and the blade Word Searches

Wine Word Search 2025-11-07

24 Items: winehidenotekitemadehimevanetabetubematepinecapefaderipemaperibetrameplanetwineshineflatebrapeslideblade

Metaphors Wordsearch 2025-10-21

12 Items: The test was a ________ - It was easyThey are bookworms - They like __________He is an _______ ______- He wakes up earlyLife is a _________ - Life has ups and downsThe car was a ________ - The car was very fastHis brain is a sponge - He learns things ______She is a ________ - She is steady and dependable...

By-Election Losers since 2019 2023-10-31

19 Items: with envyKleptomaniacson of Patrickadept at making barrelsTiger in the Jungle Book1996 Formula One Championthe groover from vancouverVs Lion and nearly a Turkeya typical teenager's bedroomdamaged the governor's districtput undergarment in the rubbishtaking the courage out of the camelshortest reigning Monarch of England...

Wordlist 1 2023-03-07

6 Items: wemetheandyoulike

Heart Words 2025-11-10

6 Items: hegotheandseehad

Find Out On Your Own 2025-11-16

6 Items: AriAndTheGrownGettingArtifacts

Odyssey Books 1-20 2026-01-27

32 Items: Whirlpool monsterThe hero of The OdysseyIsland of the PhaeaciansElderly father of OdysseusEpic poem about the journey homeLoyal cowherd who helps OdysseusWhat Athena disguises Odysseus asThe faithful swineherd of OdysseusQueen of the dead and wife of HadesThe island kingdom home of OdysseusDangerous sea monster with six heads...

Leadership and Teamwork 2025-04-14

10 Items: Delegation : Assigning responsibility or authority to another person.Collaboration : Working together with others to achieve a shared goal.Empathy : The ability to understand and share the feelings of another.Negotiation : A discussion aimed at reaching an agreement or compromise....

What is a mineral?5 2024-05-04

10 Items: When something turns around in one spot.An imaginary line that an object spins around.When one thing goes around another thing in a circle.Phases: The different shapes of the moon as seen from Earth.Pace: Moving at a consistent speed without significant changes.Side of the Moon: The side of the moon that is not visible from Earth....

BUSHONG REVIEW 2025-01-21

20 Items: Energy in motionThe ability to do workAnything occupies spaceUnit of radiation exposureProduct of mass and velocityWhat is the SI unit of force?Electron in the outermost shellRemoval of an electron from an atomAbility to do work by virtue of positionThe force that keeps an electron on orbitSame atomic number but different atomic mass...

Mentalhealth Word Search 2023-05-10

18 Items: a state of uneasinesshow you feel about yourselfAnything that causes stressthe way you view yourself overallfeelings such as love, joy, or fearfrequent changes in emotional stateStrategies for using time efficiently.The body's way of responding to threatsthe ability to recover from problems or lossbelief in your ability to do what you set out to do...

Biology Chapter 11 Vocabulary Word Search 2024-03-19

25 Items: formation of a new speciesthe variety of alleles in a populationthe changes in a population's genetic structurethe effect of chance on a population's gene poola speciation that occurs via a geographic separationa speciation that occurs in the same geographic spacean evolution that results in similar forms on different species...

The last Hope school for Magical delinquents 2026-02-05

20 Items: An elementfull of dangerAble to controlopposite of oldopposite of fireopposite of firsta female headmasterto aim for somethinganother word for magiccolour changing animalthe name of the schoolsomewhere to take a bathanother word for principalname of the librarian's catanother word for superpowersAble to summon elements or objects...

It starts with dirt! 2025-03-29

20 Items: What family do potatoes belong to?What color were carrots originally?Where do Poinsettias originate from?What fruit has seeds on the outside?What tree is the source for aspirin?Soil can be acidic, alkaline or what?Which grain is used to make semolina?What do Peas use to cling to supports?What flower was once more valuable than gold?...

