and the blade Word Searches

CFE Review 2025-05-15

18 Items: another name for a slatethe most natural camera angleanother name for a sd card readeranother name for a camera operatorcoordinates all areas of productionwho is in charge of coaching the actorsthe most perfect, beautiful dog in the worldthis communication style is mean and overbearingthis angle makes characters appear large, strong...

Our Pets 2024-07-09

8 Items: eats bugssits prettydainty lil thangorange and sturdyloves blueberriesloves gatorade bottlesruler of the countertopsone of these is not like the other

Juneteenth Word Search 2023-06-16

15 Items: to ask for somethinga synonym of documenta financial institutionthe reason we do not work 6/19agents provide this to borrowersagents answer this when it ringsUCC-1 and UCC-3 are a form of thisagreement between two or more partiesrecognition for good work/performancemethod by which time off requests are sent...

Disneyland Word Search 2025-05-06

11 Items: The AP title I holdThe middle school I attendedMy favorite place on planet EarthIn 5th grade we took a 3-day field trip hereMy favorite band that l've seen 5 times since 2018The first film I made to be shown in film festivalsLa La _____ The first movie I remember seeing in theaters....

Mike Rowe's Dirty Jobs 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

Mike Rowe's Dirty Jobs 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

Chapter 8 2025-11-23

17 Items: Linear ordering of monomers in a biopolymer.enzyme that cut foreign DNA at specific sites.A monosaccharide with a phosphate group attached.Large conformational change of the enzyme and DNAA critical structural feature in certain biological moleculesEssential molecule that stores and transmits genetic information....

dessert 2024-07-19

15 Items: A French pastry made from choux dough filled with cream and topped with chocolate icing.A rich, chocolatey square or rectangular baked dessert, often dense and fudgy in texture.A small cake baked in a cup-shaped container and typically decorated with frosting or other toppings....

routine 2026-01-15

23 Items: cookget upwatch TVgo joggingmake my bedwalk the doggo to schoolse the tabletidy my roomride a horsedo the dishesfeed the fishset the tablehave a showerhave breakfastdo my homeworkdo the shoppinglisten to musicwater the plantsplay in the gardentake out the rubbishcome home from schoolvisit my grandparents

Investing 2024-11-13

8 Items: Your 401K plan is for __________You sell stocks when they are ______You buy stocks when they are _______The lower the ______, the lower the return________ is money not backed by the government________ is the share of ownership in a companyIf you buy stock for $10 and sell it for $25 you made a _____...

Word Search Vocabulary - 6th Grade 2025-08-21

15 Items: - Developing.- Dried up or wilted.- Destruction or ruin.- Beginning or starting.- In low spirits; sad or gloomy.- Suggesting subtly or indirectly.- Made almost blind by bright light.- Long period with little or no rain.- To bear up under or function in spite of.- To take in with the mind or senses in a greedy way....

The Sun and the Moon  2020-12-05

12 Items: SunDayMoonDarkHeatNightStarsBrightSummerWinterSunscreenSunglasses

The Ant and The Grasshopper 2025-11-21

12 Items: ANTFOODWORKSINGCOLDHAPPYFIELDWINTERSUMMERHUNGRYSHELTERGRASSHOPPER

Parshat Shemini 2024-04-05

15 Items: Hebrew for "Tabernacle"Moshe gets upset with himHebrew for "Divine presence"Another word for split hoovesKosher fish need _ and scalesHebrew for "impurity" (not found on Chabad)The Torah lists the kosher version of this insectAaron's sons died after bringing this type of offeringKohanim are told not to drink this before doing the avodah...

Gavin's Sight Word Word Search 2024-01-26

45 Items: inofonwedomygomeuphetoitnoisamtoothearedadhasyeswasmomcanandyouseewhoforcomelovesaidherelikehaveplaytheydoeslookthishelpwithgoodwherelittle

8th grade Noah 2024-05-15

15 Items: Charging an object without touchingThe number of protons + the number of neutronsa material in which charges cannot easily moveThe number of protons. It is also the number of electrons.An unbalanced amount of positive charge and negative charge.An object with equal amounts of positive and negative charge...

