animal Word Searches

Word saerch page 21 ANIMAL BABYS 2015-07-21

7 Items: POTROPICHÓNOZESNOBECERROCORDEROCACHORROBALLENATO

Unit 12 2024-02-26

12 Items: improperpoorly madea thin stripto agree withshowing no sorrowto stun or confusefit to be inspectednot taking any sidesa standard measurementto turn around a central pointa machine or tool used to do household jobsan animal or person that moves to different regions

Identify these objects 2024-09-20

10 Items: Pet that BarksSomething you readWater from the skyPet that chase miceA home built by birds.Animal that loves cheeseSomething you write withSomething you wear on your headTall plant with leaves and branchesA small container used for drinking

Build Up 3.3 Welcome to the Animal Kingdom (2) 2024-06-11

14 Items: Rivers and Lakes.The top of mountains.This habitat covers 70% of Korea.Cutting down trees in the forest.A big cat that lives in rainforests.The only continent without grasslands.To use less of something like electricity.The largest habitat (it is filled with water).The plants that give the grassland habitats name....

trs23 ver3 u4 2023-02-24

10 Items: A big cat.Really great.Not interesting.A kind of long pasta.Something you think up.Have fun doing something.#1. Better than everything else.A small animal that lives in trees.Ask someone to do something with you.A kind of chicken that makes noise in the morning.

Happy Birthday Bri! 2024-06-25

10 Items: Bri's favorite cake.Bri's favorite holiday.- Bri's favorite season- Bri's favorite color.Bri's favorite food - mmm crispy.Bri's favorite animal - think pink!Bri's favorite movie genre - amour.- Bri's favorite summer activity - not running!Bri's dream vacation destination - known for pasta....

Unforgettable Minds: Memory Marvels and Forgetful Friends in the Animal Kingdomelephantschimpanzeesoctopusesdogscatssquirrelsgoldfishguppiesantsmemorywater 2024-04-13

19 Items: dogscatsantswatertoolsfacesmemorytricksforgethidingguppiesgoldfishroutineselephantsoctopusessquirrelschimpanzeesintelligenceimpressively

Gato Word Search 2023-03-03

20 Items: something people sleep onsomething people use to write ona very common house pet that meowsa very common house pet that barksa device people use to communicatea form of art people can listen tosomething people wear on their feetsomething people use to carry stuffa big gray animal with huge gray earssomething you open to get into a room...

Puzzle #6. Palabras con A. 2024-05-24

80 Items: ajoalmaaltoanísaptoaquíarpaacosoajenoálbumaletaalzaranchoángelantesanualañejoapodoarenaardoralhajaalhelíaliciaaljibeacordeafilaráfricaagendaalarmaalemánalturaamargoamarseamasaranimalantojoañorarapenasarenalalianzaaclamaradentroafloraraisladoalambrealargaralcaldealondraaltavozaltitudamarraraméricaancianoanguilaapliqueapuradoarbustoarcillaárbitro...

10 minutes de détente 2023-03-16

30 Items: ville de papeville d'arènesérie du soirmaison du sudcolis du mardiévénement de 2024chevelure du liontriangle chocolaténagui y fait chantersoignant post mortemhéros de tes lectureshabitude du quotidienil peut être d'honneurton jeu de train préféréton jeu de carte préféréta boisson de la journéefumé italien que tu aimeston animal de compétition...

ww5 u 3 & 4 2024-03-07

29 Items: weaka choiceto leavetoo earlyvery largeto cover upto lose hopestrong windsto understandexact, correctno longer livingsavage or fiercea meat eating animalto make strong againa feeling of great joya longing for the pastnot exact but close enoughto break off or cut in twoa long journey by sea or spacean animal that is hunted for food...

From Tortoises to Parrots: A Fascinating Dive into Animal LifespansAnimalsBirdsDogsCatsElephantsTurtlesFoodDietHabitat 2024-06-03

16 Items: dogscatsfooddietsizebirdssafetyanimalsturtleshabitatthreatselephantspredatorsprotectionmetabolismenvironment

Vocabulary #22 2024-05-28

8 Items: a weak person or animalencouraging and nurturingto declare with convictionto believe something without proofwithout any doubt, very apparentlyto depend upon someone or somethingto propose as a candidate for electionsadness for what another is going through

Vocab word search 2024-04-26

12 Items: definition listening to ordersdefinition its like being treated crueldefinition to bark quick in a sharp tonedefinition something that supports wood for sawingdefinition a group of shelter like a bunch of tentsdefinition an inner voice bringing someone to rightness.Definition is when your crying and have tears in your eyes...

