforces the addictive behavior.Hand-rolled tobacco in a tamburi leaf tied with colorful strings on its ends....

Great Expectations Vocab 2 2023-02-05

20 Items: guessagreeshamefulgenerousgloomy; sadquarrel; fightable to be seenlack of self-interestcondition; requirementto assume an air of superioritystrong dislike causing one to turn awayexpressing suffering or woe; melancholyskillful and competent with hands or mindto put into a state of embarrassment and unease...

Economics Chapter 2 2025-06-10

20 Items: Goods produced for current consumptionStatement which describes the world as it isGoods that help produce other valuable goodsUsing resources to create or buy new capitalConsumers can only partially adjust behavior.Statement which describes how the world should beCosts that you've already paid and can’t get back....

CJ 1 Chapter 2 Vocab 1 2023-06-23

11 Items: group exhibiting certain valuessociety creates crime and criminalstreats drug abuse as a mental illnesscriminal who commits multiple offensescriminal laws are designed by those in powerdrug offenders harm society by their actionsthoughts and actions are attributed to unconscious motives...

Vocab 2023-01-21

10 Items: quiet and modestinequality; differencelacking self-confidenceextremely poor; lacking food & shelterone who studies an art or science for amusementto express disapproval of; to depreciate one’s efforta difficult choice, especially one between two alternativesconformity to accepted standards of conduct; proper behavior...

Vocab 2023-01-21

10 Items: quiet and modestinequality; differencelacking self-confidenceextremely poor; lacking food & shelterone who studies an art or science for amusementto express disapproval of; to depreciate one’s efforta difficult choice, especially one between two alternativesconformity to accepted standards of conduct; proper behavior...

CZSD 2023-06-26

2 Items: ANXIETY, SELF ISOLATION, ADDICTION, MOODY,CHASING LOSSES, SUBSTANCE USE, LYING, SKIPPING SCHOOL, GRADES SLIPPING, CRIMINAL BEHAVIOR, WITHDRAWAL, ZONED OUT

Dns Word Search 2025-06-20

15 Items: Converts web addresses to IPsProject management methodologiesOverall experience and usabilitySystem to track changes (e.g., Git)Designing for mobile before desktopCode that is free and shared publiclyImprove code without changing behaviorService that stores your website onlineVisual elements the user interacts with...

Unit 3 Vocabulary Word Search 2025-12-08

17 Items: successfulan armed forceto hold ruling powermade with great detaila rule or code of conductfor the most part; mainlyto take control of somethinga large number of people or thingsa moral, legal, or mental obligationbehavior showing high moral standardsa type of government where the people rulea community of people with common traditions...

Manteca Day School - Challenge 2020-05-08

125 Items: AlanLinoGabeAbelDeanGillHartKaurRosaEdwinGavynKiaraCoreySohilAllanEmilyAndreTiaraArleeJesseRamonBlackFinchFrankGuptaHoodsMarieNancySousaMartinJohnnyJaylonLeyvasJasperAlyssaStevenSamuelDanielJaymonJerretIsaiasAQuoriEdwardCovertDudleyFablabFriendMarthaSeguraTeresaTorresVichetWhytryWrightAriannaMatthewAhlanahYahsiahBrandonBraulioMikaylaGabrielTristan...

Descriptive Words, IV 2025-04-17

10 Items: friendly and cheerfulenough or more than enoughchosen without method or conscious decisionshowing or having skill, especially with the handsfamous or well known, typically for some bad qualitybelieving that people are motivated purely by self-interest(of an argument or statement) seeming reasonable or probable...

Body Positivity 2024-07-22

15 Items: Physical power and enduranceThe ability to bend and adaptEnergy and enthusiasm for lifeAbility to recover from setbacksBelief in one’s abilities and worthEmbracing one’s body and imperfectionsFeeling of being in control and confidentA feeling of great pleasure and happinessElegance and poise in movement or behavior...