The Bedroom and the Bathroom 2025-09-03

12 Items: bedsinktowelclosetwindowshowermirrortoiletpillowblanketbedroombathroom

The End and the Beginning 2025-09-18

12 Items: The poet's ________ created a sad tone.Szyborska's ______ was partly created by her diction.Harry Potter has a ghost with a partially _________ head.The poet used _________ to create a vivid mental picture.The ATV got _________ after we tried to cross the stream.Our poem contained _________ of the phrase "someone has to..."....

The Fox and the Crane 2025-12-09

12 Items: foxmayslydoorstewmealbeaksoupcranetrickslurphungry

The Boy and the Giant 2026-01-17

12 Items: KingSaulFellFightGiantDavidPowerIsraelAfraidStonesDefeatPhilistines

CNA Lesson 17 Review 2023-01-22

15 Items: walkingturning upwardturning a jointturning downwardbending backwardbending a body part or jointstraightening of a body part or jointmovement of a limb toward the midline of the bodymovement of a limb away from the midline of the bodydevice used to maintain a body part in a fixed positionpermanent stiffening of a joint or muscle caused by atrophy...

CRANBERRY SAUCE 2025-10-29

26 Items: RUBYTANGYPECTINHARVESTJELLIEDRESIDUEACERBITYEMULSIONFRUCTOSEGELLATINPRESERVETARTNESSALLEVIATECONDIMENTCRANBERRYACCEPTANCEAMELIORATECONCOCTIONDELECTABLECARMINATIVE28: CRANBERRY SAUCEA: Medium Difficulty Lists (15x15 Grid)Puzzles 28-45: Remaining Challenging Word Listslists complete your 45-puzzle project and are ready for your generator....

Camping 2025-08-20

23 Items: A person who goes campingA portable shelter made of fabricA path used for hiking or walkingA device used to determine directionAustralian version of a sleeping bagThe open air and natural environmentCatching fish, often in lakes or riversA tool for cutting and various other tasksA portable stove used for cooking outdoors...

Truthinsavingsact Word Search 2023-11-30

15 Items: People before _______.Be an effective _______.You should not be eating or ______ gum while assisting customersAnyone entering the bank is either a customer or a _________ customer.Annual Percentage Yield should always be expressed to ____ decimal placesA percentage rate reflecting the total amount of interest paid on an account....

Anniversary Silly Search 2024-08-22

15 Items: The most wonderful drinkA favorite Western holiday for usAn object in the sky we both adoreA favorite weather event for us bothA desi drink we both have almost dailyYour Disney plushy friend won at a county fairThe name of the trivia game we played early onA reality show we watch with the romance and drama...

Nerdy Birdy Tweets 2025-10-08

15 Items: Clue: What you do when you want to see someone's posts on social media.Clue: What you do when you want to stop someone from contacting you online.Clue: The platform where Nerdy Birdy shares his thoughts with his followers.Clue: A bird who seems to enjoy picking on Nerdy Birdy, causing trouble online....

Solar System Word Search 2025-05-14

11 Items: BlueGrayOur homeVery brightOur home planetVery hot and coldNamed after PoseidonHas magnificent ringsPotential home for humansLargest planet in the solar systemHottest planet in the solar system

Chapter 47 2025-11-29

10 Items: EarwaxDizzinessThe absence of sightDecreased hearing ability due to agingA ringing, roaring, hissing, or buzzing sound in the ears or headThe total or partial loss of the ability to use or understand languageloss Not being able to hear the range of sounds associated with normal hearing...