Random Word Search 2024-01-11

6 Items: Man's best friendking of the junglean animal with great memorythe largest planet in our solar systemthe color of food that helps your heartthe football team that won 2023's super bowl

Me & You 2024-06-19

11 Items: Our cityour best dateyour fave animalyour donut flavoryour fave Bee Gees songour shared home last yearyour silly little nicknamewhere we're getting marriedyour (alleged) favorite dessertthe gal we're gonna see in novemberthe band you started listening to after I forced you to branch out

trs23 ver3 u8 2023-03-24

8 Items: A kind of flower.Wow! That is _________!A person who does magic.The clown does a magic _____.A kind of small, cute animal.Use this to keep your neck warm.Use this to keep your body warm.Use these to keep your hands warm.

Masculin Lettre A 2020-02-15

87 Items: anauâgeâgéairamiartabriaideangeaoutaoûtavisaccèsachatacieradieualbumamourangleappelarbrearrêtastreaucunautreavantavionavrilabsentaccordacteuradulteagneaualcoolancienanimalanneauargentaspectauteuraveniravironavocatabandonaccueilaffreuxaimablealimentamateuramusantancêtreanglaisanglaisappétitarrièrearticleartisanartisteatelierautobusautomneaveugle...

Masculin Lettre A 2020-02-15

83 Items: anauâgeâgéairamiartabriaideangeaoûtavisaccèsachatacieradieualbumamourangleappelarbrearrêtastreaucunautreavantavionavrilabsentaccordacteuradulteagneaualcoolancienanimalanneauargentaspectauteuraveniravironavocatabandonaccueilaffreuxaimablealimentamateuramusantancêtreanglaisappétitarrièrearticleartisanartisteatelierautobusautomneaveugleaccident...

The Actor Word Search Puzzle 2022-07-29

15 Items: ActorActorActorVideo EquipmentVideo EquipmentWilson's Main JobHenry Loves This AnimalJune Loves Creating ThisWilson Loves To Play This SportVideo Equipment (Use _ As Space)Henry's Main Job (Use _ As Space)June's Favorite Character To Play AsHenry's Favorite Character To Play AsWilson's Favorite Character To Play As...

Creativity Word Search 2022-05-25

5 Items: of great significance or valuethe ability to do something wellusing thought or rational judgmentUse of the imagination or original ideasthe existence of an individual human being or animal.

Animales 2024-08-27

2 Items: Qué animal salvaje tiene un cuerno en su nariz y una piel gruesa.Qué animal salvaje es conocido por sus aullidos y pertenece a la familia de los cánidos.

Jennifer and David 2024-01-21

20 Items: Where they metDavid’s Best ManJen’s first wordDavid’s middle nameJen’s favorite colorJen’s birthday monthJen’s favorite flowerJen’s Matron of HonorDavid’s favorite foodWhere they got engagedDavid’s birthday monthDavid’s favorite colorJen’s first pet’s nameDavid’s favorite candyJen’s favorite dessertDavid’s favorite drinkDavid’s favorite animal...

PMC Tech Week Word Search 2024 By Dr. Kristin 2024-09-06

22 Items: Our RescueWe work atClinic CatDogs are __PMC ManagerOur Pet StoreBlood SpinnerOur newest vet!Our CorporationWho’s that girl?Dr. Chuck’s breedThe OG technicianDr. Todd’s nemesisNot just a mustardSqueeze with caution!Heather’s favorite animalDr Kristin’s fabulous dog!Diabetic monitoring systemThe Great Pretender (dfdx)Dr. Kristin runs a lot of ___...

trs23 ver3 u3 2023-02-24

12 Items: Sound.Scared.Not loud.By yourself.Wow! I am ____!From sunset to sunrise.You turn it on so you can see.Sleep in this when you go camping.When you eat in the middle of the day.Noise you make when you are very scared.Dogs, elephants, mice, lizards, chickens.Place where you can borrow and read books.

unit12 2024-02-28

12 Items: to agreenot strongto zone outfit to be seento turn arounda standard scalea thin tiny stripnot taking any sidea helpful thing for work or your housean animal or person that moves non-stopnot feeling sorry about something you didhurting for no other reason than to do it for fun

trs23 ie2 u4p2 2022-11-16

8 Items: More good.A bird's mouth.Birds use them to fly.Go up a ladder or a tree.It is at the back of an animal.Picture made with pencils or crayons.Birds have them all over their bodies.A place you can go to see wild animals.

