4th of july Word Searches

8th grade Noah 2024-05-15

15 Items: Charging an object without touchingThe number of protons + the number of neutronsa material in which charges cannot easily moveThe number of protons. It is also the number of electrons.An unbalanced amount of positive charge and negative charge.An object with equal amounts of positive and negative charge...

Idioms 2026-04-15

20 Items: eyeflymoonmileblueboatfishyand twothe haythe knotof steamthe wordthe booksthe fencein stomachout of bagof my hairto the firean arm and legout of molehill

9306 Shoes of Peace 2023-12-25

10 Items: A follower of Jesus.Told off or scolded.Son of God, Savior, and Lord.Belief and complete trust in GodBeing in a state of rest, not awakeReally surprised, in awe of somethingReally bad weather with lots of wind and rain.A kind of vehicle that floats and moves on water.A big area of water that is smaller than an ocean...

Derivatives of First Semester Vocab Word Search 2025-12-08

15 Items: Verb; To disturb, agitateNoun; Any fleet of warshipsNoun; A particular time/eventPl. Noun; Weapons collectivelyNoun; Military forces of a nationNoun; The fact/state of being unawareAdjective; Tending to upset or agitateAdjective; unmindful, unconscious, unawareNoun; Any part of the entirety of salt waterVerb; To interrupt the quiet, rest, or peace...

Sip And Solve 2026-04-06

13 Items: The wedding month?Bryan's herd name?Maeve's occupation?Name of Maeve's dog?Honeymoon destination?Bryan's favourite take-away?What month did Bryan propose?What month is Maeve's birthday?What did Bryan study at college?What is Maeve's favourite cocktail?What soccer team does Bryan support?Location Maeve and Bryan got engaged?...

Harrisonburg Word Search 2024-10-09

24 Items: Bride’s birth monthGroom’s birth monthHoneymoon destinationBride’s favorite showColor of bride’s eyesColor of groom’s eyesGroom’s favorite hobbyWhere the couple livesCouples favorite liquorBride’s favorite cookieThe couple’s dog’s nameBride’s favorite singerMonth the groom proposedCity where the couple metType of dog the couple has...

Health Word Search 2025-03-28

12 Items: C of DECIDE1st D of DECIDETop cause of death in the US.Your relationships with others.Achieving health in all three areas.____ Stress: An impact on our mental health.The health of your body & how well it functions.The things that you believe are important in life.The ability to deal with emotions, health of the mind....

Photosynthesis Word Search 2025-03-23

20 Items: A large, slow-moving mass of iceA dry region with little rainfallThe layer of gases surrounding EarthEarth’s spinning movement on its axisThe second layer of Earth’s atmosphereThe path a planet follows around the sunA mountain that erupts with lava and gasesA piece of land nearly surrounded by waterRain, snow, sleet, or hail falling from clouds...

Exam Revision Word Search 2025-11-15

24 Items: A nerve cellA mental categoryThe fear of being without ones phoneTaking pleasure in someone else's painThe acronym for the Fear of Missing OutNon-biased information that is measuredVygotsky's Zone of _________ DevelopmentThe image used to represent an emotion onineThe positive outcome of Piaget's first stage...

“Difficult Choices in Poland” from Facing History and Ourselves 2026-03-19

30 Items: Nazi secret policeDangerous or unsafePeople living nearbySmall rural communityPersonal benefit or profitSilent or unspoken approvalWoman who hid Jewish childrenKilling of many people at onceReporting others to authoritiesKilling of individuals or groupsCooperation with the Nazi regimeActs of retaliation or punishment...

Mr. Kaiser's Georgia Studies Review 2026-04-29

20 Items: Elected President in 1860Trustee who founded SavannahGeneral who Marched to the SeaThe only president from GeorgiaUsed the New Deal to create jobsThe bomber plant in Marietta during WWIIJewish man who was lynched by a Marietta mobThe period of rebuilding following the Civil WarA type of WWII ship built in Savannah & Brunswick...