Particle Theory 2026-02-03

25 Items: pasma to gassolid to gasgas to solidgas to plasmaliquid to gasgas to liquidsolid to liquidliquid to solidmovement of particlesspace an object occupiesdefinite shape and volumemade of charged particlessmallest particle of matterhas mass and takes up spaceatoms chemically bonded togethermeasure of how fast particles move...

9-1-1 Word Search 2024-11-22

16 Items: Is allergic to dogsIs currently missingGrew up figure skatingAlmost died this seasonSaid “it’s not abnormal”Had to live with the enemyNamed after his grandfatherRightfully assaulted an ableistIs also missing (for 2 seasons)Almost died from choking on breadGot shot when they were a teenagerHas the cutest and most stylish outfits...

Countries 2024-10-09

31 Items: PeruChileChinaEgyptIndiaItalyKenyaKoreaSpainBrazilCanadaFranceMexicoNorwayRussiaTurkeyFinlandGermanyVietnamThailandAustraliaSingaporeAzerbaijanNew ZealandSaudi ArabiaSouth Africathe Maldivesthe Netherlandsthe Philippinesthe United Kingdomthe United States of America

Vocabulary Units 6-7 2024-04-24

12 Items: DJ = Disc ...The words of a song.A very popular song.To chase, catch or kill wild animals.A type of music that comes from Jamaica.You can use this to help you climb a mountain.The singing in a piece of popular music (song).A type of dance and music that comes from Brazil.The place where people sleep when they go camping....

High frequency facials and machines 2023-03-07

25 Items: the ozone has a ___________ smell to it.High-frequency _______ oxygenate the skinThis treatment promotes _______ productionthe high-frequency machine creates ______.high-frequency machine __________ the skin.This treatment promotes ________ stimulationhigh-frequency machine stimulates ____________.High-frequency devices kill ________ with contact...

Vayetze 2024-12-01

18 Items: “Law”Teshuvah“he departed”Jacob’s fatherLaban’s father.“Judah”means ??Rachel’s firstbornhis name means “joined”Jacob served Laban here.his name means “judgement”his name means “fortunate”his name means “see! a son”Where did Jacob depart from?“the place” was this mountain.To Jacob, seeing her, it was love at first sight....

Benefits of strategic planning - strategic thinking: find the words in the puzzle and fill in the blanks 2026-01-13

7 Items: ................. the business's plan to othersDevelops a sense of ................ of the planClearly defines the ................. of the businessProvides a base from which ................. can be measuredCreates a strong cohesion that builds the .............. of a businessEstablishes realistic .............. and objectives within a time frame...

Find the underlined words. 2025-01-21

5 Items: What do Croatians call their country? Hrvatska.What is the name of the sea between Croatia and Italy? Adriatic.What is the name of the first Croatian king, crowned in the 10th century? Tomislav.What is the name of the unique script used by Croatians since the 9th century? Glagolitic....

Decision Making 2026-01-09

11 Items: To stop developing, growing, progressing or advancingCombination of surroundings, conditions or influencesA thing which is regarded as more important than othersStrategy in which a person goes with their first reactionStrategy in which a person hands over control or lets someone else decide...

Jamestown Word Search 2024-12-13

15 Items: founded in 1607Colony for English Catholicscolony for pilgrims and puritansClimate of the New England coloniessocial contract signed by the PilgrimsLarge southern farms that grew Cash Crops1st Anti-Slavery Group in the 13 ColoniesNorthern slaves worked in these occupationsBritish controlled trade, angered colonists...

Gabrielle & Andrew 2025-05-16

30 Items: Best man's nameGroom's hometownBride's last nameBride's alma materGroom's professionWhere the couple metMaid of honor's nameBride's favorite cityGroom's favorite foodGroom's favorite sportThe couple's college mascotCity where the couple livesThe month the groom proposedBride's favorite movie genreName of the couple's male dog...

