animal Word Searches

1 2024-07-12

52 Items: lotaskhimnewwhybuydeepeachgivegrinjustlinelongmessonlyreadsayssongtelluponwellawaybeendeerdripgoathomekindlioncleandresseveryfightplacesevenstillthingtreatwriteafterblendclockeightfirsthappyalwayssisteranimalfamilybecausebetweenbrother

Word Search 2023-03-06

20 Items: Not a dogNot a catcolor of rosesspanish teacherColor and fruitWhere birds livecolor of patrickThe color of grassThe color of the sunWhere kids go to learnWhat you cut paper withAnimal born with a shellDevice we all use everydayBig cat king of the jungleAnother girl color not pinkdevice given to us by schoolBird with long legs that is pink...

Caballo Word Search 2023-03-10

20 Items: En que duermesEn que escribesUnido a tu palmaCon que te cubresEn que te sientasTercer mes del añoCon lo que caminasEl color del cieloOpuesto de la derechaEl color de las nubesLo que usas para llamarEs un color y una frutaanimal con cuello largoJoyas que usas en tu dedoJoyas que usas en tu muñecaUnico mes que tiene 28 dias...

Animal body coverings 2021-02-08

5 Items: furhairscalesshellsfeathers

Structures and Functions of Animals 2023-12-13

10 Items: Animals eat other __________ to get energy.A _________ is where an animal makes its home.Traveling in herds is a type of _____________ adaptation.Fish use ______ to exchange gases with the water that surrounds them.The ability to run fast is an example of a ______________ adaptation....

La dame à la licorne vert 2021-02-26

54 Items: murîleDamefondfilmromableuversfroidsériescènesalleélèvegrandrougeaussiainsisiècleanimalfleuricentrafameuxanciendevantencoredemeurelicornepanneaudécorerfameuseparfoiscréatureservanteprotégerprécieuxmédiévalgracieuxfabuleuxanciennederrièreaccrochercomporterprécieusemédiévaledécoratifgracieusefabuleusetapisseriedécorativeprintanierreprésenter...

La princesse grenouille Groupe rouge 2021-09-16

54 Items: roivieceladansprèsfaitnuitpeaumoistirerjeunefuturpetitcellealorsaiderparceRussieprinceépouseflèchedevoirdonnerbrûlerhumainanimalsauverlongueépouserépreuveréussirnouveausorcierpouvoirretenirdisparupendantchercheratterrirnouvelleterribledirectionprincesseensorceléapparencereprendreretrouvergrenouilledifférenterechercherdisparaitreprisonnière...

Animals 2022-12-07

31 Items: ρδρυτθγφφγφδδχcatτφρβφξετητρθυσρhippoελάφιεαγφρτρυτρθυυτρωφγφγαρκούδαelephantφλαμίγκοΤο ιππεύειςΤρώει μπανάνεςMan's best friendNot a good friendΤο ζώο που μιλάειblack and white animalThe king of the jungle

Wabash Word Search 2022-08-13

9 Items: state birdstate treestate riverstate flowerstate insectstate animalnickname of stateof america state mottonumber of stars on flag

La dame à la licorne vert 2021-02-26

54 Items: murîleDamefondfilmbleuversfroidsériescèneromansalleélèvegrandrougeaussiainsisiècleanimalfleurifameuxanciendevantencoredemeurelicornepanneaudécorercentralfameuseparfoiscréatureservanteprotégerprécieuxmédiévalgracieuxfabuleuxanciennederrièreaccrochercomporterprécieusemédiévaledécoratifgracieusefabuleusetapisseriedécorativeprintanierreprésenter...