Shakespeare - Impact on Language 2025-08-01

15 Items: "Blue."Iambic pentameter.A group of singers.English playwriter and poet.Main events that in a story.Conversations between characters.An indirect reference to a person.A long speech given by a character.A joke exploiting different meanings.Brief instructions followed by actors.Things that happen in a play or story....

CAFFEINE AND CANINES 10/20/2023 2023-10-20

31 Items: RetrieveA dogs kneeA dogs ankleA dogs “fangs”Most famous dogThe third eyelidA pattern of footstepsMy coonhound mix’s namemost popular male dog nameMy senior Yorkie dogs nameBroad head with short muzzlenarrow head with long muzzleMost popular female dog nameMy blonde shepherd dogs nameMy white and Brown dogs nameMy brindle pit bull dogs name...

Final E Syllables 2024-02-13

10 Items: Was my uncle _____ in the head count?I wish I knew how to play the _____ .She _____ my space and it made me upset.I hope to go to an _____ park this summer!My favorite candy are the _____ sour warheads.Please take my _____ and listen to your teacher.Kobe was an amazing _____ before he passed away.I hope the bad behavior will _____ more in class....

Latin and Greek Word Roots 2025-04-14

10 Items: Soph : Wisdom, knowledge, and insight.Anthrop : Human, relating to humans or mankind.Phil : Love, affection, or fondness for something.Bibli : Book, pertaining to books or written works.Chron : Time, relating to time or chronological events.Metri : Measure, relating to measurement or dimensions....

Manteca Day School - Challenge 2020-05-08

123 Items: AlanLinoGabeAbelDeanGillHartKaurRosaEdwinGavynKiaraCoreySohilAllanEmilyAndreTiaraArleeJesseRamonBlackFinchFrankGuptaHoodsMarieNancySousaMartinJohnnyJaylonLeyvasJasperAlyssaStevenSamuelDanielJaymonJerretIsaiasAQuoriEdwardCovertDudleyFablabFriendMarthaSeguraTeresaTorresVichetWhytryWrightAriannaMatthewAhlanahYahsiahBrandonBraulioMikaylaGabrielTristan...

Manteca Day School - Challenge 2020-05-08

126 Items: AbelAlanDeanGabeGillHartKaurLinoRosaAllanAndreArleeBlackCoreyEdwinEmilyFinchFrankGavynGuptaHoodsJesseKiaraMarieNancyRamonSohilSousaTiaraAlyssaAQuoriCovertDanielDudleyEdwardFablabFriendIsaiasJasperJaylonJaymonJerretJohnnyLeyvasMarthaMartinSamuelSeguraStevenTeresaTorresVichetWhytryWrightAhlanahAndradeAriannaBrandonBraulioCelesteGabrielKennedyMatthew...

CAFFEINE AND CANINES 10/20/2023 2023-10-20

31 Items: RetrieveA dogs kneeA dogs ankleA dogs “fangs”Most famous dogThe third eyelidA pattern of footstepsMy coonhound mix’s namemost popular male dog nameMy senior Yorkie dogs nameBroad head with short muzzlenarrow head with long muzzleMost popular female dog nameMy blonde shepherd dogs nameMy white and Brown dogs nameMy brindle pit bull dogs name...

Unit 1 Vocabulary MHT 2025-09-04

10 Items: EthosSynergyMicromanagementA general agreement reached by a group after discussion and collaboration.Uncertainty or unclear situations where multiple interpretations are possible.A leadership style where one person makes all decisions with little team input.The ability to make decisions and work independently without constant supervision....

Premonition Word Search 2024-04-26

12 Items: Frame of latA kind of fauscetTo create art in the bodymy granddaughter in spanishA heads up warning in advanceOutward behavior that isn't the bestA short jacket with no sleeves for girlsAnger by small things that by something unjustA large or a unknown size that isnt very reccongizableA sweet syrupy texture type of alcohol used as a solvent...