Horse Racing 2025-09-14

20 Items: Richest horse race in the worldAmerican mare who won 19 of 20 racesEnglish racecourse famous for The DerbyRoyal English race meeting held every JuneFamous Kentucky racetrack hosting the DerbyLegendary Australian racehorse of the 1930sStakes race that completes the Triple CrownAmerican horse who won the 1973 Triple Crown...

Checklist Word Search 2025-05-26

7 Items: How good the information isHow recent the information isHow well the information is arrangedHow correct or true the information isThe identity of the person who wrote something, especially a bookThe person or company that supports financially to help create or share something...

Tanner's Amazing Robbery Word Search! 2024-09-09

12 Items: Location for our safety zone?How many role cards are there?Dont _____ with the panic alarms!#1 thing you should do during a robbery?Who should you notify after the robbery?How much does the Hold-up Function dispense?________ members when they walk in. ALWAYS!!What do we use to block off the robbed area?...

Pharmacy Week Biometrics Word Search 2024-10-09

12 Items: A1C tests your blood _______ levels._______ (abbreviated version) is also known as cholesterol.Humana’s well-being rewards program is through _______ _______.BMI is calculated using your weight, height and _______ _______._______ (abbreviated version) is also known as good cholesterol....

Vocabulary Klett pp 288-289 2022-08-13

10 Items: synonym: divisionThe political leader of a cityA member of a particular state/countryRules that govern people's lives in a particular countrySomething connected to a certain geographical place or areaThere are human _______, civil _______, animal _______, etc.Official political institutions such as the police, courts, etc....

The Dolphin and the Monkey 2023-03-13

12 Items: SankLiarWavesSailorSplashAthensHonestBreatheSurpriseRememberEnormousImportant

Decision Making 2025-02-21

11 Items: to stop developing, growing, progressing or advancingcombination of surroundings, conditions or influencesa thing which is regarded as more important than othersstrategy in which a person goes with their first reactionstrategy in which a person hands over control or lets someone else decide...

Growth 2023-06-28

12 Items: An animal that eats acornsThis big ape is endangeredThe name of an oak tree's seedThis animal lives in AustraliaThe type of snake that Mr Stones hasThe found that Mr Stones' snake eatsA fruit that is grown in the rainforestWhat you have made from toilet rolls this weekThe continent that Mr Davies' parakeet comes from...

Les Corvees - Chores 2023-03-08

19 Items: when it gets dustywhen the leaves fallwhen the car is dirtywhen you prepare mealswhen the plants dry upwhen the grass gets highdry your clothes outsidewhen the clothes get dirtywhen there's too much trashwhen the kitchen gets dirtywhen there's no food at homewhen you beautify your gardenwhen the house is disorganized...

NMSI World Environment Day 2024 2024-05-09

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

200 - Tools & Hardware 2025-07-18

40 Items: axesawbeltboltcordfilehookmaskraketapeanvilbladecableclampdrillhingeknifelevelmeternailsscrewchiselcuttergasketgloveshammerladdermalletpliersrachetsandershovelsocketwrenchbracketcalipercrowbargrinderspannertoolbox

01 - Garden Tools 2025-07-19

40 Items: axhoesawclawforkhacklawnpickraketrugwirebladeedgerknifespadespiketinestwinedibbergloveslopperprunerscytheshovelsicklestringtillertrowelweederclippergrabbergrubberhandaxemachetemulcherplantersprayersecateurwheelbaryardstick

98 - Saw Blades 2026-01-05

40 Items: bowcutjigripbonebuckchopfrethandholetilebladechaincrownmetalmitrepanelpowersabertabletoothcopingjigsawradialscrollbandsawdiamondhacksawkeyholemasonryplywoodabrasivecircularcompoundconcretecrosscutdovetailalligatoroscillatingreciprocating

The Life and Times of the Ant 2022-12-05

20 Items: dutymoviedailyalleyfiftyemptyturkeylonelycolonysteadyhungryvalleyhockeystarrymelodydrowsyplentyinjurychimneyprairie