Calder groupe rouge 2021-04-29

55 Items: artfilferpèremèreboistôlejouetécolejeunealorstissucréerainsiplacefairepressecirqueanimallancermobileartistepeintreatelierétudierdevenirjournalficellebouchoncouleurcélèbreimmensebricolercréationutiliserarticuléportraitpersonneprimairepubliquesculpteurmécaniquecommencerfabriqueraméricainreportagematériauxeffectuerminiaturesculptureinstallers’inscrire...

le conte et les griots groupe rouge 2021-11-30

55 Items: secarfeupaystêtedansavecsoircelamaisgriotrécitpleincommecoeuravoiraussilueurheurefairetalentacteurpublicdevoiranimalerreurAfriqueconteurvillagemémoiremusiquemontrersouventpendantsurtouthistoireraconterdéplacercentainechanteurcaptiveraventurevictoireauditeurdivertirancienneréservoirplusieursconnaitreréfléchirhistoriquelégendaireexcellentepersonnage...

Les très riches heures du Duc de Berry groupe rouge 2021-02-11

55 Items: mainpeaumoismoisaoûtdontplangensvoirlivremoineannéeavantproiefaireallermontévoicichampanimalcopierpartiechevalépoqueoiseaudressépaysantravailcouleurvégétalécraserparfoischasserchâteaupaysagebaignerdernierminérauxdemanderseigneurruisseaudeuxièmedominantinventionfabriquermédiévauxminiaturerapporterplusieursimprimeriecalendriertravaillermagnifique...

Environment 2023-06-08

50 Items: airrainfuelreuseflorafaunapapersolarwasteplantwaterozonereduceenergynaturelitteranimalrecycleplasticaquaticclimatewarmingorganicbiomasscomposthabitatnuclearorganismlandfillecosystemfootprintdiversitypollutionradiationbiosphereherbicidegreenhouseecologicaldisposableendangeredextinctionfertilizersustainableagricultureradioactivebiodiversity...

La grotte de Cosquer groupe rouge 2021-03-11

58 Items: auviemainlieuornéecoursbisonsallenoyéecommeenfinhommeobjetaprèsgrotteoeuvresituerpeintegravéedatantdessinanimalphoquepartiejamaisplongéedizaineabriterchevauxgalerietrouveraccéderplongerarriverséparéeémergéeensuitehabitercalanqueempruntepingouinplongeurimmergéeossementdécouvertbouquetindécouvrirparcouriraquatiqueégalementretrouverprofondeur...

Animal and School 2015-08-28

5 Items: catdoglionzebrahippo

animals 2024-07-29

7 Items: Has 9 livesFunny animalMemory of an ...Newspaper colorsMan's best friendKnown to be blackKing of the jungle

spelling list week 8 T2 2023-06-14

5 Items: feral punctual atypicalnatural Aboriginal whimsicalmammal official optionalmedical infernal ephemeralactual integral tyrannical

weird 2024-04-26

58 Items: rockexamopenlickmazestuffmapleanimaljigsawpuzzleschoolforceszigzagfamilybindervolcanoavocadoboarderdestroyillegalbeadingenlargedecimaloctagonchapterjournalorganicasteroidtroubledelephanttabletoptriangledumbbellportraitastronomymedicallymagicallyalligatoreducationcranberryjackfruitimpedimentexperimentobliterateembroiderychalkboardinevitable...

Le règne végétal et Le règne animal 2022-10-11

16 Items: versfougermousseoiseauxpoissonmoluscereptilescrustaséinsectesconiféreamphibienarachindemammiféresarthropodemille-pattesplantefleure

Los cognados 2020-06-24

57 Items: ideamapabancoclasecolorfrutagrupohotellistalíneaadultoagentealarmaanimalbananacentrocerealcámaradebatedragónfamosohumanomillónminutomúsicaocéanoquietoartistacapitalfamiliamomentopersonaplantasadorabledirectorelefantefavoritoguitarrahistoriahospitalinsectosleopardomedicinaproblemaaccidentecafeteríachocolatedeliciosozoológicohipopótamotelevisión...

Basic Last Dance 2022-07-25

57 Items: sadarmlegagefarbikenoselegsarmswomanangrysillyhappylunchalienundersmilecrazyelbowbrainteethanimaldinnerghostsmothercousinauntiehungryballoonwalkmanmonsterunicorncaptainpikachuoctoberfootballmechanicrevisionexercisesentenceslippersdecemberbirthdaytelephoneashlyanfupermanentbreakfastwednesdayballerinanewspaperpineappletelephonebeautiful,strawberry...

