4th of july Word Searches

Sight Word Search 2025-10-22

11 Items: itisofhetomyfortheshehisone

william shakespeare 2014-01-16

11 Items: ofBardAvonglobeHamletLondonOthelloMacbethcenturyVictoriansWarwickshire

Social Studies second 6 2016-01-29

11 Items: ofwarGeorgepurchaselouisianaWashingtonindustrialrevolutiondeclarationindependencerevolutionary

Bible Memory Verse 2016-08-19

12 Items: I8amof12thethesaidJohnJesuslightworld

Bible Memory Verse 2016-08-25

12 Items: I8amof12thethesaidJohnJesuslightworld

Bible Memory Verse 2016-08-25

12 Items: I8amof12thethesaidJohnJesuslightworld

Home comforts 2020-10-05

11 Items: ofbedlinenchestceilingdrawerscottagecushionbookcaseadjoiningaccomodation

Heart Words 2025-09-08

11 Items: Iatodoofisasseeandthesaid

Romans 3:23 2025-11-19

12 Items: OFOFFORALLANDTHEGODHAVEFALLSHORTGLORYSINNED

Revisions Word Search 2026-02-01

11 Items: aofarethenotit.partfromRevisionsdeviationstructure,

Went Word Search 2026-06-02

11 Items: ofoffwentbackhaveherewithwillwelltellstill

Red Words 2026-06-10

11 Items: todoorisofwasandtheforhashis

Delaware Township Trivia 2025-01-26

13 Items: Vocke--- Tea Table--- Farm Park--- race crate--- Stone ChurchMajor industry in DTSergeantsville radio stationProduct sold by local farmersFormer name of Sergeantsville--- Sergeant's Covered BridgeTV journalist who lived in DTHistorical use of Township buildingNumber of people on Township Committee

The Wedding Wordsearch 2025-04-16

13 Items: The best manAnniversary monthThe maid of honourFavourite takeawayStephen's professionHoneymoon destinationLocation of the churchBride's favourite drinkGroom's favourite drinkColour of the bride's dressThe couple's favourite drinkThe place where the couple got engagedThe couple's favourite holiday destination

Word Search 2024-07-06

10 Items: Who was the last Viceroy of British India?Who wrote the book “The Discovery of India''What is the universal symbol for friendship?Which Indian leader is known as the “Father of the Nation”?Which movie features the friendship of a lion cub and a warthog?Who is one of Harrys best friends in the famous Harry Potter series?...

Identifying Abuse 2025-04-01

10 Items: excessive or unjustified use of a drug.reducing the risk of future harm for DV patients.type of violence that patients above the age of 65.signs of bruising, cutes, burn marks, and swelling.failing to provide adequate care or support to a individual.identifying signs of abuse in patients upon initial encounter....

Danielle & Joe 2024-05-19

22 Items: Groom’s hometownBride’s hometownBride’s last nameThe bride’s collegeWhere the couple metHoneymoon destinationGroom’s dream dog breedThe bride’s birth monthThe chore the groom doesThe couple’s favorite showWhere the couple got engagedThe month the groom proposedThe couple’s favorite cocktailThe couple’s favorite type of food...

Jessica and Jordan OO 2024-08-02

30 Items: Proposal monthProposal locationJordans middle nameJessica birth monthLength of engagementJordan’s birth monthName of Williams dogJessica’s old nephewHoneymoon destinationJessica’s middle nameMonth of the honeymoonJordans favorite candyJordans favorite storeJessica favorite storeName of Jordan’s sisterJessica’s favorite foodCity Jordan was born in...

Names In The Bible 2025-08-17

24 Items: Mother of IsaacHe built and arkBrother of MosesThe fallen angelHe betrayed JesusOur Lord and saviorThe mother of JesusHe's Jesus's cousinHe parted the Red seaJohn the Baptist's momThe first man on earthFather of many nationsHe denied Jesus 3 timesHis wife turned to saltAte the forbidden fruitHis donkey spoke to himFirst man to commit murder...

Angora Goats 2025-11-27

20 Items: A young angora goatA group of angora goatsThe coat of an angora goatA type or kind of livestockThe standard of mohair fibreSomeone who raises angora goatsIndustry that uses mohair fibreSending mohair products overseasThe grassy area where goats grazeHow goats feed on grass and plantsFarm animals raised for production...