Chapter 3 : The Constitution Vocabulary 2024-01-31

16 Items: vetorepealcabinetgridlockGovernmentSovereigntyrule-of-lawsupermajorityjudicial-reviewpolitical-partyunconstitutionalsupremacy-clauseelectoral-collegechecks-and-balancesseparation-of-powersexecutive-agreements

Holy Word Search 2024-09-27

24 Items: BEGODARKSOULMARYMASSLOVEGIFTSJESUSJOSEPHOF GODCHURCHNOVENAFATHERTRINITYCREATORAND EVEBELIEVEALMIGHTYCREATIONGENEROUSDISCIPLESGENEROSITYOF CONTRITION

Evolution Word Search 2022-08-24

15 Items: A segment of DNA that codes for one specific protein.Changes within a population over long periods of time.A visible characteristic due to an individual's genotype.The passing down of genes from one generation to the next.An evolutionary force due to mate selection and preference.A genotype where both alleles of a given gene are the same....

LA 2023-10-25

21 Items: Poor balance and coordination:________Involuntary, uncontrolled movement:__________This type of spina bifida is the most severe:________Pre-, peri- or post-natal brain hypoxia:________ ________Velocity-dependent resistance to passive stretch:________Joint stiffness and deformity as a result of fetal akinesia...

Suspensions Word Search 2025-03-26

35 Items: ion with (-) chargealso known as basesgas with pungent ordereasily absorbs moisturesubatomic with (+) chargecontraction of surface agentsion with (+) electrical chargeparticles with negative chargemixture of 2 or more substancessimplest form of chemical matterrapid oxidation of heat and lightsubatomic particles with no charge...

Citystate Word Search 2026-01-07

24 Items: God of war(战争之神)God of the sea(海神)The exchange of goods(贸易)God of the underworld(冥界之神)Rule by wealthy landowners(贵族统治)Traveling and trading by sea(航海)Goddess of love and beauty(爱与美之神God of the sun and music(太阳与音乐之神)Government where citizens vote(民主)Land almost surrounded by water(半岛)Rule by a small powerful group(寡头政治)...

Year 10 Circulatory and Respiratory system 2026-05-08

12 Items: The two bottom chambers of the heartTakes blood from the heart to the bodyYour windpipe branches into two of theseWhen breathing in, the diaphragm _______.The type of muscle the heart is made out ofWhen breathing out, the diaphragm _________.Tiny air sacs surrounded by blood capillariesMillions of alveoli give a ___________. (3 words)...

Anatomical Tooth Definitions - Equine Dental 2025-03-31

20 Items: Towards the root tipUn-Erupted Portion of the toothPortion of the tooth that is ExposedInner layer, softest material of the toothTeeth situated behind the premolars used for grinding forageNormally buried in bone as they serve to anchor the tooth in positionPermanently damaged area in the tooth that develop decay of the Tooth...

Clinicalreasoning Word Search 2026-01-28

25 Items: The mathematical average of a set of scores.The science of measuring mental capacities and processes.A single piece of information used for analysis or graphing.A measure of how much scores vary or deviate from the average.A consistent and organized method for tracking clinical outcomes....

Word Search Choice Board 2026-03-13

28 Items: BoringOsculumSpawning(sponges)Encrustingas a thin crust on a surface.large opening in a sponge through which water exits.surface the surface of an organism opposite the mouth.release of eggs and sperm into the water by aquatic animals.that bore into hard substrates such as coral, shells, or rock....

Science words 2026-06-14

17 Items: tiny piece of mattersimplest form of matterbuilding blocks of mattera young star still forminghow far light travels in a yearthe removal of trees from foreststhe amount of matter in an objecta force that pulls objects togethera community of living and non-living thingsthe variety of life in a habitat or ecosystem...

Engineers Word Search 2023-01-17

26 Items: maintains and repairs x-ray equipmentengineering involved in all aspects of healthcareDevelop and design nuclear products and processesCoaster designs, builds and maintains amusement park rides.processes and analyzes LiDAR point clouds for anomalies and artifacts.improving the manufacturing process to increase the yield of products....

Lu‘s Birthday Search 2025-07-14

16 Items: The dog‘s nameLu‘s first nameName of Lu‘s bfLu‘s Zodiac SignLu‘s car’s brandThe rabbit‘s nameLu‘s favorite teaLu‘s favorite colorLu‘s favorite danceName of Lu‘s girlfriendThe brand of Lu‘s favorite carLu‘s favorite swedish car brandOther brand of best looking bikeBrand of Lu‘s favorite bike (by looks)Lu‘s nickname according to his sisters...

