animals Word Searches

Primary Economic Activities 2025-04-10

26 Items: – Renewable energy from heat inside the Earth.– Rain, snow, sleet or hail that falls from clouds.– Planting trees to replace those that were cut down.– A type of farming that involves both crops and animals.– Catching too many fish, faster than they can reproduce.– Resources that will not run out, like sunlight and wind....

APES Unit 9 2024-04-25

10 Items: Problems with coaloil is energy _______comes from dead animalsCarbon dioxide is a _________forms with lower temperaturescomes from dead plant materialCheaper version of coal miningseparate crude oil into usable partsFossil fuels use ______ to release thermal energymuch of the NOx and SOx are removed by combining them with other substance

Ares Word Search 2025-11-10

10 Items: A God of musica God that controls warA God of war and wisdomA God that controls waterA God that sends messagesA God that controls lightingA God of hunting and animalsA God that controls celebrationA place where they worshiped the godsA God that controls fields and farming

Animals for Jorge in Albas Spelling List 2026-02-08

13 Items: DeerGoatHareWormGooseHorseSheepSkunkSnailCattleParrotLeopardPanther

Animals for Jorge in Albas spelling List 2026-02-08

13 Items: DeerGoatHareWormGooseHorseSheepSnailSkunkCattleParrotLeopardPanther

trs 5b w17 pt1 2022-06-06

10 Items: adj.dark placen.what people knowv.put things in a bagv.put something on a hookn.a person who is not freen.for example rice,wheat,oatsn.food made from cooking oats in waterv.get away from something dangerous, get outn.trees, plants, oceans, wild animals, mountainsn.a kind of small vegetable, e.g. red, black, yellow, green

Spelling Week 4 2022-09-03

10 Items: Kuro is very fat.I'll sit over there.It is hot in August.Our cat is named Inu.The jet is very fast.I like to pet animals.The peach had a giant pit.I wanted to go but couldn't.Mommy likes to call me a nut.The lot is over at the corner.

Unit 1 Weeks 1 & 2 Wonders Vocabulary 2024-09-17

8 Items: to show a signan unexpected meetingsteep, like the face of a cliffvery impressive; exciting to seethe scattered remains of somethingspecial force used when saying a particular wordfamily in the same era who have a common ancestora person studies things in nature (plants & animals)

'sure' words 2025-10-14

8 Items: Feeling pleased.Pirates love this.Time to relax or have fun.Zoo animals live in these.We might use a ruler to do this.What you are showing when you are calm.When you push on something you create this.When you feel that something is properly finished.

Most popular animals owned as pets in the US 2021-06-28

52 Items: DogFoxPigBeeOwlCatsFishGoatDeguWolfDuckPonyMouseHorseGeckoFrogsZebraLLamaSnakesParrotDragonGerbilSnailsTurkeyBudgieServalTurtlesLizardsRabbitsFerretsFinchesBeardedChickenHamstersParakeetCapybaraStarfishSquirrelCockatielCockatoosLovebirdsHedgehogsButterflyTeacupPigScorpionsGuineaPigsChinchillaHermitCrabChimpanzeePrairieDogSalamanderSugarGlider

3) FIND SIX ANIMALS AND SIX ABILITIES 2025-06-30

12 Items: CATDOGRUNFLYBIRDFISHSWIMJUMPKOALACLIMBCRAWLELEPHANT

Our Environment 2023-10-10

15 Items: Bodies of flowing water.Channeling waste into open sea.An overflowing of water onto land.The land near a shore where water and land meet.The method of providing water to dry land for farming.The action of making an environment impure or unclean.Forest with tall trees that are found in places near equator....

Unit 6 Seasons and adaptions of plants and animals 2024-06-18

28 Items: fintiltyearthawwaxypackorbitadaptgillsresinthornvenomseasonsunsetburrowquillsellipserevolveellipsedormantsunriseteamworkmigrationhemisphereadaptationcamouflagechlorophyllhibernation

UNIT 12 2023-12-15

12 Items: devouring.eating only plants.able to be influenced.rhythmic rise and fallseizing everything, greedy.able to be noticed or felt.feeding on both animals and plants.giving total attention to, captivated.hidden or secret, done without notice.an idea important to a system of beliefssomething or someone injured, killed, or eliminated....