Lauren 2023-03-15

13 Items: My furry beastMy favorite sportYour favorite showYour favorite sportYour favorite colorWe biked there this summerYou like to "Boop our...."Your favorite year in middle schoolWe both have a stuffed animal/pillowWe both used to have a hat with this animal on itWe both went to this camp for a sport this summer...

Word Search 2024-06-13

15 Items: sampleunexpectedlya part of a seriesfast/ at high speedto a very great degreein an extremely hungry waythe quality of being honesthappening because of good luckin a way that was not expectedsuggests or resembles a miracle.an animal that feeds on other animalsa place where a plant or an animal livein a way that is difficult to understand...

Test 2024-05-10

6 Items: A road signThe favorite petA mammoth animalMan's best friendA gigantic mammalKing of the jungle

Dog Word Search 2024-08-13

11 Items: potamodinheiropreto e brancoestilo de lutao rei da savanavilão do miranhaMan's best friendmei de transportevive nas motanhasdesenho do relogioanimal grande e africano

Grace5letterwordsearch 2024-05-13

3 Items: planetsmall animalopposite to no

Cover 1106 Animal therapy 2023-10-03

6 Items: nervous and afraidrelaxed and not worrieda child whose parents have passed awayan official test of how well you can do somethinga dog with thick curly hair that is sometimes cut into special shapessomeone who does work without being paid, especially work that involves helping people

fonfas 2023-05-19

4 Items: magicmartim's dadbrown animalused to attack a person or something

SKy Science vocabulary 2023-12-15

4 Items: best animalrock in spacerock hitting earthice and ball flying

Animal and plant cells 2022-11-15

6 Items: catlionzebrahippoelephantMan's best friend

Animal of my house 2023-11-02

6 Items: very fathas stripeslikes to barkhas a large noselikes to chase miceis the king of the jungle

Life Science 2023-06-12

63 Items: dnaatomgenepreycellsclaimplantanimalbiomesdarwinfossilsafetyelementfoodwebmeiosismitosisnucleusosmosisproteincompoundconsumerdominantecosytemevidencegeneticsomnivoreorganismpredatorproducercarnivorecommunitydiffusionevolutionherbivorelabskillsreasoningrecessiveadaptationeukaryoticmicroscopepopulationwatercyclecarboncyclechloroplastnucleicacid...

An Officer and a Gorilla 2024-01-31

15 Items: 담요맛있는벽난로불타다서부의부드러운보호하다도착하다잡고 있다숫자를 세다What animal is Afolabi?Afolabi wanted to go home to _____.Afolabi woke up in the New York _____._____ often came to the forest to catch gorillas.

unit 10 2024-01-22

12 Items: to endguiltyto groweasily brokento move lowerfood shortageeasily carrieda sincere requestcarful with moneyan animal in dangerruler with total powersomething to do with sight or seeing

Patti's Word Search 2023-01-20

24 Items: Involved animalCommitted animalPredicting effortTemporal limitationA weird water carafeAKA Leonardo of PisaPenultimate ceremonyDelta x over delta tShort consistent cycleBefuddled interrogativeHow much can we completeBreaks down into storiesEvery morning, with a rockPrioritized work to be doneWe do this with the backlogSlows or hinders productivity...

20 of my most challenging words form 2023 2023-12-06

20 Items: to be givena reverse movementnot alined proplelyan expert in scientsto be full of glamoura person who fixs teethto be scade of somethinga rainforest in queanslandto let someone do somethingbefore what has just happenda animal that lives in africaa animal that lives in the seafuels a fuel made out of fossilsto see something that is obviose...