We Will Rock You 2024-07-03

30 Items: Cruel and oppressive government or ruleFormal politeness and courtesy in behavior or speechNot subject to being taken away or transferred; inherentThe faculty or power of using one's will to make decisionsThe capacity to make informed, uncoerced decisions; self-governanceThe belief that free will and determinism are compatible and can coexist...

Crust Word Search 2026-01-18

9 Items: the state of matter of the inner core is _______________the state of matter of the outer core is _________________the _______________ is the solid center of Earth made of iron and nickel_________________ is measured in ℃, increases the deeper you get into earthhow tightly packed matter is, the inner core has the greatest _____________...

Time 2016-03-17

42 Items: dayMayhourweekJuneJulyfallyearnighttodaymonthMarchAprilsecondminuteMondayFridaySundayAugustseasonspringsummerautumnwintermorningeveningTuesdayJanuaryOctobercenturyThursdaySaturdaytomorrowFebruaryNovemberDecemberafternoonWednesdayyesterdayfortnightSeptembermillennium

CALENDAR 2018-12-03

42 Items: MAYHOTJUNEJULYFALLWEEKYEARDAYSFOURCOLDMARCHAPRILSEVENSIXTYFRUITAUGUSTSUNDAYMONDAYFRIDAYSUMMERWINTERAUTUMNSPRINGMONTHSTWELVETHIRTYJANUARYOCTOBERTUESDAYSEASONSFLOWERSFEBRUARYNOVEMBERDECEMBERTHURSDAYSATURDAYSEPTEMBERWEDNESDAYTHIRTYONETWENTYNINETWENTYFOURTWENTYEIGHT

Three: Trial by Twitter 2026-05-01

42 Items: FBIDAVEMARYJULYWIRELIESDIARYDRAMAFIFTYKNIFEWOODSTHREENEESESKYLARSHELIARACHELRUMORSGUILTYPRISONPAROLEPURPLEWENDYSTWITTERSIXTEENSMOKINGPSYCHICSTABBEDOAKTREELETTERSFOREVERSTARCITYNECKLACEFACEBOOKCONCERTSCELLPHONECONFESSEDBUTTERFLYHIGHSCHOOLMORGANTOWNBLACKSVILLEBESTFRIENDSWESTVIRGINIA

5.B Vocabulary 2025-04-25

51 Items: MayshyageJuneJulyniceweakuglypoorrichMarchAprilmoneyAugusta carda cakea giftJanuaryOctoberto growFebruaryNovemberDecemberbirthdayto bringto blushSeptembermean (m.)mean (f.)lazy (m.)lazy (f.)to finisha gift carddiligent (m.)diligent (f.)generous (m.)generous (f.)to give/offerhappy birthdaytalkative (m.)talkative (f.)to gain weightto lose weight...

13 Colonies 2024-12-03

13 Items: Founded in 1629Founded in 1733Grew indigo and riceFounded by John SmithWas a proprietary colonyFounded by John WheelwrightGrew Tobacco instead of cottonNot dominated by a specific religionPassed the "Act of Toleration of 1649"Attracted settlers through advertisingFounded the first Constitution within the colonies...

The Reign of Terror 2025-11-23

15 Items: XVIReignTerrorDantonFranceJacobinsTribunalculottesGuillotineexecutionsAntoinetteRevolutionRobespierreof Suspectsof Public Safety

Early European Exploration 2022-09-09

19 Items: to treat someone unfairlysedimentary rock used to make toolsa territory or state ruled by a chiefa settlement ruled by a distant countrythe average person in Mississippian societya competition for the same objective or itemthe people that held power in Mississippian societythe swamp the many native americans tribes lived in...

Amanda 2025-11-06

23 Items: Last nameMiddle nameBirth monthTabby gray kittenFavorite MLB teamFavorite NFL teamYour age currentlyFavorite MiLB teamYour mom and caregiverBlack and White kittenName of your sisters catSister and Physics studentMiddle school you attendedFavorite Disney movie franchiseFriend you play Basketball withFriend you play Poly Hockey with...

Week 8 - Chapters 15 and 16 2024-07-19

20 Items: Double visionExcessive thirstExcessive hungerExcessive urinationPresence of glucose in urineElevated blood glucose levelsPrescence of ketones in urineOccuring in an abnormal positionAbnormally low blood glucose levelsAcidic molecules produced during fat metabolismGlands that secrete their products through ducts...