Les larmes de l'assassin - chapitre 1-5 2024-03-06

12 Items: violenceserpentsimpressionnerNom de famille de PaoloLes ______ de l'assassinLe nom de la ville de Luis ?Animal donné à Paolo (p. 43)Auteur du livre : Anne-Laure _______Qui a gagné à la fin du chapitre 5 ?Nom du pays où se déroule cette histoireAngel utilise un _______ pour assassinerQu'est-ce qu'Angel a demandé à Paolo de cuisiner pour lui ?

united 2023-01-20

33 Items: leafsagemodemlaptopserverrouternutmegpenguinprinterwindowsdesktopcomputerdatabaseinternetfirewallhardwaresoftwarerosemarylavenderalligatorbandwidthcoriandertechnologyabsorptionthe study of mushroommain herb found in pestothe national spice of hungarythe main circuit board in a computerthe fastest land animal in the world...

Julianator 2013-07-19

91 Items: catdogCATDOGFUNHUGONEOWNlionCARDCLAYFILEFREELOVEMAILMAKEMINDNAMEPINEPLAYSTARSURFTREEYOURzebrahippoBEACHBRAINCHILDFIGHTGLASSHORSEJULIALAUGHLIGHTMOMMYNIGHTPAPERSHARKSHAYASHELLSNAILSTATETODAYTOHARVIDEOANIMALBRANCHCASTLECIRCLECREATEFAMILYFLIGHTHAWAIIHEIGHTINDIANISLANDJEWISHNOTICEPLANETPURPLEPUZZLERANDOMSCHOOLSUMMERBLANKETEXPLOREFITNESSFOLDERSPASSION...

Anniversaire 2024-03-24

13 Items: 1500Dans quel lieu ?Un point cardinalUne note de musiqueQui n'est pas encore mûreLà où le soleil se couchemettre à l'abri des regardensemble de pièces de monnaieAction de pour-suivre quelqu'un, un animalQui indique l'unité de début dans une sérieFaçon de s'exprimer, intensité d'une couleurCe qui guide dans une recherche, suivre une piste...

Spelling 5 2024-03-27

10 Items: opposite of badopposite of lastopposite of emptya running contestpast tense of takeround shape with no cornerssmall animal with wings and a beaksubstance on the ground where plants growan enclosure that usually contains pets like birdsto want something to happen or be true (root word with ing)

POSTIES 0325 BIG READ 2024-03-07

6 Items: very hota young catopposite of "strong"used a describe an animal that does not have a homea place where food and drink are served in a schoolto watch and check something carefully over a period of time

trs23 ver3 u2 2023-02-16

10 Items: Ha ha ha.Jump into water.Don't do something.Water that goes far down.Some water you can swim in.An animal that swims and jumps.What you get when you hit water.A colour between white and black.Between two corners. A dice has six.The place where you can walk across a road.

Clare's Big/Little Clue 3 2024-02-22

10 Items: What state am I from?What is my hair color?What sorority am I in?What color are my eyes?How many dogs do I have?Where do I do to college?What is my favorite movie?What music genre do I like?What is my favorite animal?What jewelry color do I like?

parkers manwuel amaral 2024-04-26

12 Items: a commandfront of buildinga line of soldiersdecent from ancestorsattach a boat to a ropeplants with shiny leavesa nose or jaw on any animalstand upright from the skina intense feeling of longing someonea word used when something is fallingsimple laws for any type of governmentsomething being stretched or mental pain

Spelling list 2024-01-08

9 Items: A lung diseaseTo attempt somethingBelonging to a collegeSomething men use to smell goodA fancy sparkling alcoholic drinkA pocket of puss on animal or humanA voice in your head to tell you what to doWhen you are torn between 2 different thingsA way of pronouncing words in different countries

animales cual es el animal mas inteligente 2024-01-20

6 Items: catlionzebrahippoelephantMan's best friend

Animals 2024-04-28

20 Items: MilkShellTrumpetSlitherRibbit...Feline friendFast boi lionUgly pink fishyMan's best friendKing of the jungleStriped black and whiteGoldilocks and the threeGray dog with sharp teethBaby _____ do do do do do doGigantic semi-aquatic creatureSlowest animal stereotypicallyGiant reptiles that went extinctThey have wide heads/eyes with no lids...

