and the blade Word Searches

Millie's camp word saerch 2025-08-06

16 Items: andfoxbigclipfoodfreetimeflingswingsleepclimebdinnerlslandcabinesphillipbreakfast

Proverbs 22:1 2026-02-08

19 Items: AISTOBEANDANDGOODNAMETHANTHANGOLDGREATFAVORRATHERCHOSENRICHESLOVINGRATHERSILVER

A Word Search 2022-06-28

18 Items: aambyatbeandbutcanarecaratecatcowbedcameawaycomebrown

Reading By Design Volume 1 Lessons 1-11 Review 2025-05-06

18 Items: itisastapsapfantipnapladliddidsadsipdaddippadanddill

Power Words Level 1 2025-10-14

18 Items: AATIFINITONUPANDBUTCANDIDGETHADHIMITSNOTJUSTWILL

Connectors 2025-11-10

18 Items: SoAndButAlsoThenFirstAfterHoweverBecauseFirstlyFinallyMoreoverAlthoughThereforeMeanwhileFurthermoreNeverthelessConsequently

Birthday 2014-02-28

17 Items: 12345678910111213andnowyouare

Photosynthesis and Cellular Respiration 2021-11-01

17 Items: RawandfungiplantsglucosearchaeaanimalsProductsbacteriaprotistsmaterialsProducersConsumersAutographsRespirationHeterotrophsPhotosynthesis

Sports 2021-11-13

17 Items: andjudopolotrackfieldboxingridingrowingtennisarcherybowlingsailinglacrossehandballhorsebacktaekwandowrestling

Level A Week 1 2024-09-09

17 Items: aasadandcanmanaskhadhaswasaddplanhandthanthatlaststand

Power Words Level 1 2025-10-14

17 Items: atifinitonupandbutcandidgethadhimitsnotjustwill

Conjunctions 2026-02-04

17 Items: ifasorsoforandbutnoryetwhensinceafterwhileuntilbeforebecausealthough

Vocabulary words 2024-12-05

12 Items: a fat protein unita basic fat moleculethe basic building blocks of fatturns vegetable oilds into solidsan amino acid that your body needs but cannot makea food that lacks one or more essential amino acida food that contains all nine essential amino acidsa molecule that combines with other amino acids to make proteins...

Unit 1 Form 3 2014-10-15

19 Items: heandyousheunitthisMisswhatyournamelatehellosorryBritainAmericaFinlandEstoniaGoodbyeGoodmorning

Python 2020-06-21

19 Items: ifinorintanddefelifelseinputprintrangewhilebreakclassPythonreturnprogramnaredbeprogramiranje

First Grade Fry Words 1 2022-09-12

19 Items: aamanasatbebyallandarebutcandaydidbeencomeaboutcouldcalled

Thursday Word Search 2025-06-28

19 Items: andreadstembooksearlydailyshelfspacecivicssportsoceanschapterdisplayanimalsconceptsfairytaledemocracydinosaursnonfiction

Layer 1 Red Words 2025-11-10

19 Items: forandseehaswashissheputhowyousawwhotheyfromcomewhatwantdoeshave

Love 2016-05-03

20 Items: catdoggodmomdadgasandsadmadyouhoplionlovekisskidsyouryourzebrahippoelephant

DOLCH SIGHT WORDS - List 2 2016-06-10

20 Items: toheitofinonandoneyouwashissheforsadbuthadthisthatsaidthat

Bible 2025-01-11

22 Items: ofbetoasButhisandhiswayandallyouseekwillwellfirstdoingthesegiventhingsthingskingdom

Layer 1 Red Words 2025-11-10

19 Items: forandseehaswashissheputhowyousawwhotheyfromcomewhatwantdoeshave

ADJECTIVES ENDING IN -ED & -ING 2024-05-14

18 Items: Causing anxiety or concern.Causing astonishment or shock.Feeling great surprise or wonder.Feeling in need of rest or sleep.Causing great surprise or wonder.Feeling calm and free from stress.Causing someone to need rest or sleep.Causing curiosity or holding attention.Feeling very enthusiastic or very happy.Causing enthusiasm and extreme happiness....