SOME ANIMALS 2024-07-05

6 Items: BROWN LIONYELLOW MONKEYBLUE CHAMELEONGREEN ALLIGATORAND YELLOW KANGAROOBLACK AND WHITE PANDA

Unique Animals of the South American Rainforest 2023-09-22

12 Items: coatitapirmacawocelotagouticaimanmanateekinkajoucapuchincapybaraanacondajaguarundi

ANIMALS AND ONE SPECIAL WORD 2021-03-30

7 Items: catdoglionzebrahippoelephantHAPPYBIRTHDAY

Animals in Alphabetical Order ABC Order from A-Z 2020-05-22

27 Items: YakDeerFishNewtCamelEagleGeckoQuailX-RayTetraZebraBadgerIguanaJaguarParrotRabbitHamsterLadybugManateeOctopusTermiteVultureWallabyAardvarkKangarooScorpionUmbrellabird

Animals of the Woodland Park Zoo word search fix 2025-07-17

21 Items: LionOryxOtterTapirLemurZebraJaguarToucanGiraffeGazellePenguinGorillaSiamangLeopardFlamingoTortoiseOrangutanPorcupineRhinocerosConstrictorHippopotamus

Animals found on Dangberg Home Ranch 2025-04-03

9 Items: CowsDogsHogsOwlsSheepEaglesHorsesSkunksChickens

Endangered Ethiopian Animals 2016-02-16

4 Items: WildDogNubianIbexGrevy'sZebraMountainNyala

Animals and stuff 2024-11-08

4 Items: dogcatpotatoanimal

Ethiopian Endangered Animals 2016-02-27

4 Items: NubianIbexGrevyZebraEthiopianWolfMountainNyala

WORD SEARCH - ANIMALS 2025-06-27

4 Items: COWPIGGOATCHICKEN

3rd Advanced U8 - Criminals Word Search 2025-11-23

8 Items: A criminal who kills peopleA criminal who tricks peopleA criminal who steals from a shopA criminal who steals from a bankA criminal who steals from a houseA criminal who hunts animals illegallyA criminal who steals from people's pocketsA criminal who attacks people in a public place

*SERINA* 2023-04-03

100 Items: mapadadfunkaimaxmomauntbethboascakecathenzogabyhillleahpetsaprilchanudaisyesteefolksinarikiddolizzylouisminkymulkenigelpizzasandysweetterryuncleantheaballetcanadacanapécaringdreamsdrinksfuturegenzeegeorgegivinggrowthhowzitjoyouskieranlekkerlovingnaturepointepurplesereneserinasistersquashtraveltrevonanimalsavocadobrothercarolyncousinsfreedomgrandad...

100 Days of Learning 2026-01-21

100 Items: PEbusArtTagTryMathGlueDeskTimeStarMusicLunchKruerBooksChairpaperTestsnamesMoneySmileSmartProudFocusLearnCountSchoolRecessShapesGraphsPlantsTigersReadingWritingLibraryFriendsTeacherPencilsCrayonsMarkersFoldersQuizzesPhonicsGrammarStoriesWeatherAnimalsHistoryIndianaRespectHonestySharingHelpingclassesfundays100DaysNumbersSciencePrinterJournalLearning...

Water Word Search 2026-03-13

101 Items: orushowdidmanwhorancatneweatourtwohasyesdogfoxwayredseaboybedmaysaycarawaygoodwantovertookhomeknowbearlongplaytakewellfindmoreI’lltreefoodbeenstopmustdoornextworklotsneedbabyfishgavelivesoonheadkingtownI’vewatergoingwherewouldthinkcan’tagainafterroundmagicotherrightthesebeganneverfirstmousestillfoundnightsmallthreeeveryUriahschooldidn’tthingswanted...