Les prepositions 2025-10-07

12 Items: oninunderbehindfacingbetweennext tofar fromclose toin front ofto the left ofto the right of

SIAEC HR Week 2022 2022-09-20

5 Items: This is our F_________ ever HR Week.Receive P___________ cups when you visit us our boothsThe HR Week will happen from 4th to 6th O________ 2022.Find out how you can progress in your C_________ in the dialogue with SVPHR.Find out how each function of HR S_________ your career lifecycle at our booths

Garden Word Search 2024-02-22

20 Items: (Clue: The first man)(Clue: The first woman)(Clue: God's promise symbol)(Clue: Jacob's twin brother)(Clue: Father of many nations)(Clue: Where Adam and Eve lived)(Clue: Adam and Eve's first son)(Clue: Son of Abraham and Sarah)(Clue: Joseph's master in Egypt)(Clue: Tempted Eve in the Garden)(Clue: Built an ark to save animals)...

Genetics Vocab Quiz 2026-01-23

20 Items: DNA turns into RNAChain of Amino AcidsTwo different allelesTwo of the same alleleCodes for a specific geneRNA turns into Amino AcidsChange in the DNA sequencePhysical appearance of a traitMutation where a letter is addedMutation where a letter is removedSection of DNA that codes for a traitDiagram used to chart genetic ancestry...

AMERICAN CULTURE 2024-10-17

19 Items: PIEDAYDAYROLLFOODFOODCREAMHOTDOGSTATESFREEDOMJULY4THBASEBALLBASEBALLHAMBURGEROF LIBERTYTELEVISIONAND STRIPESOF THE BRAVETHANKSGIVING

CALENDAR 2018-12-03

42 Items: MAYHOTJUNEJULYFALLWEEKYEARDAYSFOURCOLDMARCHAPRILSEVENSIXTYFRUITAUGUSTSUNDAYMONDAYFRIDAYSUMMERWINTERAUTUMNSPRINGMONTHSTWELVETHIRTYJANUARYOCTOBERTUESDAYSEASONSFLOWERSFEBRUARYNOVEMBERDECEMBERTHURSDAYSATURDAYSEPTEMBERWEDNESDAYTHIRTYONETWENTYNINETWENTYFOURTWENTYEIGHT

wonder 2024-06-11

40 Items: dogbagdesklockkindhomegamebikejulymathpuppylunchworldclassboardwonderaugustsummerschoolflowerfamilylockerphotoswinterteacherfriendsparentsenglisht-shirtstarwarssandwichnotebookhomeworkhomeroomclassroomseptemberschoolworkenviromentcomputer33tabletennis

Days and Months of the Year 2025-10-09

42 Items: dayMayweekyearJuneJulymonthMarchAprilnightfirstthirdfifthsixtheightninthtenthMondayFridaySundayAugustschoolsecondfourthTuesdayJanuaryOctoberweekendmorningeveningseventhThursdaySaturdayFebruaryNovemberDecemberbirthdayholidaysWednesdaySeptemberChristmasafternoon

Stages of Life 2024-10-08

7 Items: neophobiafear of aginggerascophobiafear of deathstages of lifefear of changemetathesiophobia

Ms. Sargent's Amazing 4th Graders 2025-08-08

17 Items: BenAlexBrokKessTroyGraceEllieKellyDaxtonCarterCamdenSkylerAutumnAmerieKasanovaVenelopeDivinity

Mrs. Vento's 4th Grade Class 2025-08-19

17 Items: KoriNoraKateJordyAddieMasonBradyCorbinXanderAubreyKayleeWestonLincolnAubrianaGiovanniKatarinaTaeleigh

Kate's Sky Science Word Search 2023-12-18

20 Items: rocks in spacerederection of lighta belief about the starsthe galaxy where we livegroups of stars in the skyan object orbiting the suna human that travels to spaceanother way to say big dipperthe study of anything in spacewhen something gives off lightanother way to say little dipperwhen a rock safetly lands on earth...

Emma & Oliver 2025-06-21

27 Items: Brides middle nameName of couple's dogName of couple's catColor of grooms eyesGrooms Favorite ShowBrides Favourite showBrides favorite colortop tier cake flavourCity the Groom is frombrides favorite animalBrides favorite holidayCountry the Bride is fromCouples favorite cocktailcouples go to coffee ordergemstone on the brides ring...