Tangerine Vocab Set 1 Word Search 2023-01-24

10 Items: steadilyopposite of beliefsynonym for restlesswork jointly toward the same enda word to describe a wild animalyou usually do this before sportssounds like a government/political wordmake full use of and derive benefit fromWhen the old lady crossed the street, I stopped _____go or move back or further away from a previous position

Animals and the environment 2022-12-30

8 Items: continue to livecatch and difficult to finduncommon and difficult to finda set of similar animals or plantsa living thing that is not a plantthe natural surroundings where we liveanimals or plants which could disappear without out helpthe place where animal or plant naturally lives or grows

Ancient Professions and Trades. 2024-09-20

15 Items: Made candles and soap.Made barrels and casks.Repaired and made shoes.Made arrows for archery.Crafted objects from silver.Created maps for exploration.Specialized in shoeing horses.Built and repaired wooden wheels.Turned animal hides into leather.Operated mills for grinding grain.Sold mens clothing and accessories....

1 2022-02-20

96 Items: ofohoractagoandbadbagbedbutbuyendgasherhitlaylownornotoiloneouroutredtenthewayyetableareaawaybabybackballbankbasebeatbestbillcallfallgameheadlongmostonceaboutaboveadmitadultafteragainagentagreeaheadalonealongamongapplyargueavoidboardleastmediaotheracceptacrossactionaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistassumeattack...

FNW Final Review 2024-04-26

20 Items: One of FCCLA's colorsFCCLA's official flowerA unit of energy found in foodOne way vegetables are classifiedOne of the parts of a grain kernelThe number of essential amino acidsThe main nutrient of the dairy groupAn example of a cultured dairy productWhen food choices are influenced by sensesThe number of calories in a gram of protein...

vocabulary 2023-10-05

27 Items: an ancestorlead by, guided(of a place) without inhabitantsan airplane with one set of wingscontaining or using only one colornext to or adjoining something elselikely to be the case or to happen.relating to or resulting from motionoperated by or equipped with machinesliving the life of a nomad; wanderingmeter used to determine the altitude attained...

animals 2024-03-14

20 Items: A wild animal with black and white stripes, native to Africa.A wild carnivorous mammal similar to a dog, known for its howling.A flying insect known for producing honey and pollinating flowers.A large predatory cat with distinctive orange fur and black stripes.A large, carnivorous cat known for its golden coat and majestic mane....

Habitat Word Search 2024-09-23

8 Items: animals killed by predatorsWhere a plant or animal livesConsume other plants or animalsProvides food for insects and animalsAnimals that hunt other animals for foodName of the food that animals need to growShows all the different food animals eat in a habitatWhen green plants make food using light energy from the sun

animals 2024-03-14

20 Items: A wild animal with black and white stripes, native to Africa.A wild carnivorous mammal similar to a dog, known for its howling.A flying insect known for producing honey and pollinating flowers.A large predatory cat with distinctive orange fur and black stripes.A large, carnivorous cat known for its golden coat and majestic mane....

LAVA 2024-01-17

4 Items: résultat, envie, animal, tortue, baleine,eau, chant, jour, mer, musique, histoire,film, volcan, terre, océan, archipel, ile,ukulélé, dérouler, dresser, compter, sentir, chanter, résonner, savoir, sortir, s’enfoncer, rencontrer , volcanique, amoureux, seul, autre, désespéré, imaginaire

South America Vocabulary 2022-11-13

15 Items: synonym soaklow-lying areascomplete controlsynonym for plantssynonym for modifycarefully uncoveringWorlds largest waterfallDriest desert in South Americapeople who move from place to placeobjects left behind by past culturesthe variety of species in an ecosystemwide open areas used for grazing and cropssmall rivers that drain into a larger river...