History & Wildlife Conservation 2024-01-17

27 Items: value to earn moneyfirst national parkfather of soil conservationpublished a book about birdssystem of safe wildlife areaspart of USDA to manage forestsvalue to enjoy wildlife's beautyfather of the conservation movementpopulation is close to becoming extinctthe use of natural resources for profitpopulation is close to being endangered...

ANIMALS AND ONE SPECIAL WORD 2021-03-30

7 Items: catdoglionzebrahippoelephanthappybirthday

Endangered Ethiopian Animals 2016-02-28

4 Items: NubianIbexGrevyZebraEthiopianWolfMountainNyala

One word for a phrase 2025-08-13

10 Items: Easily brokenHappens every yearA place with gamblingThe study of living thingsPerson from another countryA professional rider in horse racesPerson related by blood or marriageAnimals that live both in water and on landA person who looks on the bright side of thingsA person who pretends to be something they are not

Morphology Week 3 2025-02-02

7 Items: near or close to.under + to stretcha community of plants and animals.not + free from + care + quality of beinglife + apart/different + turn + quality of beingan atom or group of atoms with an electrical charge.a statement about what the possible result of an experiment might be.

Spelling 6 2024-03-27

10 Items: opposite of shortthe opposite of pushanother word for nicethe solid form of waterthe eighth month of the yearused to make windows and cupspart of an animals foot, especially catsa mineral used in jewelry, like a diamonda small round piece of metal used for moneyparts of the body muscles connect to (plural)

Plate Tectonics 2025-12-05

10 Items: Ring of Fireplate landplate OceanSan Andreas fault earthquakeLocation where two plates move apartarea where magma is close to the crustLocation where two plates hit each otherimprints of ancient plants or animals in rocksWegener who thought that the continents fitspreading when a new rock forms, mid ocean ridge

Week 5 Vocab 2025-07-30

10 Items: a great amount or quantity of.at that time; at the time in question.flat and smooth / equal in number, amount, or value.the sharp explosive cry of certain animals, especially a dog, fox, or seal.a building or part of a building where goods or services are sold; a store.exert force on (someone or something) so as to cause movement toward oneself....

Greek Root Words Week 3 2025-09-09

10 Items: To link withVery sensitiveExtremely activeHaving the same centerA real story, not fictionA person who does not speakTo come together with a purpose, a meetingSomething that can take different forms/shapesWords with same pronunciations, but different meaningsAn organism that cant produce its own food; relies on different animals for food

Abiotic Word Search 2024-07-31

100 Items: dnagpsboabdatadensfirefoodpupsalgaeclamscoralcrabsdingodunesfangsfungijoeyskoalanestsoceanriversharktoxictrapstreeswateralpinebioticdesertdronesdugongforestmagpiemarinenumbatplantspossumpythonspiderspinestaipanwattlewhaleswombatabioticanimalsbanksiaburrowsestuaryflowershabitatoctopuspugglessensorsshelterviruseswallabychemistseucalyptkangaroo...

Flower Word Search 2025-12-30

100 Items: IceJobFunBlueArtsKindNiceKidsColdCuteFoodCakeSodaBeerBestWaterJuiceCardsPaintGamesBraveQuietMusicCrownQueenBirthLunchPizzaPollsFunnyHouseCrocsShoesCleanTreatFlowerLovingMotherPrettyCanvasStrongPartysInsideFamilyCarverDinnerHotelsMesserCollarPeopleLasagnaHealthyLettersHusbandFriendsClassesBedroomHolidayAmazingNappingTakeoutPotatosChickenPuzzles...

Goal 14: Life Below Water (100 Words) 2025-11-17

100 Items: PaySeaCareDeepDiveFishFoodHelpHopeLifeLookMeetPlanSafeSaveSwimWaveCleanCoastColorCoralEarthFreshOceanShareShineWhaleWaterAccessChangeCreateMarineNatureStrongCarbonReduceThriveReformGlobalEngageFutureGrowthEthicsAnimalsAquaticCurrentProtectSupportSpeciesMonitorHabitatPreventHealthyEnhanceConnectRespectSupportActionsHarvestEconomyDeclineConserve...