A Spring Word Search 2026-02-20

25 Items: A baby duckA newbie treeA spring hobbyRed Breasted BirdA colorful insectMarch 20th EquinoxHow a Tulip startsA story of Kafka fameA Day to celebrate treesShowers bring May flowersA classic yellow raincoatA thatched home for birdsFirst signs of plant growthPink or White blooming treeThe first prankish day in AprilThe warming up from ice and snow...

Aren's silent consonant word search 2025-11-07

15 Items: RelaxedNot a rowWhat you knowSign of old ageA part of your handMoving out of the wayThe look of somethingSomebody's personalityTwo of them make a wholeWhen you owe someone moneyPut something in its placeWhat you say for a questionMany things happening simultaneouslyWhen you are not sure about somethingWhen you have negative feelings towards someone

Where is this Event? HARD 2026-02-05

14 Items: 1873170218671989RihannaJunkanooGod of WineZulu and RexSamba SchoolsTwelfth Night16 hours a dayDaniel GarfieldCarnival of IvreaCarnival of Viareggio

PYL3 - Unit 10 - Reading 2026-01-07

16 Items: With a lot of sun. (Nắng)With a lot of rain. (Mưa)With very low heat. (Lạnh)With very high heat. (Nóng)Start something new. (Ra mắt)Find something new. (Khám phá)With a lot of wind. (Gió nhiều)A planned piece of work. (Dự án)With strong wind and rain. (Bão)The level of heat or cold. (Nhiệt độ)Put a file on the internet. (Tải lên)...

Tidals and Waves 2026-03-23

16 Items: an oval-shaped pathlowest point on a wavehighest point on a waveshore area of a body of watersand bars attached to a mainlandtwo high levels and two low levelssun and moon are in a straight linea large wave with a long wavelengthenergy that moves through the ocean;wave that collapses/ destroys the wavegraphic record of rise and fall of tide...

Art Functions, Media, Elements of Art, and Principles of Design 2025-01-29

17 Items: FiberPaintMarkerPencilPastelsWatercolorThis element is 3D.This element is 2D, or flat.The degree of lightness or darkness.Materials used for the expression of ideas.Line, Shape, Color, Form, Space, Texture, ValueWhich function of art is made to help meet day to day needs?Balance, Contrast, Emphasis, Pattern, Rhythm/Movement, Unity...

Roman Numerals 2025-03-24

10 Items: 300 ______39 _________408 __________5,000 _________the current yearfourteen _______XLV __________________ (English word)XV + XV = ________________ (English word)the year of the founding of Rome _________the year of the Declaration of Independence ____________

Courthouse Word Search 2023-10-18

18 Items: Lying in courtPerson who is on the juryPromise to tell the truthAn expression of disapprovalLawyers examination before trialThe official decision of a courtRepresents the defendant in courtThe decision of a jury or a judgeAn invalid trail, caused by big errorA claim that someone has done somethingAsk a higher court to review a decision...

Pg. 35 2026-05-18

18 Items: to remove dirtinvolving electricityraised above the groundto put something into uselike oil used for making foodarrangement of parts of somethinga group or category within a systemto get off or climb out of somethinga knot used to attach a rope to an objectit can be folded to fit into a small spacea locking mechanism on an extension ladder...

Literary Devices Crossword Grades 11-12 MA ELA Standards 2025-12-22

30 Items: an author’s word choicea word that imitates a sounda comparison using like or asthe emotional atmosphere of a textdeliberate exaggeration for effectlanguage that appeals to the sensesspecial importance given to an ideaa recurring idea, symbol, or subjectthe sequence of events in a narrativegiving human traits to nonhuman things...

vocab for november 2025-11-12

25 Items: HateAngryDetailedInfamouscheerful; geniala very poor person.Masked ball, disguiseshow or prove somethingharm someone permanentlystrong sense of facinasionA temporary fail in thoughtObstruct someone or somethingCombine one thing with anotherlacking in quantity or qualityconfidence of a person or groupDisfigure or injure beyond repair...

Nutrition and Fitness 2025-04-02

37 Items: How often you do the exerciseGood health or physical conditionHow long you perform the activityThe specific activity you are doingA warning sign of chronic dehydrationAn improved benefit of physical fitnessMovement that results in expending caloriesThis can reduce soreness and risk of injuryThis can change without overall weight changing...