Dog Word Search 2024-08-19

3 Items: an animal that goes woofa small feral animal that rhymes with hata yummy food that is cold and rhymes with dream

Les mots de vocabulaire 4e classe 2022* 2022-01-13

63 Items: mairatétéjourjuinchatnoirgrisbleumarsaoûtloupvertoursmoismauvenagerlapinchienannéejeudilaverrougehiverblancverbelundimardivachevolermarroncochonsouriscachersaisonparlerrenardchevalsamedianimalsauterramperautomnecouleurbrilleroctobresemainejanviertrouverjuilletfévrierpoissonchassercherchervendredinovembresanglierhérissonpartagerregarderdécembre...

Sunshine 1 Program 10 2023-12-28

64 Items: catsaybadcutendtopweresurfcamebanglegswheebackhillwarmtestideasstillcomicyoungbrokeslopespeedsleepymovingcalledmatterfreezematteranimalenoughsleighpickedflyingclosetfluffyquiltsgrandmawarmingprogramawesometheaterbedroomstartedheavehofinallyreachedmorningfinishedsleepingtextbookinternetfreezingfollowedterriblesteamingyourselfexercisesurprised...

Sunshine 1 Program 10 2023-12-27

64 Items: catsaybadcutendtopweresurfcamebanglegswheebackhillwarmtestideasstillcomicyoungbrokeslopespeedsleepymovingcalledmatterfreezematteranimalenoughsleighpickedflyingclosetfluffyquiltsgrandmawarmingprogramawesometheaterbedroomstartedheavehofinallyreachedmorningfinishedsleepingtextbookinternetfreezingfollowedterriblesteamingyourselfexercisesurprised...

Likes and Dislikes 2024-05-07

51 Items: teadayTeagamecatsdogsfoodfishsodadanceCreamjeansonionsleepwateranimalapplesbananacoffeefamilyflowersalamitiktoktomatoyellowchickenclothesorangessausageyoutubebirthdaycomputerlemonadeto musicpinapplesneakersbreakfastchocolatehamburgerchocolatemotorbikespaghettiactivitiesvegetablesvideogamesTelevisionwatermelonfoodtropolisto the beachstrawberries...

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

Objects 2024-02-29

3 Items: Garfieldman's best friendmy animal at home

trs23 ver2 u13 2023-01-09

6 Items: not whitea tall plantfight or playchicken, beef, porka black and white animala place with lots of trees

Week 3 Review by Sharli Syed 2023-11-05

11 Items: Makes proteinsBreaks down food into energyInformation for making proteinsPackages and sends proteins out of the cellContains and protects genetic material (DNA)Breaks down and recycles worn out animal cellsCellular package containing products such as proteinHolds everything inside the cell, enclosed by the cell membrane...

NEW YEARS EVE 2023-12-27

4 Items: Bugs bzunnyAn animal with 4 legssomething that smellstransportation with 4 wheels

Différentes classes des règnes végétal et animal 2022-10-06

12 Items: oiseauxpoissonreptilesinsectesamphibienmollusquecrustacéssegmentésmammiféresarachnidesarthropodesmille-pattes

Nature's Classroom Word Search 2023-11-15

58 Items: preysoilacidhikeadaptnymphbioticcanopyedibleexotichydriclichenmammalnativecenterabioticaquaticaquiferof preydiurnalecologyextincthabitatreptileboatingdomestichumiditymollusksomnivoresandhillsamplingsurvivalcompoundamphibiancarnivorecommunityecosystemelevationherbivorenocturnalcamouflagecrustaceanendangeredcrepuscularevaporationgroundwater...

Plural Nouns 2024-04-08

65 Items: daymanboxcupkeyantelfskyflywayleafarmygulfdeerlifetunachefheroechowifeladybodyloafcalffootroofdwarfchildwomanratiochiefiglooknifesheepbanjomooserodeobunnypartyclasscoachpatiomousetoothradiobeliefvalleysalmonpotatoanimalpersonstudiotomatokidneysupplystereoworkermemorysurveyjourneysheriffcountryvarietyscissorskangaroo

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

Dog Word Search 2024-05-02

8 Items: a sporta devicea furry animala small devicea pointy shapea mans best frienda place to cross overThe biggest planet in our solar syestem

Growth 2023-06-28

12 Items: An animal that eats acornsThis big ape is endangeredThe name of an oak tree's seedThis animal lives in AustraliaThe type of snake that Mr Stones hasThe found that Mr Stones' snake eatsA fruit that is grown in the rainforestWhat you have made from toilet rolls this weekThe continent that Mr Davies' parakeet comes from...