Popcorn Words 2025-03-07

6 Items: thewasandshepinkwent

Hallelujah Word Search 2025-03-10

6 Items: TOTHEANDHALLELUJAHKINGOFKINGSLORDOFLORDS

parts of a knife 2025-03-27

9 Items: TipedgeHeelTangBladeSpineHandleRivetsBolster

maritime 2025-11-11

10 Items: rulebladepermitadviceinquirylandingcomplaintAdventureregulationcompliance

King Word Search 2025-12-15

10 Items: - being nice and caring to others.- a hopeful idea about a better future.- treating everyone the same and being just.- a person who helps guide and teach others.- the right to live, speak, and learn equally.- a talk given to share ideas with many people.- showing care and good behavior toward others....

ANITA MY LOVE 2025-02-14

24 Items: MUSTARDDDthis is ushow tall i amwho behind you?this fucking guyyour favorite brothis guy irks youthis guys your dadthe fart of all timethis guys SCARES YOUi have this sometimesyou have this and its litour first outting togetheryour guy your guy your guywe will go here eventuallythis tastes like candle wax perhapsyou like to do this and it charms me...

Herculesandthetwelvelabors Word Search 2022-08-09

10 Items: A young Greek king needs to retrieve the Golden Fleece to retrieve his throne, and many adventures arise.The Greek hero of the Trojan War endured multiple challenges and adventures on his ten year voyage home to Ithaca.A Greek demigod is forced to complete a list of challenges as a punishment for something he did while under a spell....

07 2025-08-16

15 Items: name of a motorcycle club movieis what a old timer biker is calledwhat type of clothing bikers preferThe second-in-command in a motorcycle clubafter which war did motorcycle clubs formed ?which US state does not have a motorcycle club ?is what law enforcement requires to operate a bikeThe elected leader of a motorcycle club (short form)...

Linguistics 2023-11-27

10 Items: The official language of the Indian state of Goa.Speech sound produced without any obstruction in the oral cavity.a Bantu language spoken primarily in Tanzania, Kenya and Mozambique.A linguistics field, which studies how context contributes to meaning....

Passionate Care Management Core Values 2023-07-14

9 Items: Showing enthusiasm and energy in everything that we do.Being open and honest so everyone knows what you are accomplishing.Sharing ideas and creativity with the team. All ideas are important!The golden rule. Always being mindful to _____ PCM team members, clients, and patients....

Kate's Sky Science Word Search 2023-12-18

20 Items: rocks in spacerederection of lighta belief about the starsthe galaxy where we livegroups of stars in the skyan object orbiting the suna human that travels to spaceanother way to say big dipperthe study of anything in spacewhen something gives off lightanother way to say little dipperwhen a rock safetly lands on earth...

: The Consequences of the Industrialization 2022-12-01

26 Items: The action or process of appeasing.Centralized control by an autocratic authorityTreaty that ended the first Opium War in China.A law that restricting Chinese immigration in the U.S.A law that restricted non-European immigration in Australia.A German philosopher that came up with the theory of Communism....

Renewable Energy 2024-01-19

18 Items: GaswindPanelbladeEnergysafetyturbinestoragesunlightinverterrenewablemegawattsEmissionsgeneratortechnicianelectricitysustainableenvironment

Unit 10 2024-04-25

12 Items: Absorbs UV radiation coming from the sunthickest layer of atmosphere, auroras happen herethis air sinks because it is more dense (warm or cold)short term local variations of temp. and precipitationall weather events occur in this layer of the atmospherecontains the ozone shield in this layer of the atmosphere...

Turkey Word Search 2025-06-22

12 Items: A big meal with lots of foodA warm sauce poured over foodFeeling happy for what you haveThe people you love and live withWhere everyone sits to eat togetherA soft, yellow bread made with cornWhen fruits and vegetables are pickedA big bird often eaten on ThanksgivingA sweet dessert, often pumpkin or appleBread and herbs cooked inside the turkey...