Ava's Animal Rescue Birthday Bash 2026-01-01

100 Items: AVABEDCATDOGFURJOYPAWPETVETWAGBARKBONECARECATSDOGSFEEDHELPHOMEHOPEKINDLIFELOVEMUTTNOSEPAWSPETSPLAYSAFESAVESOFTSPAYTAILTOYSVITOWALKWOOFADOPTASPENBOWLSCLEANHEARTIDTAGLEASHLICKSPUPPYSAVEDSMILETRAINTRUSTWATERCOLLARDONATEFAMILYFOSTERFRIENDHUMANEKITTENNEUTERRESCUESENIORTREATSWARMTHWILLOWANIMALSANSTINEBLANKETCOMFORTHEALINGHOUSINGKITTENSMEDICALNURTURE...

Classification Word Search 2026-01-09

8 Items: Organisms w/o a nucleus.The name of “our” domain.Science of naming or classification.The “Father” of the science of naming.Kingdom known as containing decomposers.Another way to refer to a scientific name.Kingdom where cells have walls made of cellulose.Scientist who first separated organisms into 2 groups (plants & animals).

💖 2024-12-10

99 Items: appleoceanbananaorangegrapespencilgardennaturesoccertennisjunglesunsetbridgefarmercarrotteacherstudentfriendssciencelibrarykitchenanimalsrainbowpictureholidaystationvillageislandsvolcanohistoryjourneylaundrybicycleplayingjumpingdancingcookingdrawingreadingwritingsingingrunningwalkingballoonpajamassandalsbedroomsunrisemorningeveningweekendweekday...

100-Words! 2025-05-11

100 Items: IceJobFunBlueArtsKindNiceKidsColdCuteFoodCakeSodaBeerBestWaterJuiceCardsPaintGamesBraveQuietMusicCrownQueenBirthLunchPizzaPollsFunnyHouseCrocsShoesCleanTreatFlowerLovingMotherPrettyCanvasStrongPartysInsideFamilyCarverDinnerHotelsMesserCollarPeopleLasagnaHealthyLettersHusbandFriendsClassesBedroomHolidayAmazingNappingTakeoutPotatosChickenPuzzles...

Ethans Word Search 2025-10-09

100 Items: sunseaecoiceairlifetreebirdwildlandpondrainfishfirelavaparksoilfoodkindfloraoceanrivercloudgreengrasswoodsbeachhumanfrostcometworldalgaespacelemurwaterparksgardenplantsspringflowerplanetnatureanimalcosmosfungusbeautyfloraljungletrailsearthyliquiduniquewinterspirithikingfaunasmammalstreamnaturalanimalsnurtureglacierweathertornadoseasonshabitat...

Goal 14: Life Below Water (100 Words) 2025-11-17

100 Items: PaySeaCareDeepDiveFishFoodHelpHopeLifeLookMeetPlanSafeSaveSwimWaveCleanCoastColorCoralEarthFreshOceanShareShineWhaleWaterAccessChangeCreateMarineNatureStrongCarbonReduceThriveReformGlobalEngageFutureGrowthEthicsAnimalsAquaticCurrentProtectSupportSpeciesMonitorHabitatPreventHealthyEnhanceConnectRespectSupportActionsHarvestEconomyDeclineConserve...

Adopt Word Search 2026-01-02

100 Items: AVABEDCATDOGFURJOYPAWPETVETWAGBARKBONECARECATSDOGSFEEDHELPHOMEHOPEKINDLIFELOVEMUTTNOSEPAWSPETSPLAYSAFESAVESOFTSPAYTAILTOYSVITOWALKWOOFADOPTASPENBOWLSCLEANHEARTIDTAGLEASHLICKSPUPPYSAVEDSMILETRAINTRUSTWATERCOLLARDONATEFAMILYFOSTERFRIENDHUMANEKITTENNEUTERRESCUESENIORTREATSWARMTHWILLOWANIMALSANSTINEBLANKETCOMFORTHEALINGHOUSINGKITTENSMEDICALNURTURE...