Data Rep 2026-02-04

18 Items: the dimensions of an imagethe number of samples recorded each seconddiscreete data that only uses the values 0 and 1a base-10 number system that uses the values 0-9a base-2 Number system that uses the values 0 and 1a continuous stream of data that is processed by humansA base-16 number system that uses the values 0-9 and A-F...

4th Grade Word Search 2025-11-07

12 Items: saxwaxtaxboxflexsackstacksrelaxkinksfleckswhacksclucks

4th Grade Vocabulary Words 2026-06-23

12 Items: cynicbluntdecayancientconsumetricklefearlessmarveledmajesticobsessedcautiouslydisoriented

4th Hour 2022-12-20

6 Items: catlionzebrahippoelephantMan's best friend

Christmas and more 2022-12-16

27 Items: elfpolestarjudekerrcarolgravysantaangeljesuscaroljamieturkeypotatocarrotsleighjumperskiingchickenpuddinglaplandsproutsscroogereindeerchristmasof new Yorkghosts of Christmas past

Frank Word Search 2025-07-08

30 Items: AlexLunaJanefromnearconeFrankSunnySuzieabovefirstchurneverystoreWaldenbehindbesideinventlot offlavorschooltomatopicklehistoryfactoryvanilladessertfront ofchocolatebarbershop

Sustainability 2024-10-09

12 Items: The variety of all living species on the planetMass destruction of forests, often for agricultureKind of energy obtained from the heat inside the earthThe process of reusing waste as raw material for new productsThe ability to do work, often obtained from renewable sourcesThe presence of harmful substances in the air, water, or soil...

Vocabulario - Auténtico 1, Capítulo 2B Tu Sala de Clases 2026-02-17

16 Items: ofmyyoutheheresometherebehindWhere?in, onon top ofit's a...underneathin front ofthere is/areWhat is this?

Jackson Era Choice Board Word Search 2025-11-21

20 Items: ClayBankBankGoldCrisisBargainJacksonNullifyTarrifsDemocratPopulistCarolinaof TearsSuffrageRepublicanPatriotismRemoval ActAgricultureLaissez-faireof Good feelings

Hayden's Waves Word Search 2022-11-28

10 Items: areas of maximum displacementareas of maximum displacementfrequency is measured by hertzlocation of maximum displacement upa distance of one complete wave cyclelocation of maximum displacement downmeasurement of of maximum displacementa number of waves or vibrations per secondwave, moves the medium parallel to the wave motion...

Chapter 2 Vocabulary 2025-08-21

10 Items: ModifyClimateLocationLatitudeGeographyLongitudeCoordinatesof LatitudeDistributionof Longitude

IT'S CORN 2025-10-18

12 Items: The small seed part of a corn cob.The science and practice of farming.The layer of earth where plants grow.The tall, sturdy stem of the corn plant.A person who grows crops or raises animals.The center part of the corn where kernels grow.The process that helps corn plants make new seeds.The process by which plants make food from sunlight....

Cardiovascular Systems 2025-11-24

9 Items: incision into a veinoriginating in the heartcondition of fast/rapid heart (rate)inflammation of the muscle of the heartabnormal reduction of (all) blood cellsabnormal reduction of white (blood) cellsabnormal reduction of (blood) clotting cellsPhysician who specializes and treats blood disorders...

Force and Motion 2023-11-27

20 Items: Unit of ForceA push or pullDistance over timeThe amount of matter in an objectDistance over time with a directionAn object's resistance to change in motionthe measurement of paths taken by an objectthe action or process of moving or being movedSpeeding up, slowing down, or changing direction...

Acute Word Search 2024-11-21

20 Items: willful, stubbornto prove incorrectto make peaceful or calm; to sootheoverly self-satisfied, self righteousgreedy; very hungry; eager for satisfactiondeep and painful regret for one's past misdeedsthe lenght of time that something continues or lastscausing fear because of strangeness; weird, mysterious...