#FINDINGDAHL - The Twits 2025-01-11

10 Items: The father of the monkeys.The reader of the gas meter.The animals in Mr. Twit's spaghetti.Another name for Mrs. Twit's other eye.A "Giant Skillywiggler" seen by Mr. Twit.The disease that Mr. and Mrs. Twits caught.The superglue used by Mr. Twit to capture the birds.The previous job of Mr. and Mrs. Twits in the circus....

Brainstorming Word Search 2025-06-11

12 Items: describe properties or occurrences in ways that do not rely on numbersmeasurements, which by definition consist of both a number and a unit.a conclusion or opinion that is formed because of known facts or evidencethe goal is to solve a problem by building or improving a product or process....

SOF final project 2024-06-05

15 Items: Putting values where the letters area polynomial, which has only one termvery different from the usual or traditionalalgebraic expressions that consist of variables and coefficientsa straight line that is used to define a curve or a conic sectiona quantity that may be changed according to the mathematical problem...

Basal Word Search 2025-10-27

12 Items: Rods and Cones.The ____________ pathway is a critical visual pathway.Auditory pathway. (Two words no space: 7 letters + 9 letters).A selective inability to recognize or differentiate among faces.Structures that connect the cerebellum and other parts of the nervous system....

wk1 0902 2022-09-02

14 Items: To go __________ you need a pair of skis and fast boat.I'm not going to watch that ghost movie, it's too _________!The old man likes to sit by the river and go _________ all day.They go ___________ on their boat in summer. It's very relaxing.Everyone plays ______________ in the UK, it's the most popular sport....

Planet Word Search 2025-05-29

15 Items: The star we orbit.The largest planet.The windiest planet.The planet we live on.The closest planet to earth.The thing that orbits earth.The closest planet to the sun.The planet known for having rings.The dwarf planet with 9 hour days.The planet NASA is trying to take us to.The first planet spotted with a telescope....

Medical Terminology 2025-09-11

46 Items: cellfrontskullfiberbloodbelowspineabovechestcancertissuepelvisabdomenstomachnucleusdiseaseformationcartilagecast; throwsame; equaltone; tensiondeveloping cellinternal organsback of the bodystar; star-shapedthe study of diseaseumbilicus (belly button)Near the point of origin.Normal standing position.above; above normal; excessive...

FUELS 2023-05-03

12 Items: Substances made up of only hydrogen and carbon atoms.Heat energy extracted from the Earth through hot water or steam.Energy from captured solar radiation to use for hot water and electricity.Atmospheric motion generated by the uneven heating of Earth's surface by the Sun....

3.2 Starting Versus Buying a Business 2023-11-16

8 Items: A ___ gains the right to use the product, process, or service to run your business.You can go to college to ___ new skills, knowledge, or assets for personal or business growth.The ___ provides the buyer with planning and management expertise to support the success of the new business....

Christian Initiation and Baptism 2025-10-16

9 Items: Our model of holiness is _____________________.In Baptism, we become members of the _____________________.In Baptism, we are freed from _____________________________.Baptism is the _______________________ sacrament we receive.There are _____________________ Sacraments of Christian Initiation....

Find the Government Vocab! 2024-01-25

15 Items: The highest federal court in the United States.Employment in government positions based on merit.The power of courts to declare laws unconstitutional.The general trial courts in the U.S. federal court system.Presidential act forgiving a person of their federal crime.A practice of giving government jobs to political supporters....

ANIMALS AND ITS BODY PARTS 2025-11-12

15 Items: CatDogDeerLionFishhippoParrotOctopusElephantit's got a beakit's got long neck and it's yellowit's got black stripes and it's whiteBig animal, it's got big teeths and it's brownit's got long neck and it's white; it's a birdit's got a tail and it's brown; it lives in the jungle

Age of Discovery 2026-01-12

18 Items: The Spanish word for conquerorTo sail all the way around the world.An instrument for measuring time at sea.A movement to spread Catholicism in SpainA strip of land that connects two larger landsPeople who trade, buy, and sell to earn a living.A small, fast Spanish or Portuguese sailing ship.A tool that measures the positions of the stars or sun....