Unit 6 Vocab - Puzzle 1 2026-03-26

18 Items: A path for advancement within a companyCommunication teamwork and people skillsA person responsible for overseeing employeesPreparing employees for future leadership rolesTraining created and delivered within the companyThe line of authority showing who reports to whomSkills related to specific job tasks or knowledge...

Marie Curie 2014-11-05

14 Items: ofnobelprizepariswinnerradiumx-raysphysicspoloniumchemistryradiationuniversitydiscoveriesradioactivity

Science Review Word Search 2023-03-02

17 Items: F=MxAspeeding upslowing downa push or a pullfirst lunar phasethe unit for forcethe unit for energythe amount of speedthe earth orbits the...the power house of the cellwhat you can use to see cellswhat holds the slide in placethe direction the earth orbitshow many lunar phases are therethe color of the moon during a lunar eclipse...

All About Me 2025-05-30

20 Items: AgeBirthdateFirst NameMiddle Name1st Car ModelFavourite FoodFavourite FoodFavourite ThingFirst Dream CarFavourite FlowerFavourite ColourBusiness #1 NameBusiness #2 NameWhat I call myselfName of First ChildName of Second ChildFavourite RestaurantBest Month of the YearFavourite Animal on paperWhen I grow up I want to be...

WIP 2026-05-12

12 Items: MauMau: “savages armed with ideas” is the choice of words used by Churchill to describe Kenyan insurrectionists fighting British rule in the 1950s.Gahndi: "We should be rid of a bad man and an enemy of the Empire if he died." This was Churchill's wartime stance on which famous Indian pacifist?...

Sight Words 2022-12-01

21 Items: byofforhasaregetrunwassitcanyouseewillgirltheylookplaylikethisfindcome

DAILY PUZZLE 3.7.25 NATIONAL CEREAL DAY 2025-03-06

21 Items: OfdrymilkoatsbrancornPostbowlLuckyHoneyMillsspooncerealflakesRaisinCharmsBunchesGeneralCheeriosKelloggsbreakfast

Birthday Surprise 2025-09-04

22 Items: aiWeatoforareandyouyouboatyourloveMarshCreeksunsetdeciderentinggettingtakeoutsunrisechoosing

Sight Word For Kindergarten 2025-09-13

21 Items: Iaofattoishewemearethemayforsheseethatlikehavemakewithlook

Snap Words 2025-12-11

21 Items: ifoforbigeatnotnowoutputcamehomehaveintomakemorereadtakesameyourthreelittle

Wordsearch 3 2026-01-15

21 Items: ofdobyohoffitsnowtooI'msawsaidcomeweremadecameheretheredon'taboutlittlechildren

Philippians 2:8 2026-04-24

22 Items: ainHebytoofonAndtheformevenbeingfoundhumanpointdeathdeathcrosshumbledhimselfbecomingobedient

Night Vocabulary & Spelling Word Search 2023-02-24

25 Items: (v.) recall the past(adj.) the quality of being holy(adj.) offering little or no hope(v.) cancel officially; revoke; repeal(n.) open resistance; a hostile exchange(n.) an absence of emotion or enthusiasm(v.) have and exercise; to be able to use(adj.) known widely and usually unfavorably(adj.) conspicuous in position or importance...

Lesson 1: He Is Smart 2023-01-16

15 Items: shybadboygoodlazygirldonemovebravesmartworrycoursenaughtyhonestyamazing

Reusable Word Search 2026-04-11

15 Items: ofbincycledirtynoisethrowgardenforestrubbishdolphinhealthyreusablematerialcreativeenvironment

WW13 2025-05-12

15 Items: – Study of heredity.– Different forms of a gene.– Expressed with just one copy.– Physical expression of traits.– DNA segment coding for a trait.– Change in a gene or chromosome.– Two identical alleles for a gene.– Two different alleles for a gene.– Family tree for inherited traits.– Has a gene but doesn’t express it....

Alcohol Vocabulary 2024-12-18

20 Items: E-cigarettesWhen you stop smokingEnlarged stuffy lungsA toxic oily substanceAn electronic cigaretteA smoldering end of a productA type of e-cigarette companyRaises nervous levels severelyCauses cancer in living tissueTobacco that hasn't been burnedWhite patches on a mucous membraneWhen people exhale smoke out of it...