Part 2: The Sieve and the Sand 2023-05-10

30 Items: teemmoorstrewchaosrebutmorgueweltertriflequaveroraclesuffusecadencedlinguistfiligreemanifestverbiagebeatificpatronageprofusioninsidiouscertitudediscourseexhalationdentifriceskepticisminvigorateintuitivelycomplementingperfunctorilyphosphorescent

Lion, the Witch, and the Wardrobe Vocabulary 2023-05-10

26 Items: sulkyreignhoarsetriflejeeringbrisklydespairsoothingcourtiergloatingenchantedharboringstratagemearnestlythresholdtreacherousa winter scarfa deception, tricksevere; forbiddingterritories or landquestioning, curiousmournful; sad; pensivefestivity or celebrationunending, lasting foreverpackages wrapped in paperfull of malice; malevolent

The Great Depression and the New Deal. 2024-10-28

20 Items: okiespoliohoboesbankrunhueylongbonusarmyforeclosegrantwoodpublicworksstockmarketgoldstandarddorothealangeinstallmentplanwilliamfaulknereleanorrooseveltfranklinrooseveltsocialsecurityactdowjonesindustrialaveragenationallaborrelationsboardnationalrecoveryadministration

The Serpent and the Wings of Night 2025-11-18

25 Items: lossheirorayagriefNyaxiaritualkejaririshanserpentsecretsVincentcoloniablessingdevotionslowburnbetrayalforbiddennightfallsacrificebloodshednightbornmoonlightascensionbreathlessheartbreak

MY BROTHER'S PECULIAR CHICKEN 2025-10-28

6 Items: He is the oldest man in the village.He is the protagonist and owner of the peculiar chicken.He is the owner of the largest poultry business in town.He is the younger brother who argues that the chicken is a hen.She often cried while the brothers are arguing about the peculiar chicken....

Mental Health Crossword 2024-02-21

15 Items: A cause of stress.Causes extreme mood swings.The act of harming ones self.Way to take a break from feelings.The act of causing ones own death.A feeling of fear, uneasiness, or dread.Expression or release of strong emotions.The reactions on what to do when stressed.Emotional, physiological, and social well-being....

NMSI World Environment Day 2024 2024-06-04

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

Shannon & Matt 2025-03-31

21 Items: Brides hometownGroom's hometownBrides middle nameFavorite card gameGroom's middle nameFirst Broadway showGroom's favorite bandFirst vacation togetherGrooms favorite cocktailDating anniversary monthThe month Archie was bornWhere did the couple meetGroom's most hated animalThe month the groom proposedWhere did the couple get engaged...

Periodic Trends 2024-12-09

16 Items: The most electronegative of - Cu, Au, AgThe largest atomic radius out of - Cu, Au, AgThe largest atomic radius out of - P, N, B, HThe smallest atomic radius out of - K, Fr, H, LiThe largest atomic radius out of - Cr, Ca, K, TiThe smallest atomic radius out of - Sc, Mn, Zn, FeThe largest electronegativity out of - C, Fe, Fr, Ga...

PPE VOCAB 2023-10-25

6 Items: a “water fountain” type of unit designed to flush the eye and face area onlygarments that are specifically designed to protect the wearer from flames and thermal injury.a type of personal protective equipment that goes in the ear canal to prevent noise induced hearing loss...