How Are New Vaccines/Drugs Developed Word Search 2025-12-03

21 Items: acronym for virus like particlesViruses that infect bacteria are called_______bacteria killing mechanism that involved apoptosis + pyroptosis.a study where participants, researchers, AND data analyzers all don’t knowbacteria killing mechanism including hypoxia tolerance, chemotaxis, motility genes....

Nursing Shortage 2024-04-07

15 Items: What primary focus guides the efforts of nurses in healthcare settings?What term describes the insufficient number of available nurses in healthcare settings?What strategy aims to keep nurses in their current positions within healthcare institutions?What paramount concern guides the actions of nurses and healthcare providers in their duties?...

Old Shows 2023-12-03

40 Items: eddaystrekzonemasontimesmaudeacreskojakbunchacresrhodafamilyislandlassiebatmanfamilycolumbomoonersdragnetmccouldjetsonsand wifein spacemunsterslove lucybetwichedreed showknows bestthree sonshillbilliesflintstonesreal mccoysand harrietand shirleygriffth shownewhart showit to beaverin the familyboone family ties

CMS Exam Break 2022-12-07

20 Items: restbluenavyrelaxrootswingswhiteeaglesrechargeteachersstudentsour mascotWho We AreOur Principalone of the 3 r's8th grade administrator7th grade administratoranother one of the 3 r'sand one more of the 3 r'sAssistant Principal of Instruction

Your name (Addie) 2025-04-23

10 Items: Being PatrioticA specific group of PuritansTranslated the Bible To English.His ideas led to the Hussite movement.Led the Protestant Reformation in Switzerland.Translated Bible into English from Hebrew and Greek.Started the English Reformation so he can get a divorce.One of the 3 main Protestant Denominations (starts with L)...

Control+F 2025-07-24

15 Items: The brain inside the boxIt holds data in a programFixing mistakes in a programSomeone who breaks into computersA rule that decides what happens nextRepeats a set of actions again and againIt mixes numbers with ABCs, and 16 is the keyClear thinking used to solve problems in codingThe main screen you see when the computer starts...

WORLD HAND HYGIENE DAY 2025 2025-05-02

17 Items: HandHygieneThe step after scrubbing handsThe final step in hand hygieneRecommended time for hand scrubbingMicroorganisms that can cause diseaseThe result of germs entering the bodyThe central part of the hand to scrubA goal of proper hand hygiene practicesMust be cleaned to prevent germ buildupA part of the hand often missed when rubbing...

Tony Word Search 2024-02-20

7 Items: lineAwardLa LandLion Kingin the Rainof the Operaand the Beast

Ron's Celebration of Life 2024-01-27

20 Items: teaLawtealbeetsporchbowerheartbatmanhamfammywifebowlingbroncoseclairsriflemanthe Deerhomebodyand onionscheesecakemuhlenbergdunkindonuts

Sharks Word Search 2025-03-25

22 Items: What are mermaid’s purses? ________What are baby sharks are called? ________What type of skeleton do sharks have? ________What is the fastest species of shark? ________What is the smallest species of shark? ________How do sharks communicate with each other? ________What is an excessive fear of sharks called? ________...

James space 2023-12-18

15 Items: a rock flying through spacea rock sitting still in spacealignments of stars that make a shapethe smaller version of the big dippera space rock that has landed on earthwhen the sun passes through the equatora rock/ice ball that flies through spacewhen sunlight isn't on the north and eastthe most famous constellation in the north...

Chemistry Chapter 2 2025-11-17

12 Items: Electrons in the outermost shellThe counting term used in chemistryAn element with 1 proton in its NucleusThe name of each row in the periodic tableThe name of each column in the periodic tableWhat happens when a neutral atom gains electrons?Gold, iron, silver, and copper are all examples ofWhat type of ions are formed when atoms lose electrons?...