Renaissance 2024-10-08

15 Items: rebirth_ years of war.Died from a stroke.Had three children.Worked 18 hours a day.Believed in top Depravity.95 statements on a documentBridget Bisop was involved in the _.Spaghetti is known for being greated here.This is the way individuals see the world.An expectation about someone or something.He was mad at the clergy selling "indulgences"...

Word Search! 2024-03-28

15 Items: You drive thisOpens and closesYou sleep on thisWe use them to seeIt's white and coldIt's bright and hotAn animal that flysYou can eat this thingThe teacher of the classYou put them on your feetThe first day of the weekdayAn animal that's black and white70% of our bodies are made up of thisYou carry this to school on your back...

VOCAB REVIEW 2025-04-28

35 Items: servant; slavemoderately warmlying face upwardmannerism; demeanornot of central importancewith a side or oblique glanceconducive to success; favorablewarn or reprimand someone firmlybeing joined in close associationnot securely held or in position;loose fitting garment (dress like)struck with dread, shock, or dismay...

Assessment, Evaluation, Diagnosis 2.0 2025-04-30

25 Items: Inflammation of a tendon.force that pulls tissue apart.Test used to assess joint laxity or integrity.Grading system for muscle strength from 0 to 5.complete break or loss of continuity in a bone.subjective experience described by the patient.Test used to measure range of motion of a joint.Term describing normal movement limits for a joint....

Environmental Sensitivities 2026-05-11

12 Items: Environmental sensitivities are INVISIBLEPERFUME is an example of a common scented productASTHMA is an example of an environmental sensitivityScent-free policies apply to EVERYONE in a workplaceSIGNAGE is a method of scent-free policy communicationIf experiencing an environmental trigger, inform your SUPERVISOR...

The Electoral College 2024-10-21

15 Items: ________ DC has 3 electoral votes.This state has 40 electoral votes.Indiana has how many electoral votes?Symbol of the Republican party (animal)Symbol of the Democratic party (animal)This state has the most electoral votes.This southern state has 8 electoral votes.This southern state has 30 electoral votes....

And Then There Were None Word Search 2025-09-08

15 Items: the genre of the novelman who was killed by marblewhat Vera killed Lombard withthe mastermind behind each murderthe poison that killed Emily Brentthe crime Wargrave committed 10 timeslast name of the writer/author of bookwhere the guests get stranded in the bookman who was killed by poison through drinking...

Inpatient Cardiovascular Diagnoses & Procedures - Part 1 2026-03-24

15 Items: Congestive cardiomyopathyRepair mitral valve, open approachOther persistent atrial fibrillationAtrioventricular block complete third degreeJuxtarenal abdominal aortic aneurysm, without ruptureSeptic pulmonary embolism without acute cor pulmonaleCerebral infarction due to embolism of right middle cerebral artery...

Pathophysiology Word Search 2026-06-13

15 Items: Crackling or popping sensation in jointsLocalized collection of pus caused by infectionProtective protein found in skin, hair, and nailsInflammation of joints causing pain and stiffnessDegenerative joint disease due to cartilage breakdownDiagnostic test measuring electrical activity of musclesInflammation of a tendon due to repetitive use or injury...

Books of the Bible  2020-08-04

21 Items: ofSongJoelAmosHoseaJonahMicahNahumIsaiahDanielHaggaiSolomonEzekielObadiahMalachiJeremiahHabakkukZephaniahZechariahEcclesiastesLamentations

Gigi 2021-02-04

23 Items: ofbugbutbabybadabingbadaboombestbingbandbellabotherbackupbubblebiscetsbrotherbalencebaboonsbagloniebackbonebunblingballareina

Day of the dead 2024-05-02

20 Items: ofdaythediedeadlossdaysfoodcolourmexicanholidayflowersfestivalskeletonancestorsrelativescelebratebutterflycelebratingtraditional

Heart Words Word Search 2025-05-23

21 Items: myheweohsonogotodooftheshewassaydayaretooforseeplayplays

I like cheese 2025-08-14

23 Items: IISoMyOFNahTheLikeMuchThatBodyIntoIntoJustTurnIntoTurnsCheeseMASTERKiddingActuallyCheez-itsCHEESE!!!!!!!!

word search 2 2026-01-08

21 Items: ofdobyohoffitsnowtooI'msawsaidcomeweremadecameheretheredon'taboutlittlechildren

Let Word Search 2026-05-28

23 Items: ofinasoftobeLettheoneyouAndruleyourbodywerepeacesincepeaceChristheartscalledmembersthankful

Psychological Word Search 2026-04-28

12 Items: StigmaDisorderDisordersDisordersHypothesisSchizophreniaSpectrum DisordersHealth OrganizationDepressive DisorderPsychiatric AssociationManual of Mental DisordersClassification of Mental Disorders