Adopt Word Search 2026-01-02

100 Items: AVABEDCATDOGFURJOYPAWPETVETWAGBARKBONECARECATSDOGSFEEDHELPHOMEHOPEKINDLIFELOVEMUTTNOSEPAWSPETSPLAYSAFESAVESOFTSPAYTAILTOYSVITOWALKWOOFADOPTASPENBOWLSCLEANHEARTIDTAGLEASHLICKSPUPPYSAVEDSMILETRAINTRUSTWATERCOLLARDONATEFAMILYFOSTERFRIENDHUMANEKITTENNEUTERRESCUESENIORTREATSWARMTHWILLOWANIMALSANSTINEBLANKETCOMFORTHEALINGHOUSINGKITTENSMEDICALNURTURE...

Adopt Word Search 2026-01-04

100 Items: AVABEDCATDOGFURJOYPAWPETVETWAGBARKBONECARECATSDOGSFEEDHELPHOMEHOPEKINDLIFELOVEMUTTNOSEPAWSPETSPLAYSAFESAVESOFTSPAYTAILTOYSVITOWALKWOOFADOPTASPENBOWLSCLEANHEARTIDTAGLEASHLICKSPUPPYSAVEDSMILETRAINTRUSTWATERCOLLARDONATEFAMILYFOSTERFRIENDHUMANEKITTENNEUTERRESCUESENIORTREATSWARMTHWILLOWANIMALSANSTINEBLANKETCOMFORTHEALINGHOUSINGKITTENSMEDICALNURTURE...

Adopt Word Search 2026-02-16

100 Items: AVABEDCATDOGFURJOYPAWPETVETWAGBARKBONECARECATSDOGSFEEDHELPHOMEHOPEKINDLIFELOVEMUTTNOSEPAWSPETSPLAYSAFESAVESOFTSPAYTAILTOYSVITOWALKWOOFADOPTASPENBOWLSCLEANHEARTIDTAGLEASHLICKSPUPPYSAVEDSMILETRAINTRUSTWATERCOLLARDONATEFAMILYFOSTERFRIENDHUMANEKITTENNEUTERRESCUESENIORTREATSWARMTHWILLOWANIMALSANSTINEBLANKETCOMFORTHEALINGHOUSINGKITTENSMEDICALNURTURE...

West Virginia State Animals 2024-02-15

5 Items: cardinalhoneybeeblackbearbrooktroutmonarchbutterfly

Endangered Animals in Panama 2024-09-26

5 Items: SlothJaguarHarpyEagleGoldenFrogGreenIguana

Domestic Animals — "Animal Wonderland!" 2025-04-17

5 Items: DogCatCowDuckRabbit

Animals Word Search Puzzle 2023-07-03

5 Items: catdoglionbirdtiger

Puzzle 2: Wild Animals 2025-01-25

5 Items: LIONBEARTIGERMONKEYKangaroo

Puzzle 1: Farm Animals 2025-01-25

5 Items: COWPIGHENDUCKHORSE

Wild Animals — "Jungle Jamboree!" 2025-04-17

5 Items: LionTigerZebraGiraffeElephant

Animals on the Farm 2025-08-27

5 Items: cowpigduckgoatsheep

Animal Adaptations 2024-03-14

16 Items: copying a behavior or appearancemanipulate an object to perform a certain taskmore eyes in a group to watch out for predatorsbehaviors that are inherited rather than learnedpretending to be dead to escape from bodily harmadjustments to internal or external physical structuressolving a problem by repeated, varied attempts until successful...

Epidemiology - Topic 1 2023-01-27

7 Items: W__ gets the disease?W____ does the occur?H__ is the condition contracted and spread?W___ do people or animals get the condition?Key elements in epidemiology? P_____P____T___environment, Agent and Host are the component in epidemiology t_______Why we need to use "epidemiology's one word questions"? To come out with c______m______