The Months and Seasons of the Year 2025-05-10

26 Items: MayJuneJulyYearDepuMarchAprilHappyAugustSpringSummerAutumnWinterMondayFridaySundayJanuaryOctoberTuesdayFebruaryNovemberDecemberThursdaySaturdaySeptemberWednesday

Landmark 6: The Tortoise and the Hare 2025-11-04

30 Items: hurryswiftforestreasonslowlywinnersteadyanimalshearingforwarddecidedalreadythoughtquietlyreachedfinallyrelyingslowesttortoiseburstinglaughtergatheredploddingsteadilysleepingcheeringboastfulcarelessastonishedpeacefully

Tom Clancy The bear and the dragon 2014-01-23

20 Items: GENIALDEFUNCTHEATHENPANOPLYCYNICISMFOLDEROLINHERENTSARDONICAPHORISMSCLERGYMENDICHOTOMYASSOCIATESATTENUATEDCURMUDGEONPROSTRATEDSOLICITUDEABERRATIONSERRONEOUSLYIMPLICATIONSPENITENTIARY

Understanding the Presidency and the Executive Branch 2024-12-04

20 Items: VetoTermLawsBranchPowersChecksCabinetEconomyFederalDiplomatElectionCongressBalancesTreatiesPresidentExecutiveCommanderLeadershipImpeachmentConstitution

8_Book One: The King and the Kingdom 2025-05-15

20 Items: GRANTVAULTDEFEATROUTEDBLAZINGEXALTEDMAJESTYRESCUEDBESTOWEDFORTRESSREJOICESSPLENDORSUSTAINSTREMBLEDCONSUMINGSWALLOWEDUNFAILINGVICTORIOUSVINDICATEDADVERSARIES

The Country Mouse and the City Mouse 2025-09-04

25 Items: JoyCityFearLifeMouseVisitFeastPeaceQuietShareTrustDangerCheeseSimpleSafetyLuxuryHumbleWisdomChoiceEnoughCountryContentJourneyFriendsGratitude

Galaxy Christmas Party 2025-12-16

74 Items: deanblockcoachcourtdrivejalenlayuppivotstealtysonassistcarterchargedeaniejaydenkainoapeytoncharliedefensedribbleinboundjabstepoffensereboundtimeoutbackdoorbaselinedeadballeurostepfadeawayhalftimehelpsideslamdunkturnoverbackboardbackcourtbreakawayfastbreakisolationperimetertravelingbasketballbouncepassdoubleteamoutletpasspointguardstrongside...

POKÉMON 1 2023-04-28

6 Items: 001 on PokédexSquirtle evolutionComplete the evolution. MINCCINO,__________.These look alike. Mesprit, Azelf and _________.Complete the evolution. Charmander, __________, CharizardComplete the evolution. _________, Pikachu, Raichu/Alolan Raichu

El tren 2025-04-11

21 Items: Trainaisleticketarrivalthe seattrain cardeparturedining carfirst classtrain trackdestinationsecond classthe scheduletrain stationticket windowthe next stoptrain platformthe waiting roomto get on the trainto get off the trainreducida reduced fair

Quintus' word search 2023-12-19

20 Items: our galaxyglow on it ownpeople draw linesknow as big dippera icy and gassy balllight bounces off itknow as small dipperthe research of spacelook like a big spoonbelief in constellationlook like a small spoonpeople that go into spacefirst day of spring or fallsomething that orbit the sunfirst day of winter or summerwhen a space rock reach earth...

Advanced Roots, Prefixes, and Suffixes 2025-04-14

10 Items: AUTONOMOUS : Independent and self-sufficient; from the prefix “auto-” meaning self.MICROBIOLOGY : The study of microorganisms; from the prefix “micro-” meaning small.MELANCHOLY : A feeling of deep sadness or sorrow; from the root “melan-” meaning black.BENEVOLENT : Showing kindness or goodwill; from the prefix “bene-” meaning good or well....

Harrisonburg Word Search 2024-10-09

24 Items: Bride’s birth monthGroom’s birth monthHoneymoon destinationBride’s favorite showColor of bride’s eyesColor of groom’s eyesGroom’s favorite hobbyWhere the couple livesCouples favorite liquorBride’s favorite cookieThe couple’s dog’s nameBride’s favorite singerMonth the groom proposedCity where the couple metType of dog the couple has...