Dog Word Search 2022-12-23

9 Items: tigges breedour favourite petsCharlie's boyfriendwhere we lived abroadmy favourite cocktailyour favourite cocktailmum's favourite word gameour favourite holiday destinationwhat woodland animal piggy looks like

From Head to Toe - Animal Word Search 2015-01-21

12 Items: catsealcamelparrotmonkeydonkeypenguingiraffebuffalogorillaelephantcrocodile

Animals of the World 2024-09-15

15 Items: The largest animal on Earth, found in all oceans.A long-living reptile found in the Galápagos Islands.The largest land animal, known for its long trunk and tusks.The largest primate, native to the forests of central Africa.This bird of prey is the national symbol of the United States.A large, herbivorous mammal with one or two horns on its nose....

Sukkah Word Search 2023-09-21

19 Items: schach must grow from thisschach must be _ from the groundschach can't become spiritually _animal _ can't be used for schachThe sukkah must be at least 10 _ tallThese must be put up before the sechachThe sukkah can't be higher than 20 _ tallThis must be put on the sukkah every yearThe sukkah must be at least _ tefachim wide...

Reyna's Favorite... 2023-10-05

21 Items: WordFoodColorGroupSnackFruitDrinkAnimalSeasonVeggieTV showCartoonCandy BarComputer GameSchool SubjectWhat on her ceilingItem from McDonald'sWhat she wants to beOverseas place to visitPlace in DC she visitedArticle of clothing, black ...

Nature's Classroom Word Search 2023-11-15

58 Items: preysoilacidhikeadaptnymphbioticcanopyedibleexotichydriclichenmammalnativecenterabioticaquaticaquiferof preydiurnalecologyextincthabitatreptileboatingdomestichumiditymollusksomnivoresandhillsamplingsurvivalcompoundamphibiancarnivorecommunityecosystemelevationherbivorenocturnalcamouflagecrustaceanendangeredcrepuscularevaporationgroundwater...

Différentes classes des règnes végétal et animal 2022-10-06

12 Items: oiseauxpoissonreptilesinsectesamphibienmollusquecrustacéssegmentésmammiféresarachnidesarthropodesmille-pattes

How Well Do You Know Your Wife? 2024-07-18

15 Items: shoe sizemiddle namefavorite coloriloveyousomuchdream pet animalcantwaittoseeyoufavorite NBA teamanniversary monthmy favorite smellwhere is my home?boil favorite foodhow many kids do i wantfavorite sibling ( my own )favorite wingstop wing flavormy favorite color hair on myself

Ecology 2023-04-20

13 Items: Organism that only eats meat.Organism that only eats plants.Animal hunted by another animal.Plants use _____ to make energy.______ eat dead and/or decaying matter.Organism that eats both plants and animals.______ break down dead and decaying matter.All of the energy on earth begins with the ____....

Animal Word Search #1 2013-08-13

5 Items: DogCatBatElephantKangaroo

Flower Word Search 2023-04-17

5 Items: a animala plant that growssomething to write witha place where kids learnwork given to do at home

Cat Word Search 2022-09-15

6 Items: dog's enemyMan's best friendthe king of the junglebiggest mamal in the worldhave white and black list furdangerous animal ini the world

Evolution of plant-based meat - October 2 2023-09-18

6 Items: another word for "delicious"a person who does not eat meat or fishthe soft part of an animal or a bird that can be eaten as fooda great source of vegetarian protein that was invented in Indonesiaa soft white food that was invented in China and is made from soybeans...