Clinical Day 5 2025-11-11

15 Items: hyper and hypoAffects calcium balanceattack on peripheral nervesincludes Addison’s Cushing’s , and tumorsTumors or dysfunction can cause growth issuesExcess ADH causes water retention and low sodiuma life-threatening allergic reaction with airway swellingchronic autoimmune disease affecting skin, joints, kidneys...

The Adventures of Amina Al-Surafi 2025-01-11

10 Items: The function of this was from Islamic KhimirAn English word coming from tantalus and -izeComes from the Latin phrase vagābundus which means to wanderThe origin is unknown however it was around the mid-18th centuryThe word originated from India and the East as they use this the most...

John 3:16 CSB Word Search 2024-01-08

29 Items: inhesoinforgodthewayhisoneandsonwhohimnotbutthisgaveonlythatwillhavelifelovedworldperisheternaleveryonebelieves

Sight Words 1 2025-09-19

28 Items: OfInOnIsAsHeHatForYouManFatAreFanCanPatBatTheRanSatAndHisMatPanCatTanHereThatWith

Spelling Words 2025-12-22

28 Items: amatbeheifinisitmemynoontoweandbutcanforgetnotseetheyouawayherelikemakesaid

December Word Search 2022-12-11

11 Items: februariusThis emperor created the Julian calendar.Most New Year’s festivities begin on _______ 31.This is the popular song for ringing in the new year.Bang on these kitchen items to make noise at midnight!square Thousands gather here in New York to watch the ball drop.Make this vow to improve yourself and stay positive in the new year!...

ALL THINGS POETRY/ DRAMA 2025-03-24

16 Items: smiling sadly!beings who have to die.loosely hanging threads or cords.the overall structure of the poem.a suspect in the missing crucifix.the sister who reported the brother.the sequence of events within a story.time or place where the story takes place.he was bullied because he was small and quiet.an institution for mental persons in the drama....

Beauty and the Beast pgs. 14-19 2023-10-11

18 Items: Who came to Beauty's dream?Where did the horse go to eat?What can she see in the mirror?Where did they find food inside?What were the cupboards full of?Who did the Beast walk right up to?When does her father need to leave?What animal did the Beast look like?What was everywhere in Beauty's room?Who found the way to the Beast's palace?...

MYTHS AND LEGENDS 2024-09-19

15 Items: Giant wolf from Norse mythology.Greek goddess of wisdom and war.Greek monster with snakes for hair.Giant sea monster from Norse legend.Norse trickster god, brother of Thor.Egyptian falcon-headed god of the sky.Legendary bird that rises from its ashes.Greek god of thunder and king of the gods.Half-man, half-bull, trapped in a labyrinth....

UFLI 54 (1) wordsearch 2025-01-17

24 Items: bakecakecamecavedatefadegamegategavelakelatemademakemalematebladebrakebravechaseflakeflamegradegrapecapecase

Atmosphere and Heat Transfer 2025-10-27

14 Items: heat transfer through touchheat transfer through waveshow much stuff is in somethingthe 1st layer of the atmospherethe 2nd layer of the atmospherethe 3rd layer of the atmospherethe 4th layer of the atmospherethe 5th layer of the atmospherea force that pulls on everythinga tool used to measure air pressurethe movement of heat from hot to cold...

Economy Chapter 2 Definitions 2025-09-12

19 Items: The sacrifice of one resource or production choice for another.Goods, such as tools or machinery, used to produce consumer goods.Those goods or services that an economy produces to satisfy human needs.As used in graphs, the point at which the vertical and horizontal axes meet....

Ghost word search 2025-12-19

20 Items: Ghost's real name?The persons mom diedGhost enemy at school?Main characters nicknameWhat is the team called?The boss of the track teamThe only girl on the team?What Ghost does for Coach?Who's store does Ghost go to?What Ghost wants to do one dayWhat is Ghost and his friends?He is now what on the track team?What did Ghos's dad try to use on them?...