Polish Verb Iść 2025-11-04

24 Items: the form of "iść" in past tense for "on" (he)the form of "iść" in future tense for "ja" (I)the form of "iść" in present tense for "ja" (I)the form of "iść" in past tense for "ona" (she)the form of "iść" in future tense for "my" (we)the form of "iść" in present tense for "my" (we)the form of "iść" in future tense for "oni/one" (they)...

Los días de la semana y el tiempo buscapalabras 2022-10-26

26 Items: MondayFridaySundayTuesdayThe dayThursdayThe weekthe dateSaturdayToday isWednesdayIt is hotIt is coldthe weatherit is sunnyTomorrow isIt is windyit is snowingit is rainingYesterday wasWhat is the date?what day is today?The days of the weekWhat day is tomorrow?What day was yesterday?What is the weather like?

Hatcho Elementary School 2025-10-05

15 Items: What animal is Mr. Tomono afraid of?The groups made from all grades are called what?What disaster experience did you do in 4th grade?What is the name of the 5th grade English textbook?What sport did the 5th graders practice in PE class?What famous Toyohashi food did you make in 3rd grade?Teachers read books to students during Story __________....

Open House Word Search 2025-07-01

16 Items: Where do you play?Where do you sleep?What has eight sides?Where do you eat meals?What is made from trees?Where meals are prepared?Where do you park your car?What is soft but stepped on?What's the Agent's last name?Where do you store your food?Where is the best place to be?What's the Agent's first name?What holds your plates and cups?...

Cycle 1 Vocabulary Week 3 2024-09-04

10 Items: a trade or professiona colorless, odorless toxic flammable gasthe action or fact of forming a united wholethe number of protons in the nucleus of anatomextending along a straight or nearly straight linea person not in the armed services or the police forcea legal entity that is separate and distinct from its owners...

Michael Jackson's Xmas 2023-10-11

20 Items: ItbadpytJeanMovesof PopNaturethrillermoonwalkCriminalthrilleror Whitethe Timewith Youthe Wallthe Worlddangerousin the MirrorWay You Make Me FeelStop Til You Get Enough

Coating Vocab 1 2025-06-17

10 Items: License Plate Number.The method of joining two pieces of material to form a continuous web.The release material that protects the adhesive layer and keeps it from sticking to itself.The process of switching a production line or machine from running one product to a different product....

dessert 2024-07-19

15 Items: A French pastry made from choux dough filled with cream and topped with chocolate icing.A rich, chocolatey square or rectangular baked dessert, often dense and fudgy in texture.A small cake baked in a cup-shaped container and typically decorated with frosting or other toppings....

dessert 2024-07-19

15 Items: A French pastry made from choux dough filled with cream and topped with chocolate icing.A rich, chocolatey square or rectangular baked dessert, often dense and fudgy in texture.A small cake baked in a cup-shaped container and typically decorated with frosting or other toppings....

dessert 2024-07-19

15 Items: A French pastry made from choux dough filled with cream and topped with chocolate icing.A rich, chocolatey square or rectangular baked dessert, often dense and fudgy in texture.A small cake baked in a cup-shaped container and typically decorated with frosting or other toppings....

Thermal Energy 2023-11-08

6 Items: the energy for heatanother word for heatthe rising and falling of thermal energytransfer of heat through electromagnetic wavesthe direct transfer of heat through atoms movingthe unit of degrees that measure the degrees in something

Expressions and Equations 2025-08-15

7 Items: the answeruses an = signuses a < > signdoes not use an = signthe y variable (depends on x)the x variable (determines y)used to balance and solve an equation or inequality

sail 2025-02-02

12 Items: shippiervoyagecrewmanA device usedAway from the shoreThe left side of a boatThe rear end of the boatThe right side of the boatthe horizontal surface areathe person in command of the sailboatthe direction in which the boat is sailing

Voca 16000 Lesson 1 2025-08-26

14 Items: to cause to be angry or upset (OFF***)to cause to become free of a disease (CU**)to give great pleasure to someone (DEL****)to hit with the hand or with a weapon (STR***)able to be used or possible to get (AV****BLE)food or other things that are thrown away (GAR****)to set apart for a special use or purpose (DED****E)...