animals, animal noises and places where animals may live 2013-02-15

19 Items: catdogpigratliongoatbearbearbirdpumazebrahipposheeppolarmousebunnydonkeyanimalselephant

Diabolical Word Search 2024-08-06

69 Items: PigCowAntSkiCoolAuntKingBakeNeffQuickThumbProudShareLemonPlazaJesseSecretAnimalDonkeyAntlerMelodyZipperBasketMizzouTrumanGalenaTigersFaroutNoxiousPopcornMinimumDogwoodLibraryCornellHearnesColumnsRespectMissouriProofingBlushingInfringeFootballHospitalColumbiaHawthornLafferreMountainsGarrulousRelevanceTranslateAmbiguitySouthwestDiscoveryDiabolical...

CR Amex team 2022-09-29

17 Items: teamsureLDA's petpuntarenasCR capitalmarried manmommy to beproud to beSaprissa' petwhite last namebreakfast to goCosta Rica lifestylead dealers main functionseasonal fruit 2mil el Keveryones fav college drinkCr most exported fruit 2019unexpected animal that joins zoom meetings

Ben’s Giant Animal Word Search 2022-08-25

6 Items: catlionzebrahippoelephantMan's best friend

unit 16 2024-04-24

12 Items: roughnot bendingto get alongextinct animalto stuff tightlycapable of growingto take upon oneselfsomething that protectsan action that is wrongto supply with furniturea person of the same ageto expose to injury or harm

trs23 ver2 u12 2022-11-25

10 Items: 100use your teethopposite of thina big, scary fishopposite of lighta yummy thing to eatcan lift heavy thingswill make you feel scaredtry to run and catch somethingthe outside of an animal or person

A WORDS 2024-02-01

73 Items: asatactaddageagoairallandanyarmartaskablealsoareaawayaboutaboveadmitadultafteragainagentagreeaheadallowalonealongamongapplyargueavoidacceptacrossactionaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistassumeattackauthorabilityaccountaddressagainstalreadyanotherarticleactivityactuallyalthoughamericananalysisanythingapproach...

Animales del bosque 2024-08-22

15 Items: Mamífero elegante con grandes astas, que habita en bosques y montañas.Predador canino, símbolo de fuerza y unidad familiar en la naturaleza.Mamífero salvaje de gran tamaño, conocido por sus colmillos y su fuerza.Ave nocturna con grandes ojos, conocida por su sabiduría en la mitología....

Good Word Search 2024-04-30

7 Items: bonroi des animauxdire quelque choseplanete qui a beaucoup d’eauanimal grands et fin qui rampesentiment quand tu perds ton perefruit rouge qui tombe des arbres d’après Newton

Posties Big Read 0212 2024-01-22

6 Items: doubting that something is true or usefulsolid waste that comes from the bottom of a person or animala large, black and white animal that lives in forests in Chinaa soft, wet substance made from wood, which is used to make papera tall plant with hard, hollow stems, often used for making furniture...

Les mots de Bibracte 2020-04-10

73 Items: fermurrueabriansearmeboiscireclefclouepeehaieminemiremontorgeparcsitearbreautunaversbijoucesardomusecoleeduenelevefleurforgeforumfoyerhachehetrerepasanimalargileatriumbaladebassinbriquebronzecasquecentrechaumechenetchevalclochedessindoliumfauconreleveamphorearverneatelierbeuvraycollegecollineconcertcouventassiettebatimentbibracteboucliercervoise...

School 2020-11-30

72 Items: catdognotteatenrunfunbigsunfoxcowjimlionpenstimewithsaidmilknoonmoonwolfgolfkiwidocsnotszebrahippomathsbookspaperbikesbreakfruithorsetrackafterclassdriveanimalinsideplayedchromeminutepeoplehitingsitingpersonaroundgooglewritingreadingmoaningteacherarguingplayingoutsidepencilsmorningfriendscartonsrunningchickenstudentelephantlearningfightinglistening...