European Capitals 2022-12-07

11 Items: oslolondontallinmadridwarsawhelsinkistockholmCity of lightWhere the Parthenon temple isThe city of Mozart and Gustav KlimtWhere the statue of little mermaid is

M3 Unit 1-3 vocabulary 2023-09-01

11 Items: the ovule becomes this partmany food chains linked togetherthe ovary of a flower becomes thismethod of identifying an unknown organismtype of process where humans control traitspollen moving from the anther to the stigmathe passing of features from parents to offspringtype of process where the environment controls traits...

World War 1 2025-03-20

12 Items: An explosive used to destroy submarines.Monetary payment is used to right a wrong.Naval submarines used by Germany in World War 1.A position of remaining neutral in times of conflict.African-American Regiment that fought on the front lines of World War I with the French....

Summer of the Mariposas 2023-03-16

17 Items: Spanish for mermaidNarrator of the storySpanish for butterflyDelia and Velia are _____Youngest of the Garza sistersColor of the dead man's houseUS state where the Garzas live"Too much cream spoils the ____"Model of Papa's car the girls tookLast name of the author of the bookEnchanting hostess who served treatsLa Llarona's role in the Hero's Journey...

For Word Search 2023-11-22

6 Items: fortheandhascanlast

Plot Word Search 2025-08-02

7 Items: theandtheplotfindlinesintersections

Pinchas 5.0 2025-07-13

16 Items: What tribe was Zimri from?Tzelofchad had how many daughters?What was poured with each offering?Which tribe had no land inheritance?Who did Moses appoint to succeed him?The central figure of this Torah portion.What stopped the plague among the Israelites?Which holiday includes fasting and atonement?What holiday includes the blowing of the Shofar?...

ICE SKATING 2024-12-12

15 Items: catlionSPINJUMPRINKSNOWzebraSKATEBLADEGLIDECHILLWINTERelephanthippoICEMan's best friend

A Word Search 2024-11-13

6 Items: aisofandthehis

Thunderhawk Pledge 2025-08-26

17 Items: our principalpublicly displayour school mascotour male counseloryou are all ______our female counselorour male vice principalour female vice principala solemn promise or undertakingthe state or fact of having a dutyrelating to education and scholarshipshowing regard for abilities and worthrequired or expected to justify actions...

American Football 2025-09-14

20 Items: Dallas team nicknamed “America’s Team”Chicago Bears running back nicknamed “Sweetness”Pittsburgh team with six Super Bowl championshipsGreen Bay team that won the first Super Bowl in 1967New York team that beat the Patriots in two Super BowlsFamous stadium in New Orleans hosting multiple Super Bowls...

The Word Search 2023-12-18

6 Items: aisoftheandhis

Popcorn Words 2025-03-07

6 Items: thewasandshepinkwent

Hallelujah Word Search 2025-03-10

6 Items: TOTHEANDHALLELUJAHKINGOFKINGSLORDOFLORDS

d 2026-02-09

6 Items: aisoftheandhis

d 2026-02-09

6 Items: astohasandtheinto

Math 7 Word Search 2025-10-08

15 Items: AdditionDivisionPositiveNegativeSubtractionMultiplicationThe answer to a division problemThe answer to an addition problemThe answer to a subtraction problemThe answer to a multiplication problemThe positive and negative versions of a numberThe number breaking up the dividend in a division problem...

MODULE 1C: WORD SEARCH 2025-03-15

15 Items: movement of water through a membrane.Plant hormones that help with growth.A chemical that controls body functions.A nerve cell that sends messages in the body.The long part of a neuron that carries signals.System The system in the body that makes hormones.The tiny gap where nerve signals pass between neurons....

Equations and Inequalities word search 2025-10-09

15 Items: A combination of constants, variables, and mathematical operations (e.g., 2x+7).Indicates that the expression on the left is larger than the expression on the right.Indicates that the expression on the left is smaller than the expression on the right.The numerical factor multiplied by a variable in a term (e.g., 3 is the coefficient in 3x)....