Beginning of Moses 2025-11-14

26 Items: SeaBushVeilRiverSinaiTorahAaronLeaderSaviorCanaanMiriamProphetPlaguesPharaohLawgiverMediatorof EgyptCovenantof StonePassoverDaughterDecalogueWildernessof the SeaIsraelitesCommandments

Chapter 9 Special Education 2025-03-11

10 Items: What is an AAC device used for?What has two requirements for assessing students with disabilities?What kind of assistive service is provided to special education students?Representation, expression, and engagement are the three key principles of what?What kind of tools like crutches, wheelchairs, joysticks, and alternative keyboards fall under?...

POSTIES 0127 BIG READ 2024-12-27

6 Items: Oyster shells are mostly made of _____.to make new objects out of waste materialused to describe someone who is slow to act because they feel uncertainBefore the oysters can be sent to Green Island Cement, the hotel staff must _____ and store them.a grey powder used in building which is mixed with water and sand or stones to make a hard substance...

Connectives and time openers 2014-09-03

15 Items: soifandbutwhenthennextfirstsecondlastlybecausehoweverfinallyafterthateventhough

1st Year anniversary 2025-03-16

15 Items: ImyandYouAllLoveWithMarchJulioFirstHeartHubbyWifeyDeniseAnniversary

Kindergarten Words 2025-04-25

15 Items: youandwassheforarehadliketheythatwentwithhavethisfrom

Ten Word Search 2025-08-05

15 Items: Itenzipjobandyouleftlandnextjumpnameheatninesoapwave

One year anniversary ❤️ 2025-08-18

15 Items: MyOneAndYearLoveBabyGirlAdoreAdmireAlwaysWorshipForeverObsessedBeautifulAnniversary

Counties in Ireland 2023-11-29

7 Items: The capital of IrelandHas the Cliffs of MoherHome to the Munster Rugby TeamThe smallest county in IrelandHas the highest mountain in IrelandHas the most southerly point in IrelandA county in the north of the country that is not part of Northern Ireland

World Safety Month Word Search 2 2024-04-08

20 Items: I wear my _____I _____ the joblikelihood x consequenceI follow my lifting _____I _____ myself against fallsabsolute way of life at TerexI _____ myself in a safe zonethe most effective hazard controlset of behaviors that prevent SIFsthe least effective hazard controlthink _____, work _____, home _____set of behaviors that prevent common injuries...

ANYTHING AND EVERYTHING HOLIDAYS 2025-12-03

20 Items: _____ NavidadAll I Want for Christmas is...Jewish candelabrum for HanukkahClassic spiked holiday beverageUnder which people are smoochingA ski/snowboarders winter must-haveMay or may not be a Holiday movie...At the front, pulling Santa's SleighTraditional French Christmas DessertA region that experiences Polar Night...

The best Word Search because Joseph made it 2022-11-28

10 Items: Lowest part of a waveThe highest part of a waveWhat frequency is measured inThe distance from crest to crestdistance between crest and troughMaximum displacement in a longitudinal waveMaximum displacement in a longitudinal waveWave motion that is parallel to wave directionNumber of waves or vibrations produced per second...

Week 4 Vocab 2026-02-09

10 Items: To go before__________________To think about carefully__________________Making something for sale__________________To advance in rank or position__________________Factory where something is made__________________To give someone a particular job__________________To make people aware of something__________________...

W Words 2023-04-28

10 Items: thin and weakextreme angercareful, cautiousTo bring about or inflictphysically and mentally fatiguedTo quarrel in a noisy or angry wayto roll about in a lazy, clumsy, or helpless wayto draw back suddenly, as though in pain or fearAn intentional, knowing relinquishment of a legal right....

Hello Kobi! I have a question for you. 2016-04-24

14 Items: gotomeonyoutwoandwillpromwithjunetenthsixteenthousand

• W O R D S E A R C H • 2022-11-12

15 Items: inandandoldyourlifegrowhappyzharaenjoyweddingforeveryanuardytogetherhappiness

Sight Words 2024-02-13

14 Items: goinandbigcanforawaybluecomedownfindhelpherefunny

FFA Creed (1st Parragraph) 2026-01-22

4 Items: yearsways, even as the better things we now enjoy have come to us from the struggles of formerby the present and past generations of agriculturists; in the promise of better days throughBELIEVE in the future of agriculture, with a faith born not of words but of deeds - achievements

Vocabulary 2025-11-20

15 Items: A nerve cellRemoval of wasteProcess of taking in substancesTissue that receives & sends signalsa unit used to measure the energy in foodswavelike muscle contractions that push foodplant material in food that is difficult to digestan organic molecule made from a chain of amino acidsTissue made up of skeletal, cardiac, and smooth muscles...