3rd Grade Unit 3 2023-02-21

44 Items: mapbookglueflagdoorglobepaperclasslighttablerulerchairchalkerasercrayonpencilmarkerschoolwindowthe pencalendarnotebookcomputerbackpackthe wallscissorsclassroomchalkboardclock/watchwastebasketteacher's deskfemale teacherthe boy studentthe male teacherthe girl studentthe student's deskthe feminine pluralsomefeminine pluralthe-masculine plural...

Sense Organs : The eye and the ear 2023-04-25

20 Items: irispupilincusstapesossiclemalleusglaucomaopticiantinnitusdeafnessscleritismydriasisvitrectomyotomycosisaudiometryastigmatismoptometristaudiologistcholesteatomaconjunctivitis

Part 1: The Hearth and the Salamander 2023-05-10

25 Items: abysscowerpagantallowtampedstratumconjurenomadictactileravenousfeigningpratfallmausoleumdistilledolfactoryprobosciscacophonytrajectoryballisticscentrifugeluminescenttitillationrationalizecartographernoncombustible

The Underground Railroad and the abolitionist movement 2023-06-12

24 Items: starnorthsongstruthcanadaescapehiddenquiltsroutestubmanfreedomharrietnetworkfugitivepathwaysrailroadabolitionsojournerconductorsnarrativesresistanceundergroundemancipationstationmasters

In the Kitchen and In the Bathroom 2025-11-25

20 Items: panfanbowlsofalampbookglassspoonstoveknifetableclockbroompillowpencilblanketcupboardtoothpastetoothbrushtelevision

Nate the Great and the Crunchy Christmas 2025-12-05

20 Items: elfNateFangsnowcardcluecaseAnniebellssludgeshovelseasoncatalogholidaymailboxmailmancollectChristmasdetectivesnowflake

Pathophysiology Word Search 2025-02-16

15 Items: damaged tissue.Infestation with liceNon-cancerous skin tumor.Mass of pus in the tissue.Small area of discolored skin.Physical suffering or discomfort.medical term for itching of the skin.Cancer that forms in epithelial tissue.Type of skin cancer that arise from melanocytes.Also called fungal infections diseases caused by a fungus....

Catapulta Fall Issue 2025-11-17

15 Items: First name of the Red-40 dye compoundBone cells that enlarge during growthRegion where Sámi languages originatedHGH is an example that affects human heightGut bacteria affected by food dye consumptionProtein deposits found in Alzheimer's patientsLanguage family that includes Sámi and FinnishWhat happens to the Eiffel Tower in summer heat...

Alps Word Search 2025-07-19

9 Items: The English national flower.The royal family lives there.This long river flows through London.A sweet, triangle-shaped chocolate bar.The first name of legend from Nottingham.This large mountain range runs through SwitzerlandTraditional singing heard in the Alps with echoes.Traditional meal: meat, potatoes, and Yorkshire ___....

Modelling Data Word Search 2025-03-16

8 Items: Changing the appearance of dataUsed to calculate and produce dataA sinĀle tab on a spreadsheet used to store dataA single box on a sheet used to store a piece of dataThe column and the row number of a cell, examples: A1; C13; F27A vertical line in a spreadsheet, usually represented by a letter...

Polish Verb Mieć 2025-11-04

24 Items: the form of "mieć" in past tense for "on" (he)the form of "mieć" in future tense for "ja" (I)the form of "mieć" in present tense for "ja" (I)the form of "mieć" in past tense for "ona" (she)the form of "mieć" in future tense for "my" (we)the form of "mieć" in present tense for "my" (we)the form of "mieć" in future tense for "oni/one" (they)...