Chase Word Search 2025-11-01

24 Items: HookQuaysoulSolemnRepeatGazeboCrappySneakyDimpleUnsafeVanisharoundComposePortrayany priceWhirlwindbash boshBoundlessRehearsalDormitoryin the skythe rainbowa rainy dayand my big mouth

El Día de los Muertos 2025-11-04

13 Items: skullgravecandleancestormarigoldstraditionphotographcelebrationpaper cut-outsDay of the deadbread of the deadoffering table/altarDay of the Dead is celebrated the 1st and 2nd of _________.

Hard word search for Curious minds 2025-11-19

27 Items: ClueThe gas we breatheKing of the animalsSmart marine mammalThe lightest elementThe coldest continentThe only flying mammalExtinct giant reptilesFamous musical composerEarth's natural satelliteA mountain that spews lavaTower Famous tower in ParisA machine that can perform tasksThe world's largest coral systemBees produce this sweet substance...

Avatar Word Search 2024-09-07

10 Items: DuneWarsE.T.AlienAvatarMatrixRunnerGravityInceptionTerminator

The Legislative Branch 2025-12-15

20 Items: to make lawsthe House of Representatives + the Senatethe leader of the Senate; also called the "President of the Senate"the "Upper House" of Congress, where each state has 2 representativesa lawmaking body made of two separate chambers or houses (the House of Representatives and the Senate)...

Vocabulary Unit 1 2025-09-17

24 Items: heatmeltbasicbladehumanriskyradarsoggywheelbuttonrotatescreenwiringdevelopexplodeautoparthologramcourageouselectronicmechanicalcomplicatedkitchenwaremicrowaveovenArtificialIntelligence

fe 2025-10-07

24 Items: cutgrinfaceglowjackfallsmileteethmouthknifebladesliceroundlightnightcarvedorangehollowspookycreepyshadowpumpkinlanternoctober

Luke's Spelling 2025-09-12

23 Items: pastjailhanggraysaleraftexactstalemaybegraspdrainstaindelayquakeamazebreakbladesteakglassmagiccrayonremainashamed

in theatro 2025-09-19

8 Items: Letta: "Hey, you _____!"What/who can Poppillus not hear?Sabina: "But the view is _______!"What kind of crowd is in the theatre?What does Poppillus say is not strong?Poppillus and Letta sit ______ Sabina and Alexander.What row of the theatre does Alexander and Sabina climb to?What does Poppillus call the old people sitting in the front row?

NJROTC Word Search 2024-12-05

13 Items: Person in a societythe care, guardianship,control exercised by a deityThe practice of being a citizenRules and regulations to followrelated to Christianity and JudeaismDedication of citizens for common goodLove Americans have for bonding togetherLegal power to act on behalf of someone elsePrincipals of living by Judeo-Christian teachings...

Religions of the World 2025-02-28

12 Items: A sacred text for Islam.A sacred text for Judaism.A sacred text for BuddhismA sacred text for Hinduism.The sacred text of Christians.A sacred text for Confucianism.This religion started in India but spread along trade routes.This religion started in India and was likely contained by geographic barriers....

Carbondioxide Word Search 2024-05-16

15 Items: Produces Atphas a formula of C6H12O6The site of Photosynthesissingle member of a speciesHas a chemical formula of CO2when a liquid turns into a gaswhen a gas turns into a liquidwhen water is released from the cloudsliquid that fills up the inside of a cellConverts light energy into chemical energyall the living and non living things in an area...

WSW: Brotherly Love 2025-11-26

15 Items: SinGodLoveHateUnityAgreeHonourBrotherlyPreferringRighteousnessRomans 12:10 Be kindly ? one to another with brotherly love; in honour preferring one another;Leviticus 19:17 Thou shalt not hate thy brother in thine heart: thou shalt in any wise ? thy neighbour, and not suffer sin upon him....