Editing 1 101025 2025-10-13

13 Items: A specific type of ground or land.A very brief, quick look at something.(Of water) cloudy, muddy, or not clear.Not mapped or explored; unknown and new.The difference or contrast between things.An animal's natural mood or way of acting.By mistake or accident; without intending to.VALUE The obvious or apparent meaning or worth....

27 2025-08-17

15 Items: Lesser crime.Taken into custody.Short-term detentionFound guilty in court.Long-term jail facility.Punishment ordered by court.Organized set of riders traveling togetherEmblem showing affiliation with a motorcycle clubMetal container for fuel or oil carried on long ridesMeeting place for a specific branch of a motorcycle club...

5 Stages of Grief 2026-04-14

15 Items: finding … after a loss - PEACEfifth stage of grief - ACCEPTANCEsaying “if only i had..” - REGRETfourth stage of grief - DEPRESSIONsaying “this can’t be” - DISBELIEFwishing to change the past - GUILTwithdrawing from others - ISOLATIONcontinuing life after loss - PROGRESSrefusing to accept loss/reality - DENIAL...

vocab 2026-05-22

15 Items: living off anotheradd explanatory notessmall shop selling groceriesimmaculately clean and unusedthe act of making choice; willa sign of a thing about to happento burn slowly and without a flamean intial activity to release tensiona religious residence especially for nunsthree people or things considered as a unit...

Political vocab 2024-12-10

22 Items: States that consist of multiple nationsA group of people with a common identityExtending a country’s influence by forceA State that mostly consists of one nationNation that is spread out among multiple statesA nation that does not have a state for themselveschanging voting districts to favor one party over another....

Exam Review Word Search - Chaps 5&7 2025-01-17

11 Items: Change in momentumThe amount of force per unit areaspeed Peak acceleration when fallingTwo values change in opposite directionsSecond Law Acceleration ~ net force/massvelocity Peak acceleration when falling with directionResistance Friction Acting on something moving through aircollisions Whenever two objects become tangled or couple together...

Unit 5 10 word Vocabulary word search 2025-02-24

10 Items: sodio(salt levelgripe (short for influenzasaludable (in good health.fresco (when something is freshactivo (when a person is doing somethingmetas( something you set in hopes of become a better version of yourselfDatos (facts that are collected,analyzed,and utilized in various contexts...

Prayer Word Search 2025-04-30

10 Items: – A prayer calling down God's favor.– Trust in God and belief in His promises.– A posture that opens the heart to hear God.– The inspired Word of God used often in prayer.– To make holy through God's presence and action.– A word of affirmation meaning “so be it” or “truly.”– Personal acts of prayer and piety outside of liturgy....

Leo Lens - December 2025-12-31

10 Items: The collective term for newspapers and news mediaThe process of producing multiple copies of the paperA paid notice used to fund the newspaper's productionA title often used for official journals or newspapersA journalist who reports from a specific remote locationThe activity of gathering, creating, and presenting news...

Chapter 3 Vocab 2025-02-07

15 Items: a push or pull exerted on an objectgravitational force exerted on an objectstates that energy cannot be created or destroyedsum of all of the forces that are acting on an objecttendency of an object to resist any changes in its motionforce that opposes the motion of objects that move through the air...

Variable Word Search 2025-10-08

15 Items: The opposite of that operationA term the number stays the sameThe process of finding the variableWhen there's only one step to solveWhen there's only two step to solveA letter that represents a unknown numberThe final number that makes the equation trueA the number that is multiplied by the variablesign The sign that means two expressions are equal...

Chemical Word Search 2026-05-30

15 Items: the energy of movementenergy carried by moving electric chargesenergy stored in food, fuels and batteriesenergy carried by vibrations through a mediumstored energy due to position, height or shapeheat transfer by the movement of liquids or gasesthe ability to make things happen or cause changetiny pieces of matter that make up all substances...

ROCKS! 2026-01-07

7 Items: this type of melted rock is found inside the Earth.a type of rock formed by compacted and cemented sedimenta type of rock formed directly from cooled magma or lava.this type of melted rock is found on the outside of the Earth.this type of crust, or tectonic plate,is found beneath the ocean!...