Sight Words 2016-03-10

72 Items: OhEyeAweOweBuyDieLiePieTieByeLyeDyeRyeLoseLoveMoveAcreIsleGloveProveShoveTasteWasteWholeCrepeHasteNicheWhoseWomanWomenAmongPastaAngelWatchCelloHeartMinutePoliceHonestRemoveBeautyPrettyAnimalDebrisDoubleTripleSubtleChangeEngineOfficeRecipeGarageOrangeMachinePromiseApproveComradeImproveSomeoneCroquetColonelTroubleImagineStrangeLibraryHandsomeMosquito...

End of Year Word Search (SSL1) 2024-05-28

31 Items: dog______ear______sun______book______bird______head______food______star______leaf______dirt______lake______woman______write______quiet______angel______fruit______cloud______river______stone______father______window______cookie______summer______I praise______mountain______eye____________elephant____________I'm Great____________Excuse me____________...

Decifrando a Páscoa 2023-03-16

6 Items: Semana...Alimento do coelhoLugar onde se guardam os ovosAnimal que representa a PáscoaDia da Páscoa no calendário semanalProduto que são feitos os ovos de Páscoa

Noah's Ark: Genesis 6-9 2023-07-15

14 Items: Who loved God? (page 27)What covered everything? (page 31)The people _____ about God. (page 26)What did God put in the sky? (page 33)What did the dove bring back? (page 33)What animal did Noah send out? (page 33)What did God tell Noah to make? (page 28)Noah and his family _______ God. (page 33)How did Noah and his family feel? (page 32)...

Cat Word Search 2023-05-02

10 Items: Wild dogLand Sea horseMan's best friendWomans best freindKing of the junglesomething you sleep onworlds largest land mammalpineapples don't belong on _____Animal with stripes in the savvanahthe old way of transportation without cars

September 21st 2024 2024-07-02

20 Items: The officiant's name?What soroity was Taylor in?What month did George Propose?What is Taylor's new last name?Who was Taylor's only Prom date?what is Taylor's first degree in?What is Taylor's favorite animal?What is the couple's favorite sport?Who was George's favorite Prom date?What sport did Taylor do in college?...

Les mots de Bibracte 2020-04-10

73 Items: fermurruevueabriansearmeboiscireclefclouépéehaiehouxmiremontorgeparcurnevertarbreautunaversbijoucésardomusécoleéduenforumhêtremeuleoutilanimalargileatriumbaladebassinbriquebronzecasquecentrechaumechenetchevalclochedoliumamphorearverneatelierbeuvraycollègecollineconcertcouventtruelleassiettebâtimentbibracteboucliercervoisechantierchapellechaudron...

Sight Words 2016-03-10

72 Items: OhEyeAweOweBuyDieLiePieTieByeLyeDyeRyeLoseLoveMoveAcreIsleGloveProveShoveTasteWasteWholeCrepeHasteNicheWhoseWomanWomenAmongPastaAngelWatchCelloHeartMinutePoliceHonestRemoveBeautyPrettyAnimalDebrisDoubleTripleSubtleChangeEngineOfficeRecipeGarageOrangeMachinePromiseApproveComradeImproveSomeoneCroquetColonelTroubleImagineStrangeLibraryHandsomeMosquito...

Units 42-43 Sheet 4 2024-01-01

38 Items: (feminine) the itch, itching(masculine) the (male) nurse(neuter) the (anatomy) bloodto be of interest, interests(neuter) the (animal) octopus(masculine) the (animal) frog(neuter) the court, court roomto vote  (rel, to elect) εκλέγω(feminine) the freedom, liberty(masculine) the (anatomy) brain(masculine) the (anatomy) shoulder...

Animales - Colores - Emociones 2023-03-02

4 Items: someone who's happy (male)the color of Colombia's flagsomeone who's excited (female)big animal that throws water at you

May 2024 Safety Word Search 2024-05-01

10 Items: PPE stands for Personal Protective (9).Ensure that PPE fits each associate (8).Keep human food items in (10) areas only.Always (4) your hands after handling patients.Remember to keep cuts and scratches covered with a (7).Never attempt to treat open wounds without wearing (6).(8) is a common zoototic disease we see at the hospital....