trs23 ie2 u5p1 2023-01-12

10 Items: a small, glass ballput it with your keysa kind of scary animala small model of a personuse it to erase your writingput it on your clothes or baguse it to sharpen your penciluse it to colour in a drawingstick it on paper or on your thingsblow it up and it will float in the air

trs 3b w17 pt1 2022-06-01

11 Items: adj. not farn. a baby animaln. brother or sistern. a very smart personv. make something move upn. a person who makes musicv. lift up and move somethingadj. very good at doing somethingn. a big, white bird that lives on waterv. make a sound with a musical instrumentn. small sea creature that looks like it has wings

trs23 ver3 u1 2023-02-16

8 Items: Not pretty.Pick something up.Go from one place to another place.A scary, not real animal or person.A room in a house with a TV and sofa.What you give when somebody asks you a question.Animals have these. Some are long, some are short.Where two sides meet. A square has 4. A triangle has 3.

How Can We Tell If An Animal Is Happy Without A Wagging Tail? 2023-03-19

17 Items: tailkickwatchhappytwitchpouncetreatsfriendwaggingrabbitsferretspurringplayfulrelaxedsteeringenergeticguineapigs

Site words 1 2023-01-13

113 Items: hegoinismetoitmyweonatasofifambedonousuporcanyouseegetnotanddidrunforwasareallbigboybutcardayeatfunhadhasherhimhishownewnowoffoldoutransawshewhywhooneusetwoanysaidhavelikeawaybestcomedownfromgirlgivegoodherelookmademakeoverplaysometellthatthemtheythisthemwantwhenwhatwentwillwithyourweregirleachbeenwordmanyintodoesafteraboutcan’thousetherethingwould...

Monthly Challenge A-B 2023-03-08

109 Items: addagoairallandantanyarmartaskbadbagbatbedbigbooboybusbutbuybyeablealsoareaauntawaybabybackballbarkbearbeatbeesbeepbellbikebirdblowblueboatbodyboneboombothbowlbusyaboutaboveafteragainagreeallowalonealongaloudangryapplebeachbelowblackboardbooksboxesbreadbreakbringbrownbrushbuildacrossactingactionafraidalmostalwaysanimalansweranyonearoundarriveartist...

Theme 4 complete 2021-04-21

106 Items: ofinfordrypawbitecagecutefastkeepleafmeatsoftwildlakelionbirdcarechewduckfishjumpluckmalemesspondrideskintakeparttameareabusyheropoorrichroseboneflatsafestartownfurryheavysharphorsemouseoceansnaketigergooseshinsstuffspotswingsenemyexistmarrymerryriversandystealtulipadultdustyskulltoweranimalarriveplentyspinesjunglemonkeyparrotrabbitspiderfemale...

Juanita - classes 1 and 2 2023-07-27

10 Items: benefitobjectivewithout lucksynonym of fightto notice somethingwith a lot of noiseto care for a child or young animalsynonym of finish (but it's not the same)a formal arrangement to meet or visit somebody at a particular time, for example a doctor.a small piece of metal or plastic, with a design or words on it, that a person wears on their t-shirt.

trs23 ver3 u13 2023-05-31

10 Items: Lions can run ___.Look ___ the window.A shape with no corners.Something not from Earth.A car has 4. A bike has 2.Cars, trains, buses, planes etc.A kind of small animal with a long tail.It is white or grey and it is made by fire.It has wheels but it doesn't drive on the road.How you feel if someone says "Boo!" behind you.

Unit 10 2024-01-24

12 Items: easily brokena ruler or leadereasily moved or carrieda severe shortage of foodcareful about spending moneyto criticize a person of wronghaving to do with sight or seeto open up, to make or grow largeran animal hunted as food by anotherto do away completely with somethingto move to a lower place from a higher one...

Word Search 2 2024-03-04

7 Items: Who killed Macbeth?Who carved Pinocchio from wood?What is the name of Mickey Mouse’s dog?What animal appears on the crest of Slytherin?Tick Tock (from the Disney movie) was what type of creature?What is the name of the character of the pig in Charlotte’s web?What stuffing was used inside the little boy's beloved Velveteen Rabbit?