King Word Search 2025-12-15

10 Items: - being nice and caring to others.- a hopeful idea about a better future.- treating everyone the same and being just.- a person who helps guide and teach others.- the right to live, speak, and learn equally.- a talk given to share ideas with many people.- showing care and good behavior toward others....

Adjectives for My favourite sportsperson 2024-07-07

19 Items: Showing controlled behavior.Free from errors or mistakes.Having a strong desire to win.Full of energy and enthusiasm.Relating to detailed planning.Certain about one's abilities.Concentrated on a task or goal.Having great strength or force.Able to move quickly and easily.Skilled in planning and tactics.Able to adjust to new conditions....

Body Positivity 2024-07-21

14 Items: Physical power and endurance.Energy and enthusiasm for life.Ability to recover from setbacks.Belief in one’s abilities and worth.Embracing one’s body and imperfections.Feeling of being in control and confident.A feeling of great pleasure and happiness.Elegance and poise in movement or behavior.A quality that gives pleasure to the senses....

Tic Tac Toe 2022-09-07

5 Items: the fact or condition of being accountablethe state or of having a duty to deal with somethingthe mental and moral qualities distinctive to an individualmoral principles that govern a person's behavior or the conducting of an activityan occupation undertaken for a significant period of a person's life and with opportunities for progress

Chapter 4 Word Search 2023-05-12

20 Items: Fail to care for properlyFree from outside controlFailure to take proper careLack of respect of courtesyMaking false spoken statementsUsing finances inappropriatelyBeing worthy of honor or respectUnacceptable or improper behaviorKeeping something secret or privateActs which do not suit one's statusMoral principles that govern conduct...

Criminal Minds 2025-02-24

133 Items: baufbiunsubcluesalibichasetrialmotiveserialkillerenigmatraumashadowritualmalicepoisonescapemanhuntsuspectprofilemysterypatternmindsetanomalyjusticeinsightremorsehostageculpritautopsyparadoxcrueltyinquiryevasionjoyrossicatadamsiandoyleevidencebehaviorcasefilecriminalparanoiainsanityderangedstrategydistressconflictanalysisoffenderimposterdisguise...

Culture Word Search 2023-11-07

23 Items: - Belief in one God- Belief in many gods- growth to a global or worldwide scale- gender roles that are less restrictive- A restriction on behavior imposed by social custom.- the physical things created by members of a society- Central to a society and it helps to compare societies- the visible imprint of human activity on the landscape...

Body Positivity 2024-07-21

15 Items: - Physical power and endurance.- Energy and enthusiasm for life.- Ability to recover from setbacks.- Belief in one’s abilities and worth.- Embracing one’s body and imperfections.- Feeling of being in control and confident.- A feeling of great pleasure and happiness.- Elegance and poise in movement or behavior....

Technical words - 3 2025-06-20

15 Items: Converts web addresses to IPsDesigning for mobile before desktopCode that is free and shared publiclyScrum Project management methodologiesImprove code without changing behaviorService that stores your website onlineLayout adapts to different screen sizesA computer that hosts and serves a websitecontrol System to track changes (e.g., Git)...

Tiny Love Stories 2025-11-06

15 Items: a short job historyfree, not held back.a small, happy laugh.steady, not changing.very beautiful or amazing.very beautiful or attractive.a long, narrow part of something.skill in using your hands or body.deep respect for someone or something.to expect or look forward to something.the ability to follow rules or control your behavior....

Specialized Crimes 2024-11-13

25 Items: to provoke or mockbelief in a system of faithphysical or mental impairmentgroup sharing the same culturepersonal concept of one’s own gendergender to which a person is attractedperiod of supervision over an offenderformal letter expressing disapproval or criticismtouching someone against their will or without consent...

Vocabulary Word Search 2025-10-03

14 Items: Definition: to hate (Abhor)Definition: chaotic (Tumultuous)Definition: promote an idea (Propagate)Definition: extract information (Glean)Definition: found everywhere (ubiquitous)Definition: to leave something out (Omit)Definition: to exclude someone (Ostracize)Definition: a warning / limitation (Caveat)...