The Solar System 2024-01-09

20 Items: What we breatheThe color of MarsWhat color is Mercury?The big holes on the moonThe blue part of Earth areThe Earth is a ___________.The green parts of Earth areThe number of moons Mars hasThe closest planet to the sunThe second planet from the SunThe fourth planet from the SunDarker, cooler spots on the sunJupiter is called a _____ giant....

End of Life 2024-05-01

13 Items: experience of losing a loved one by deathfear and apprehension of death; death _______________withdrawal of life-sustaining support: _______________ euthanasiaintense physical and psychological distress following the death of a loved onedocuments that mention a health care agent and living wills; advance _____________...

Historic Vernon Bible Study: “EPHESIANS” 4/1/2025 2025-04-01

40 Items: GRACEPEACEAPOSTLEMYSTERYRENEWEDFAITHFULABOUNDEDGENTILESPRISONERMEEKNESSPROPHETSDOCTRINEEDIFYINGSALVATIONHOUSEHOLDQUICKENEDSTRANGERSCOVENANTSPARTAKERSLOWLINESSCAPTIVITYEFFECTUALFORGIVINGFOUNDATIONREDEMPTIONABUNDANTLYBITTERNESSINHERITANCERichInMercyWORKMANSHIPNewTestamentCIRCUMCISIONDISPENSATIONTRIBULATIONSLONGSUFFERINGTENDERHEARTEDHeavenlyPlaces...

Moses Word Search 2025-05-30

37 Items: SeaoutSeaArmyFearWindbackCampMosesEgyptGloryFaithstillPlacesPursuegroundDepartWheelsPharaohDrownedforward& Signsof fireChariotsHorsemenHardenedof waterof cloudEgyptiansSalvationOverthrowIsraelitesVocabulary& CommandsPi-hahirothBaal-zephonDeliverance

Native American Culture Regions 2023-09-19

10 Items: The region of the far north, cold and harshA culture regions home is also called _________The region where buffalo was a main food sourceThe region that was diverse and good basket makersThe region of deserts yet farmed due to irrigationThe region along Pacific Ocean known for totem polesThe region of warm and mild climate and good farmers...

The louvre 2025-05-22

14 Items: LisaDavidDavidLiliesVermeerda VinciDelacroixGéricaultof NapoleonMichelangeloLeading the PeopleRaft of the MedusaVirgin of the Rockswith a Pearl Earring

30c review 2026-05-28

14 Items: Negative Utopiason of Priam, king of TroyState control over all aspects of lifeutopia that Candide discovers (then leaves)a coming-of-age story centered on inner growth.“Sing, goddess, the wrath of _______, son of Peleus.”place where cataclysmic earthquake takes place in 1755...

Bengalfamine Word Search 2026-05-12

12 Items: MauMau: “savages armed with ideas” is the choice of words used by Churchill to describe Kenyan insurrectionists fighting British rule in the 1950s.Gahndi: "We should be rid of a bad man and an enemy of the Empire if he died." This was Churchill's wartime stance on which famous Indian pacifist?...

WIP 2026-05-12

12 Items: MauMau: “savages armed with ideas” is the choice of words used by Churchill to describe Kenyan insurrectionists fighting British rule in the 1950s.in 1937 Churchill informed the peele report on palestine that North America and Australia had been “colonised by a stronger race, a higher-grade race”....

Spelling Word Search 1.5 2025-10-23

15 Items: a line of poetry or a section of a songto ride on ocean waves using a surfboardserious and strict in manner or appearanceto go back to a place or give something backto say something suddenly and without thinkingto twist or move around in an uncomfortable wayan exam given in the middle of a school term or semester...

Final Review 2025-11-21

15 Items: Economic system developed by Adam Smith.French estate that was made up of the clergy.Who gained independence through a slave revolt?What country became unified under Otto von Bismarck?What was the result of all Latin American revolutions?What is another word for peasant in the feudalism system?...

Circulation Search By: Zena.K and Jana.J 2025-12-05

15 Items: What organ pumps blood throughout the body?What receives blood from the right ventricle?What receives blood from head and upper limbs?What receives blood from the trunk and lower limbs?Which type of blood vessel carries blood away from the heart?Which type of blood vessel carries blood back toward the heart?...