A Whale of a Trip 2024-02-04

8 Items: not long agonot long agoin place of something elseto go to another area or countrysomething made known that was previously a secrettravel from one place to another over a long distancespacecraft or other objects that circle a planet or a stara type of animal that drinks milk from it's mother's body when it is young

Animal 2022-10-27

1 Item: animal

Everything! 2013-11-20

113 Items: catdograteatredpenbedboxmanskysunsuntaxlionfoodbluepinkgoldmeatryanlukecakehardeasydeskdeerbearbirdmoonfaceeyesbandsingfeetlegsdoorzebrahippophonemousedrinkgreenblackbrownsteaksarahjennimagiccolorpaperhouseshackwomenchildmapletigermouthsocksstorehumanshirtpantshockeyfamilyorangeyellowpurplesilversoccersydneydakotapencilpillowracoonanimalground...

Aashka <3 Vaibhav 2022-10-25

25 Items: Mayanagriour home no.1our home no.2panda zoo cityMy squishmallowMy song for youMy favorite dishBest pirate everYour song for meMy human golgappaYour squishmallowYour favorite dishJuciest fruit everCuteness _________I'm your______ mamaYou're a cutie _____first kiss in _______I'm the best _____ wooMachine learning ________place where I fell for you...

Jen Trivia: Word Search Edition 2023-07-10

25 Items: Jen's majorHer last nameHer first nameHer middle nameA sport Jen playedA sport Jen playedJen's Favorite foodJen's Favorite colorJen's Favorite animalThe name of Jen's carOne of Jen's DIY PhasesOne of Jen's DIY PhasesOne of Jen's DIY PhasesJen's favorite video gameJen's favorite soft drinkJen's favorite/lucky numberThe high school Jen attended...

Build Up 3-3 2023-02-03

11 Items: This turns into a froglet.The only egg-laying mammal.The top layer of a rainforest.The largest habitat on the planet.Mammals and birds are ____-blooded.Habitat where you might find horses.This kind of animal has hollow bones.Hard shiny things that cover a fishes skin.A mammal that lives in a marine environment....

Simple German Word Search 2023-09-19

10 Items: Bier/An adult drinkMilch/Liquid from a cowVater/Your patriarch/male caretakerBrot/It's the main part of a sandwichMutter/Your matriarch/female caretakerBar/A large brown animal that likes fishMusik/A sound that billions of people listen toIch/Referring to yourself, used in 1st person storiesKaffee/A drink used to boost energy, mostly drank warm...

Spelling List #1: ALL, AL, AW 2022-10-13

12 Items: a type of nuta word that means totalthe inside of your handsomething that is not biganother word for flower stemthe amount of rain that fallsa product that heals your skina word that means to speak or chata word that means the opposite of angrya thing used to draw on a board or pavementa room where a horse or other farm animal lives...

Cinderella pgs. 26-31 2023-07-10

12 Items: What is the magic word?What did each mouse turn into?What do the lizards turn into?What did the pumpkin turn into?What shoes does Cinderella get?What did the godmother take out?What did one of the rats turn into?Who helped Cinderella go to the party?How did Cinderella feel as she drove away?What time does Cinderella have to come back?...

Animal Word Search 2024-09-09

1 Item: animal

trs23 ver2 u15 2023-01-18

10 Items: A painting or drawing.The ant walks ____ the table.The shark swims ____ the water.Don't ____ the can of coca-cola!You can write, draw or paint on it.An insect with big, colourful wings.Coloured stuff used to make a picture.Use it to paint. Use it to clean your teeth.A living thing that moves and eats and breathes....

Alice's Adventures in Wonderland pgs. 67-73 2024-02-20

10 Items: Where was the Mock Turtle?Who was the turtle's teacher?Who couldn't find the gardeners?Thank you for your _______ story.What animal does the Queen ask Alice about?Who will take Alice to see the Mock Turtle?What was the gryphon's top of his body like?Then Alice saw that the Mock Turtle was _______.What was the gryphon's bottom half of his body like?...

The Jungle Book pgs. 42-47 2023-11-17

12 Items: Monkeys won't _____ you.What do the monkeys hate?Who climbed into the tank?How many monkeys are there?Where did they go to find Mowgli?He was ____ that Mowgli was safe.How did the monkeys feel about Kaa?Who did the other monkeys drag away?Which animal went to fight the monkeys?Where does Kaa go to attack from up high?...

Nick's word search 2024-04-26

12 Items: A sharp and clear soundPeople who work with birdsSomeone who does woodworkingwhen something realeases a smellA device that can catch an animalWhen somebody is completely wrongOne or more people working togethersomeone who is not paying attentionsomeone or something that is very scaredWhen a birds feather is a damaged and wet...