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

Spanish 2023-04-28

27 Items: seazoocitylaketreebearbirdplacemuseumanimalmonkeystadiumtheatermonumentto learnto visitto sunbathenational parkto go boatingamusement parkplay (theater)country, nationto ride a horseto buy souvenirsto rest, to relaxto scuba dive/snorkelatracción, attraction, attractions

Can You Finish This 2023-09-05

76 Items: asatbyaddageagoairallandanyarmartaskbadbutbuycanablealsoareaawaybabybackcalladmitadultafteragainagentagreeaheadallowalonealongamongapplyarguebeginbringbuildaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistbeforebehindbudgetcameraabilityaddressagainstalreadyanotherarticlebrotheractivityactuallyalthoughamericananalysisanything...

Long i spelling- ZB 2023-11-15

5 Items: the opposite of day.a small, quiet animal.another word for okay, or good.you eat these, made from potatoes.feeling quiet and nervous to share.

trs23 ie2 u6p2 2023-02-07

10 Items: Not the same.Green thing with leaves.E.g. chicken, pork, beef.E.g. bread, rice, noodles.E.g. milk, cheese, yoghurt.E.g. sardines, tuna, salmon.E.g. lettuce, carrot, potato.E.g. apples, bananas, oranges.E.g. lion, dog, crocodile, mouse.Some food between two pieces of bread.

trs23 ver2 u7 2022-10-19

10 Items: 365 dayslittle animalclean with watermeal at 12 o'clocksomeone in your familymake a picture with a pencilby yourself, just one personTomorrow I ____ go to school.You ____ to drink water every day.It is 4:20p.m. Class will finish ____.

애완동물 Word Search 2024-09-08

25 Items: nowfishyardbabya petchickhouselatermotherfatherto dieto liketo livetogetherapartmentto be sadto be bigdog, puppyto grow upto be goodto be rightmiddle schoolto hate, disliketo hear, to listen toto raise, to grow animal

Les mots de vocabulaire 4e classe 2021 2021-12-13

77 Items: mairatétéjourmoismarsjuinaoûtchatloupoursbleuvertnoirgrislundimardijeudisamdiannéeavrilchienvachelapinverbelavernagervolerrougejauneblancmauvehiveranimalchevalsourisoiseaucochonrenardsautercachermangerparlerrampertombermarronorangevioletsaisonsemainejanvierfévrierjuilletoctobreanimauxpoissonmarchertrouverchasserbrillercreusercouleurautomnemercredi...

Les mots de vocabulaire 4e classe 2022 *** 2022-01-13

77 Items: mairatétéjourjuinchatnoirgrisbleumarsaoûtloupvertoursmoismauvenagerlapinchienannéejeudilaverrougehiverblancverbelundimardivachejaunevoleravrilmarroncochonsouriscachersaisonparlerrenardchevalsamedianimalsauterrampertomberorangevioletmangeroiseauautomnecouleurbrilleroctobresemainejanviertrouverjuilletfévrierpoissonchassercreusermarcheranimauxchercher...

Les mots de vocabulaire 4e classe 2021 2021-12-13

77 Items: mairatétéjourmoismarsjuinaoûtchatloupoursbleuvertnoirgrislundimardijeudisamdiannéeavrilchienvachelapinverbelavernagervolerrougejauneblancmauvehiveranimalchevalsourisoiseaucochonrenardsautercachermangerparlerrampertombermarronorangevioletsaisonsemainejanvierfévrierjuilletoctobreanimauxpoissonmarchertrouverchasserbrillercreusercouleurautomnemercredi...

Random stuff im learning :D 2024-01-18

11 Items: live in a shellsad__ - adverb -slow__ - adverb -quick__ - adverb -5/7 - 2/3 = ? - simplify -2/3 - 3/8 = ? - simplify -6/7 - 2/6 = ? - simplify -4/6 - 4/8 = ? - simplify -4/5 - 2/3 = ? - simplify -an animal that unpollutes waterpeople were over harvesting them in Chesapeake Bay