09 2025-08-16

15 Items: This term refers to a car.A very long motorcycle journeyA short ride taken in a single dayTraveling long distances by motorcycleLifestyle of riding cruiser motorcyclesThe culture and passion for riding bikesA planned trip covering multiple destinationsTo ride a motorcycle aggressively or intenselyFeeling of liberation while riding a motorcycle...

Bible Memory Verse  2016-08-25

12 Items: I8amof12thethesaidJohnJesuslightworld

games 2017-11-29

12 Items: ofofgamepreyevilcalldutyzerodawnthroneshorizonresident

M100W Golden Words 2020-06-09

12 Items: IABEITINISTOOFANDTHETHETHAT

PSALM 147:4 2025-01-10

14 Items: Heofhetoofthetheallthemstarsgivesnamescountsnumber

Spelling words 2025-02-05

11 Items: ofspotcametakecakemakemadegavespellstillfebruary

Alex's Trick Words 2025-04-28

11 Items: asofbyhasarelooksaidwanttheylovelike

League Word Search 2025-07-02

11 Items: OfKingCroreLeagueMagnusOverallLiquidsLegendsThousandAchievementProductivity

Trick words/vocabulary words 2025-09-11

11 Items: isoftheandhismaplitjobfixquitSeptemeber

For all have sinned and come short of the glory of God. Romans 3:23 2025-10-17

12 Items: ofofForallandtheGodhavecomeshortglorysinned

Sight Words 2026-02-10

11 Items: itofintooncatdogandtheforthat

For Word Search 2026-03-23

12 Items: OfOfForAllAndTheGodHaveFallShortGlorySinned

Music Memory 2024-04-29

10 Items: GrilloSalutede lunefrom SupermanIrae from Requiemfrom Sleeping Beautyto Act 3” from Lohengrinfrom Orchestral Suite No. 2from Carnival of the AnimalsArrival of the Queen of Sheba Solomon

Greendog triva 2026-03-11

10 Items: owns castlebest swordsmanis brainrottedmultiversal powerslives in the castlehis third characterhas three characterssword of best swordsmancreator of this word search namecreator of the word search other name

Musicals 2022-05-26

27 Items: MIAWIZFAIRrentannieevitaOF OZgreasechicagoPOPPINScamelotoklahomaOF MUSICcarouselMUSIC MANTHE WOODSLION KINGseussicalhairsprayFAIR LADYCHRISTMASKING AND ISIDE STORYMISERABLESBYE BIRDIEIN THE RAINME IN ST LOUIS

Auténtico 2B 2023-04-19

23 Items: ofmyflagdeskdoorhereyourmouseclocktablechairtherein/onposterscreenwindowWhere?computerbackpackkeyboardtrash canon top ofpencil sharpener

Festivals 2025-04-23

27 Items: DiwaliEkadashiAnnakutaNandotsavaGopashtamiVyasa-PujaJanmashtamiRatha-YatraRadhashtamiSnana-YatraRama-NavamiKirtan-MelaJhulan-YatraGita-JayantiGaura-PurnimaKartika-VrataTulasi-VivahaGauranga-MelaGovardhan-PujaVamana-DvadasiPavitra-EkadasiAkshaya-TritiyaBalarama-PurnimaFestival-of-IndiaNrsimha-CaturdashiPanihati-Chida-DahiFestival-of-Inspiration

Insurance Claim 2026-01-28

29 Items: SOLOffPayDraftCheckPacketStatusRepairEscrowPlacedProctorCompanyReleaseIn FullCurrentof LienInvoiceReissueProposalDocumentsAffidavitDelinquentof ForgeryProcessingInspectionEndorsementDepreciationSupplementalAdjuster Report

Our Wedding Word Search 2026-01-08

14 Items: Wedding monthOur sons nameWhere we liveCeremony locationSlovakias capitalraise a glass of…Our daughters nameWedding destinationWhere we got engagedOur new marital nameFirst dance song nameThe currency used hereName of bar for welcome drinksName of the Hotel for reception

Summer of the Mariposas Chapters 1-7 2025-10-15

15 Items: Mother to InesNumber of sistersLeader and narratorOdilia's magical itemThe baby of the familyThe dead man's first nameSpanish for "butterflies"State where the girls liveMama's job is a __________Country the sisters travel toMythical creature guiding the girlsAnimal that symbolizes transformationFavorite game played by the Garza family...