6 letter words 2026-01-31

7 Items: Annoy persistentlyJourney to hunt or see animalsMake a sound typical of metallic objectsPeriodically repeated sequence of events (plural)Artifact made by weaving natural or synthetic fibersShort knife with a pointed blade used for piercing or stabbingHard glossy mineral consisting of silicon dioxide in crystal form

animals 2023-08-16

2 Items: lionjaguar

Animals 2014-01-14

2 Items: hungergamesgatewayacademy

animals 2024-01-15

2 Items: cut petloyal friend

Animals 2021-10-26

2 Items: catdog

Animals 2025-01-19

2 Items: cowhippopotamus

Farm animals. Animales de la granja. 2014-05-12

8 Items: patoovejagallocabragansoconejocaballogallina

Word saerch page 7 DENGEROUS ANIMALS 2015-07-21

8 Items: RANAORCAARAÑAPIRAÑACULEBRATIBURÓNCOCODRILOESCORPIÓN

Word saerch page 5 JUNGLE ANIMALS 2015-07-21

8 Items: LEÓNTIGRETUCÁNCEBRAJIRAFAGORILACULEBRALEOPARDO

Word saerch page 8 OPIVAROUS ANIMALS 2015-07-21

8 Items: PEZPATOPALOMATORTUGACULEBRAGALLINAPINGÜINOAVESTRUZ

Word saerch page 7 DENGEROUS ANIMALS 2015-07-21

8 Items: RANAORCAARAÑAPIRAÑACULEBRATIBURÓNCOCODRILOESCORPIÓN

Remus Word Search 2023-04-11

9 Items: Who was Julius CeasarWhat did the Romans believeDid Romans like the theatreWho was the twin brothers who diedIn which century did the empire endWhat did Romans call 'a day at the racesIn what game did huntsmen take on wild animalsWho were the most powerful people in the Roman RepublicWhich brother was killed when they were naming the empire

Animals 2025-12-30

2 Items: GrayBlue

Literary Elements and Parts of Speech 2025-09-03

15 Items: expresses actiondescribes a noundescribes a verbthe problem in the storythe message of the storyparts of a fiction storya person, place or thingtakes the place of a nounwhere the story takes placepeople or animals in a storygoes against the main characterthe main character of the storytraits that describe the characters...

Word saerch page 4 DOMESTIC ANIMALS 2015-07-21

8 Items: PEZGATOLOROPERROCONEJOHAMSTERTORTUGACANARIO

... 2025-12-09

15 Items: : place to see animals: to speak words aloud: place to fly on a plane: place to keep or get money: feel happy about something: feeling pleased or thankful: place to drink coffee or tea: feeling anxious or concerned: send a message on your phone: to perform an action or task: to create or produce something: place to buy clothes or things...

San Francisco song 2025-07-15

10 Items: There was one in 1906.These are marine animals.The Pacific is an example.This is a synonym for roadThis is where the seals are.This is a means of transportThis is the sound a seal makes.This is a place where you can play.A very famous bridge in San Francisco.This is the colour of the Golden Gate Bridge

Plants and animals of the Salish Sea 2025-03-28

10 Items: ṕəltaqʷəʔəptənɬoɬmomƛaləqənχɛχyɛq́ƛəqstənkʷumaqɛnχawχɛḱʷumkʷumkʷumay

Unit 2 Review 2024-04-08

15 Items: Fibers derived from plants.Fibers derived from animals.Fibers from specific animals.Knitted in a continuous tube, eliminating the need for seams.The capacity of a material to retain heat and provide insulation.The capacity of a material to take in and hold liquid or moisture.Made by interlocking loops horizontally, resulting in a stretchy fabric....

Animals 2021-04-15

2 Items: catdog

Animals 2022-02-13

2 Items: catdog

animals 2022-12-16

2 Items: cabe

Ancient Greece Gods And Goddess Word Search! 2025-11-11

10 Items: The god of warThe god of fireThe god of musicThe leader of the godsThe god of sea and oceansThe goddess of war and wisdomThe goddess of love and beautyThe goddess of fields and farmingThe goddess of hunting and animalsThe wife of the leader of the gods and is the goddess of marriage and family

trs23 ver3 u1 2023-02-16

8 Items: Not pretty.Pick something up.Go from one place to another place.A scary, not real animal or person.A room in a house with a TV and sofa.What you give when somebody asks you a question.Animals have these. Some are long, some are short.Where two sides meet. A square has 4. A triangle has 3.