Gather Word Search 2024-10-07

71 Items: aannoatbyinofontoorsoifcutmixtheanyfewforoffoutandbutstirtestthisthateachsomemanyfromintowithwhenapplycheckthesethoseeveryaboutaboveafteralongamongbelowunderuntilwhilegatherattachinsertremovesecurefollowacrossaroundbeforebesideduringinsidetowardsince.measureinstallagainstbeneathbetweenoutsidethroughbecauseassemblealthough

Rescue in the snow 2026-01-21

10 Items: – burned very brightly– to break into many pieces– moved smoothly and quietly– needing to be done right away– a person who writes news stories– a big snowstorm with strong winds– cleared snow or dirt out of the way– a ride you sit on to slide over snow– something very bad that causes damage– moved your head up and down to say yes

Connectives  2016-11-04

18 Items: soorifandbutwhenthennextwhilesinceunlessbecausefirstlyfinallythirdlyalthoughsecondlymeanwhile

Back to school 2020-09-08

18 Items: wenoyouandyesthisthattheyrulercrayonpencilrubberlessonpupilsplaytimescissorslunchtimeplayground

7PreAlgChp2DcmlOprtnsVcblry Name____________________Date_________Period___ 2023-10-23

18 Items: andruledigitrounddecimaldivisornumbersdividendestimateexponentisequaltoislessthannumberlinereasonablecompatiblestandardformisgreaterthanscientificnotation

Video Games 2025-11-10

34 Items: GTAPeakPUBGFIFABlurSkateRobloxMaddenPortalBurnoutDestinyFar-CryFortniteThe-SimsValorantMinecraftOverwatchHelldiversBattlefieldAngry-BirdsClash-RoyaleNo-Man's-SkyHollow-KnightPath-of-ExileMarvel-RivalsCounter-StrikeNeed-for-SpeedThe-Last-of-UsCrash-BandicootMetal-Gear-SolidLeague-of-LegendsKirby's-Dream-LandRed-Dead-RedemptionThe-Legend-of-Zelda

Brian's Winter Word search! 2024-04-26

12 Items: to light something on fireto drool saliva while eating something.a piece of ground rising on a marsh area.a person that opposes an enemy or opponentsomething that you need to survive in life.to close something very tightly and securely.stripped leather that can be used as material.sealed enough so that air cant escape or get in....

Equalforces Word Search 2025-12-16

17 Items: to take inwhen light bendsto bounce off a surfacea form of energy we can seean object that stores energya form of energy we can hearthe stored energy an object hasforces that have the same strengthforces that have different strengthsa device that opens and closes a circuita form of energy measured by temperature...

Dolphin Word Search 2025-02-11

10 Items: A highly intelligent marine mammalA crustacean known for its large clawsA marine organism that forms coral reefsA small fish known for its horse-like headThe largest mammal on Earth, living in oceansA large predatory fish found in oceans worldwideA gelatinous creature with tentacles that can stingA slow-moving reptile, some of which live in the sea...

Happy Valentine’s Day 2026 2026-02-07

10 Items: First dinner dateWhere our story beganWhere we made it officialWhere I first held your handFirst concert we ever went to together3am Adventure where we almost got stabbedWhere we go to see stars and the city skylineA little reminder of my feelings towards you ❤️The first song you ever sent me that got us to start talking...

Sleep Word Search 2023-02-20

12 Items: readsleepwatch tvdo sportgo swimminggo shoppingmeet friendsplay the pianoplay the guitarplay basketballplay video gamesgo to the cinema

Kids  2016-11-24

19 Items: AntAndArmBatBunBigCanCutDogDigDotDenEggElfEndFogFinFunCake

Conjunctions Wordsearch 2023-10-24

19 Items: orsoasifandnorbutyetthatwhenaftersinceuntilwhilebeforethoughunlessbecausealthough

Modal verbs and linking words 2023-11-27

20 Items: maycanandmustmustwillhaveneedalsolastcouldshallwouldshouldusedtohoweverinsteaddespitecomparisonparticulary

loveletter2leyla 2024-08-21

20 Items: soareredareandyouare2blueare3goldrosesfartsstinkyvioletsfreedomamericaleylasbackbadsingerssihamsbugeyesdaddylonglegs