Pinocchio pgs. 14-18 2023-07-14

12 Items: You've been ______!Who grabbed Pinocchio?Who was looking for Pinocchio?What part of Pinocchio got longer?Where did Pinocchio hide his coin?Who does Pinocchio see on the road?What animal comes to get Pinocchio?What do they tell Pinocchio to fetch?Pinocchio saw that the hole was ______.Who helped Pinocchio and took him to her home?...

POSTIES 0722 BIG READ 2024-06-18

6 Items: a person who studies languagesa system of sounds and words to communicatea wild animal similar to a dog, that lives in North AmericaFrench, Spanish, Italian and Portuguese all come from _____.Some people in Papua New Guinea speak a language called _____.In the story 'Tower of _____', humans originally spoke a one language.

POSTIES 0304 COVER 2024-02-15

6 Items: to slowly change over timeone of many large rocks that circle the sunused to describe a living thing that no longer existsfacts or information that show that something is truethe parts of a dead animal or plant that have been preserveda reptile that lived millions of years ago but is now extinct

Everything! 2013-11-20

113 Items: catdograteatredpenbedboxmanskysunsuntaxlionfoodbluepinkgoldmeatryanlukecakehardeasydeskdeerbearbirdmoonfaceeyesbandsingfeetlegsdoorzebrahippophonemousedrinkgreenblackbrownsteaksarahjennimagiccolorpaperhouseshackwomenchildmapletigermouthsocksstorehumanshirtpantshockeyfamilyorangeyellowpurplesilversoccersydneydakotapencilpillowracoonanimalground...

uwu 2019-06-11

115 Items: aIasatbebydogoheifinitactaddageagoairallandanyarmartaskbadbagbarbedbigbitboxboybuycancarcupcutdaydiedogeatfarforgasgetherjobablealsoareaawaybabybackballbankbasebeatbestborncallcardcareeasyedgegoalheadhelpaboutaboveadmitadultafteragainagentagreeaheadallowalonealongamongapplyargueavoidacceptacrossactionaffectagencyalmostalwaysamountanimalansweranyone...

Theme 4 complete 2021-04-21

119 Items: ofinfordrypawbitecagecutefastkeepleafmeatsoftwildlakelionbirdcarechewduckfishjumpluckmalemesspondrideskintakeparttameareabusyheropoorrichroseboneflatsafestartownfurryheavysharphorsemouseoceansnaketigergooseshinsstuffspotswingsenemyexistmarrymerryriversandystealtulipadultdustyskullsmalltowertrackhillyquietanimalarriveplentyspinesjunglemonkeyparrot...

ELA VOCABULARY 2024-04-26

14 Items: tornsilhouettedA very sharp edgeIs like a metal coatingLike a ghost or spirit imageHaving blue hands like frostbiteIs like having a lot of attentionHard to use or handle like a weightGrabbing the edge of your snowboardSomething that is important to show upBeing away from school and being absentAn animal that has feathers on its head...

VET 211 Sampling techniques 2022-12-21

25 Items: Diazepam can be given___ Before eye ointmentLocation used for IM injGetting a sample from the trachea.What is one vaccine given intranasal?Performed at 7th-8th intercostalspaceWhat does an arterial sample evaluate?How is one form of allergy testing done?What area is avoided for SQ injs in cats?Fentanyl patch, flea/tick meds,methimazole...

Don Quijote - Vocab practice 2023-01-23

16 Items: no es buenouna cosa muy muy viejaes el opuesto de suciono es una mentira (lie)no peligroso (dangerous)es muy similar al verbo "IR"esta persona monta el caballouna persona tiene mucho dineroes protección para un caballeroUna persona ________ en TED talk.una persona no tiene mucho dinero¿Qué hace un caballero a un caballo?...

trs 3b w19 2022-06-15

11 Items: n. Sea.adj. Very tasty.n. A famous sports player.v. Another way to say 'can'.n. A place with sea all around it.v. When a plane goes to the ground.n. Something that is wrong or broken.n. Green plant that covers the ground.v. Ask someone to do something with you.n. A place to put an animal so that it can't run away....

Gru Word Search 2024-07-21

10 Items: A mythical animal with a hornThe favorite food of the MinionsAn annual convention for villainsThe main character who leads the MinionsGru's elderly, gadget-inventing assistantTall Minion with one brown eye and one green eyeGru's youngest adopted daughter who loves unicornsShort, one-eyed Minion who loves playing the guitar...