animals +size:[35 TO 40] 2025-11-29

6 Items: catlionzebrahippoelephantMan's best friend

Vocabulary 2025-09-13

8 Items: aware ofwork well togetherwhen something is inactivefields that are flooded to grow rice inthe place cows are milked on a dairy farmcaring for or showing empathy towards someone or somethingan indoor growing facility that controls growing conditionsof burden animals used to carry loads or do work; often on a farm

Winter/Christmas Wordearch 2024-11-22

110 Items: hatpieicebadredfuntreesnowsledcoatstarcoalparkcakemilksaltconelistgoodgoldbowsjudeigloohappyjollysantascarfbootspartybellsmusicgreenmagicjamesshovellightscarroteggnogsleighbeanieturkeymovieswinterauroraglovesbasketcandleskiingangelsgamilygrinchsilveryellowspiritfamilyjackieameliasnowmanpopcorncookiespenguinskatingchimneybrowniemarketslettersanimals...

100 Days of School 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Walker Filtration Oct 2025 2025-07-03

24 Items: AftershaveNoddys mateThe big blueLarge planetRed and juicyBlack and redType of appleType of appleHome of MickeyLargest house catBoiled or pickledH R Giger creationSlang for NewcastleTakes arial footageDave sings for theseElephant with big earsSome like it some dontSinger from North EastDave drummed for theseListen to music on these...

Columbianexchange Word Search 2025-01-15

20 Items: Refers to Europe, Africa, and Asia, which were connected before the Columbian Exchange .Refers to the Americas, which were introduced to Europeans after Christopher Columbus's voyage in 1492 .An agreement between Spain and Portugal in 1494 dividing the newly discovered lands in the Americas between the two nations ....

Can You Spot All the Yosemite Animals? 2025-02-19

10 Items: FoxOwlBearDeerFrogFishLynxHareDuckEagle

1o wild native wild animals from Argentina 2025-11-10

10 Items: foxPumaRheasWhaleCondorLlamasCaymanPenguinAlpacasAnteaters

Bo 5.0 2025-01-26

17 Items: מִצְווֹתPlague #8Plague #9“come”, Hebrew“good” in Hebrew“Mitzvah” Hebrew“Hello” in HebrewThe king of Egypt.“Let My people ____”The Holy One’s calendar.Nothing new here…. Ecc.1:9The letter ‘mem’ pictures??The ‘sign’ on the doorposts.“We’ll done, good and faithful _______”These had light during the plague of darkness....

Animals You Might Find in the Artists’ Paintings 2023-10-30

12 Items: fishdeerbearegreteagleheroncougarseagullraccoonpanthersquirrelspoonbill

What Makes This Place Special? Vocabulary 2023-02-07

10 Items: a vacationnot the sameto go from place to placea place with a roof and wallsthe animals that live in a habitatthe path someone follows when travelinga picture that shows where things are locateda natural feature of Earth, such as a mountaina place with many businesses, homes, and peoplewhat the air and sky feel and look like any time

Tent Word Search 2026-02-05

10 Items: - a path for walking in nature- resting in a tent or sleeping bag- a bag used to carry camping things- bright lights seen in the night sky- meals cooked or eaten while camping- plants, animals, and places outside- a tall plant with a trunk and leaves- a large body of water near campsites- a small fabric house used when camping...

6 Types of Animals Groups 2025-04-22

6 Items: BirdFishMammalInsectReptileamphibian

Debris, Word Search 2026-04-08

16 Items: We met a bear.It is amazing.I was very afraid.We picked up trash.Let's get together.To show or point out.We finished the project.We re-followed our steps.I was __________ by a bear.It is hard to read the text.There are many food choices.My grandfather, father, and me.The large size of this mountain.Someone who likes animals and plants....

Our Earth and Environment 2023-02-15

14 Items: our planeta dense forestWhat gives us oxygengrows from the groundwhat plants grow fromtaking trash and reusing itthe outer land near a riveranother word for what’s outsidewhere you can find the frogs! 🐸taking food waste and making it soilwhat comes from the sun on warm daysthose on the earth that are not human...

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...