Psalm 139:14 2025-01-10

22 Items: iiyouyouandareandwillhavebeenmadeyourknowthisverywellworkspraisebecausewondrousremarkablywondrously

Transition words 2025-10-07

19 Items: soyettoobutandalsonextthenfirstafterlaterbecausefinallyhoweveranothermoreoveralthoughthereforemeanwhile

The Senate and House of Representatives 2026-02-16

14 Items: RedLawsHouseBillsGreenTeamsSenateLeaderVotingSenatorParliamentElectorateIndependantsRepresentatives

metadiscourse 2017-10-01

17 Items: orbutandbutforyetminefirstlastlyhoweverbecauseperhapsfinallymoreoverthereforedefinitelyunfortunately

Sight Words Unit 1-5 2021-12-22

17 Items: arewasandhishassheforwasonehavefromweredoessaidtheyyourinto

eihfjj31 2025-01-28

16 Items: ayissowowbyeandbutloveboomgoodhelloboringhelpfuleverydayknowledgecivilization

k 2025-05-07

16 Items: forandredvotenorthshoreschoolkaitlynhistorystudentmustangshistoriangraduationgovernmentrepresentativerepresentation

Staveord 1 2025-11-06

16 Items: andondindbåddumtrundskibbrevtandflydebølgebilligkøkkenfryserpostkassetrillebør

Commas IN A Compound/Series Sentence 2026-01-13

16 Items: OrSoForAndNorButYetListCommabreakSeriesFanboysSeparateCompoundSentenceCoordinatingConjunctions

Hobbies Teens 3 2015-02-25

12 Items: readdrawsingdancemake-artdo-karatedo-karateplay-gamesplay-soccerwatch-a-movieplay-the-guitarbrowse-the-Internet

Movie Title Word Search 2025-10-08

10 Items: Count Orlok's alias.Your favorite 90's ghost (animated).Toni Collette was robbed of an Oscar for the crying in this film alone.Brillant young women who is looking for a companion to face this cold cruel world.Fantasy story that involves a girl named Sarah, a Goblin King and a kidnapped baby brother....

Pepe Word Search 2025-08-29

7 Items: Vote into officeGroup of 52 cardsBuild a skyscraperQuick kiss on the cheekRomantic cartoon skunk LePewSomething to follow in gamesColors like burgundy and scarlet

Be Word Search 2022-08-02

18 Items: begoandnotthygodnotgoodfearthemlorddoththeefailstrongafraidcourageforsake

Wildcat Issue 2 2025-11-21

17 Items: IandsadNounVerbwordlovegoodStuffThingPlacewordshappyPersonobjectcryingderanged

Acronyms for Medical Coding Governing Organizations 2025-03-15

35 Items: Nurse PractitionerPhysician AssistantOffice for Civil RightsElectronic Health RecordAdvance Beneficiary NoticeCurrent Dental TerminologyEvaluation, and ManagementAmbulatory Surgical CentersOffice of Inspector GeneralAmerican Medical AssociationCertified Professional CoderLocal Coverage DeterminationNational Provider Identifier...

At- word Family  2014-12-16

15 Items: catratcathatfatmatandbigsatthatawayblueflatchatsplat

HFD U4 Word Search 2023-12-03

14 Items: inandarehistootwohavesaystellthemtheywantwhatgives

logic circuit 2023-12-18

14 Items: orandnotonetruezerofalselogicbooleanconditionlogicgatetransistortruthtablelogiccircuit

And Word Search 2024-07-11

14 Items: asandcanmanaskhashadwasplanhandthanthatlaststand

connecting words 2025-03-22

14 Items: soandbutalsohoweverbecausemoreoveralthoughthereforeasaresultinadditionfurthermoreconsequentlyontheotherhand

Royal Tribune 2019-01-11

21 Items: PopELAMr.ArtandandMathClubRoyalMusicSportRoyalscultureDebatesAlfredoFacultyTribuneShiningScienceFitnessActivities

Abhorrent Word Search 2023-06-30

20 Items: andafootalertaortaabsurdaccuseassumeactuateadvanceadverseanalyzeantonymanxietyanythingassembleabhorrentaestheticafternoonadolescentasymmetric