Historia de la Animación - Parte I: Búsqueda de Palabras 2022-08-09

6 Items: El creador de la técnica cel.El personaje más popular de Walt Disney.Tres letras que significan "imágenes generadas por computadora"Este animal es famoso por ser un ejemplo de imágenes en movimiento.El éxito de esta película creó el camino para el sonido en las películas....

Spelling Words 2024-01-10

15 Items: When you’re fun.Combing your hair.When you are unwise.When you were a child.When you are very happy.Something that opens up.A book that has food recipes.The store where you get books.A fantasy / fiction storybook.When something is out of shape.A night animal that loves trash.Food that you might eat for lunch....

Cat Word Search 2023-03-18

1 Item: cute animal

Quest 2 2022-10-15

12 Items: The Ancient of Knowledge.Home to the Vermilion elves.A young keeper, blind at birth.Known as the "Jewel of the South."The main antagonist of the Warminster Series.The animal species the Faircloth family breeds.Incanus Dru'Waith is a ____ elf and an assassin.Erud's magical tome is called The Tome of ________....

rrr 2022-10-19

120 Items: eartowyamgunbadpietripmeltthawpasstallkillsorttaildimefuelhillbootneedlewdpeeltameeggshalfdullwildloaftreecooldebtskirtnaivepartycauseclaimstartquillmessybikesavoidkaputbladepointspicymeatyarguetracehandyritzyscarfroyalmatchcakesreadytouchincomeextendgathertawdryvulgarbrokenstringparcelabjectvioletreportfingershaggyislandbridgeanimalbubblewaiting...

animal 2020-08-20

1 Item: xxjkmn

i love you <3 2023-06-30

10 Items: Our song :)My first ever gift to youYour first ever gift to meYour first nickname for meThe month of our anniversaryMy favorite nickname you have for meThe place where we first had umm car timeThe animal that I painted for you at As You WishThe color of the flower you gave me for my 18th birthday...

trs22 5b w13 pt1 2022-07-04

12 Items: n.Riding an animal.n.Skating on wheels.n.Driving a small car around a track.n.Going forwards down a snowy mountain.n.Going sideways down a snowy mountain.n.Walking though forests and mountains.n.Riding a bike across rough, natural paths.n.Moving across the ice using special shoes.n.Standing on a board and getting blown by the wind....

Alice's Adventures in Wonderland pgs. 12-17 2024-01-17

14 Items: Where was Alice sitting?Where were the lamps on?What was the rabbit wearing?What was all around the hall?Where does the rabbit go down?Where did Alice lose the rabbit?What was on the sides of the hole?What was Alice going to go and pick?What did the rabbit have in his hand?Alice's book didn't have any _________....

Word Search 2022-10-13

19 Items: A feelingYellow fruitEnglish alphabetThe place we liveCapital of AmericaState with four i'sA very cold countrySmall armored animalA day where one is bornBest gym in the countryAlcohol, typically from ScotlandA series about six friends in NYTechnical item we cant live withoutOur really amazing teacher in English...

Books Master Word Search 1 2024-03-03

8 Items: What animal goes pop?What superhero is a web slinger?Name a classic story by Brothers GrimmWhat bear is smarter than your average bearWhat is the name of the enchanted island in Peter Pan?Amelia Bedelia would misunderstand tasks. What was her job?What creature told the kids to make the Cat-in-the Hat go away?...

Animal 2023-01-10

1 Item: woof fetch leash collar hound puppy breed adopt training

Palabras al Azar 2023-03-07

20 Items: a sneaky animalan extoic fruitMan's best friendthe color of an applemoisture for the skina device you play withword describing an injurya color on the Honduras flagwhat people drive on an dailytrips people take to get awayword describing having to waittype of support to help you seeword describing a tiring feelinga subject dealing with chemistry...

Cinderella Word Search 2024-03-03

8 Items: What animal goes pop?What superhero is a web slinger?What bear is smarter than your average bearWhat is a classic story title by Brothers GrimmWhat is the name of the enchanted island in Peter Pan?What creature told the kids to make the Cat-in-the Hat go away?Amelia Bedelia would often misunderstand tasks. What was her job?...