Us 2024-11-05

20 Items: wesoasbemyourandyouhavewithwillspentenjoybeingbeginstogetherbirthdayseachotherbaecationgirlfriend

Madeleine's Amazing Word Search 2025-09-22

20 Items: ishoptopmoppopandpothotgotnotdogjogfoghogforboxfoxmixsixare

Madeleine's Amazing Word Search 2025-09-22

20 Items: ishoptopmoppopandpothotgotnotdogjogfoghogforboxfoxmixsixare

Madeleine's Amazing Word Search 2025-09-22

20 Items: ishoptopmoppopandpothotgotnotdogjogfoghogforboxfoxmixsixare

3rd Grade Since: Bones and Joints in the Body 2020-10-05

20 Items: ribandballtibiafemurhingepivotjointpelvissocketpartlycraniumpatellascapulaglidingmovableclaviclemandiblephalangesimmovable

Romeos Food 2022-03-17

21 Items: macandhotfishricesteakpizzafriesfriedcheesenoodlechickenschrimpburgersnuggetspocketschickencrablegskentuckychilidogschilicheesefries

Canada provinces and territories 2022-03-22

20 Items: NEWANDNOVAYUKONSCOTIAPRINCEEDWARDISLANDQUEBECALBERTABRITISHNUNAVUTONTARIOCOLUMBIAMANITOBALABRADORBRUNSWICKNORTHWESTTERRITORIESNEWFOUNDLAND

Here Word Search 2022-12-21

20 Items: petdayhimyesforcanandseedogmanpigoutmayoldboywascathereridewill

Cups Word Search 2023-06-24

20 Items: andpancupspotspansbowlslowscaletimerwhiskknifesheetsautédutchbakingmixingkitchencuttingskilletrollingpin

Composition Word Search 2023-06-24

20 Items: artpenandinklineyarnhookcowlmixedsocksdoilystitchedgingdoodlescrochetpatternbootiestunisiancompositionillustration

Faithful God - Chelsea Stanley 2023-12-09

22 Items: beofheheisyoucangodyouhisandsurethislovesneveralonebreaksalwayshappenswhateverpromisesfaithful

This Word Search 2024-01-24

21 Items: weonandtopandwillgrowlongtermhighsafebasedsoundassetsprosperqualityserviceethicalbuildingstandardsrelationships

MATHS REVISION 2024-02-07

20 Items: oddandevenplustakeordertablenumerographsregularnumbersshuffleadditiongeometrymultiplysubtractirregularsubtractionmeasurementmultiplication

oliver ferie 2025-06-24

20 Items: andlynprutplusstolvindluftmadsemilquakskabgangeminusrobineliaspokalrobloxolivertordenfortnite

Whiny A 2025-09-22

20 Items: amanifincanmanpanfanSamPamtanantandfitpitpattipsatnapnip

Sequence Clue Words 2025-12-05

20 Items: ANDENDNEXTTHENFIRSTTHIRDAFTERANTESFINALSECONDBEFOREFINALLYPROXIMODESPUESPRIMEROTERCEROSEGUNDOENTONCESSIGUIENTEFINALMENTE

Spelling Words 2026-01-11

20 Items: byskytryandeatpinkslamgamehomehidejumptimeyeareachreaddrinkthinkthingteachfumble

Week 1 & 2 2026-01-21

20 Items: itrugcowbusruntoycanandeggswormseescornpumpplaytigerdresscrayonrainbowtoastersomething

Walker Filtration Oct 2025 2025-07-03

24 Items: AftershaveNoddys mateThe big blueLarge planetRed and juicyBlack and redType of appleType of appleHome of MickeyLargest house catBoiled or pickledH R Giger creationSlang for NewcastleTakes arial footageDave sings for theseElephant with big earsSome like it some dontSinger from North EastDave drummed for theseListen to music on these...

Santa Word Search 2025-12-04

20 Items: Another Christmas colorA sweet treat for SantaWhat Santa checks twiceThe man who brings giftsA bright Christmas colorA person made out of snowSomething you give someoneA ribbon tied on a presentWhat makes the tree sparkleSomething you wear to keep warmWhite flakes that fall in winterThe decorated Christmas evergreenSomething you ride on in the snow...

Brojevni sustavi i logički sklopovi 2020-06-19

13 Items: DORNOTANDNORNULAJEDANBINARNIOSTATAKOKTALNIDEKADSKIINFORMATIKAHEKSADEKADSKI