Parliament Triumphs Over England 2024-12-17

20 Items: The belief that monarchs are appointed by God to ruleThe army led by Oliver Cromwell during the civil war.One of the charges against Charles I during his trial.The supporters of Charles I during the English Civil War.A serious crime that Charles I was accused of committing.The supporters of Parliament during the English Civil War....

properties 2025-03-10

13 Items: windsillwidthdepthlengthheightweightwindowwindowstrengththicknessof an objectof and object

citizenship and responsibility 2024-12-10

12 Items: lawJudeovirtuecitizenreligionmoralityauthorityof powersprovidencecitizenshiprepublicanismof association

Pakistan 2024-08-27

14 Items: desertcurrencycapital citynational gamelargest rivernational poetcity of lightsnational fruitnational dressmountain rangecity of saintsnational animalnational flowerheart of Pakistan

Nitrogen Word Search 2026-02-09

18 Items: Harmful substances that pollutes the air.Such activities are not advisable during a haze.haze can cause ________ to our eyes, nose and throat.A method to reduce the number of vehicles on the road.Burning of ______ fuels release pollutants into the air.What acid rain can do to statues and buildings over time...

Miss Gould's 4th Grade Class 2025-08-11

17 Items: LeoJaxZoeyEmeryTysonRomanTeiganKamdynCarterCarsonJaegerGarrettRosaleeCashtonMadelynIzzabellMissGould

Mrs. Caesar's 4th Grade Class 2025-08-12

17 Items: GinoAyminJasonDavidJulianOliviaHassanAlyssaDorcasSergioXavierSophiaRosendoLeilaniBrashodJonathanMrsCaesar

Year 10 Physics, Term 1 - Measurement 2026-02-15

16 Items: Mass × velocity (8)SI unit of force (6)Slope of a graph (8)Push or pull on an object (5)Estimated range of error (11)Rate of change of velocity (12)The “strength” of a battery (7)How close repeated values are (9)Cannot be created or destroyed (6)International standard unit system (6)Important digits in a measurement (11)...

95 Word Search 2024-10-09

15 Items: vll had 6 wivesguess about someone or somethinghunt took place from about 1450 to 1750parallel lines covering to a single pointdistinctive among 16th-century reform movementswas a period in history between 14th and 16th centuryitalian renaissance sculptor paunter architect and poetan Italian painter and architect of the high renaissance....

A Word Search 2026-05-20

10 Items: ofanygivehappyangrylaughlot ofgardenhungrygood for A

4th Grade Word Search 2026-04-13

12 Items: gamesbooksmovieshikingsoccertennisreadingsingingdancingdrawingbaseballbadminton

Vocab 2 Word Search 2025-12-15

20 Items: Famous for something badLasting a very short timeSly or cunning intelligenceIncapable of making mistakesLacking in flavor or interestShowing Steady, earnest effortOne who attacks cherished beliefsHaving or showing great knowledgeOpen to one or more interpretationTo persuade by flattery or promisesThe quality of being open or honest...

Final Practice 2 2026-03-26

25 Items: kept secretno longer usednot yet finalizedflowing in abundanceshort account of eventbased on a random choicestate of being uncertaincapable of being changedhighly critical languageliteral meaning of a wordexperience through anotheruse of verbal irony to mockvisually descriptive languageto reach an overall agreementto be doubtful or questionable...

Week 11 easy 2023-11-08

24 Items: winnerto worryurge to vomitfeeling relaxedthe guilty personable to do somethinginventive, imaginativea main branch of a treea false or mistaken ideathe removal of somethinglover of mankind; doer of goodwanting to know more about thingsthe season between summer and winterouter covering or sleeve for a letterthe hardest mineral on the Moh's scale...

Kenzie's Science Wordsearch 2023-12-18

20 Items: Is earths GalaxyA group of stars making a shapeIt must be big and orbit a starA path that a planet is stuck inThey study of everything in spaceWhen light bounces off the objectA piece of rock floating in spaceDischarged gas air and other stuffA rock that enters earths atmosphereBelief of that signs tell our personality...

Ancient Rome 2025-06-08

20 Items: The first emperor of Rome.The king of the Roman gods.The ruler of the Roman Empire.A large unit of the Roman army.A garment worn by Roman citizens.A member of the wealthy, ruling class.A common citizen or lower-class Roman.A term Romans used for non-Roman people.A political body that advised Roman leaders....

Narrative subgenres 2025-09-22

20 Items: Fairy tales charactersfirst German collectors of taleskind of narrator used in an epic storyThe main purpose of the narrative genrethe word myth comes from this Greek wordcentral theme of the epic poem Gilgameshstory about the lives and actions of godsfairy tale usually begins with this openerMinor subgenre that contains a moral lesson...

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

Week 11 hard 2023-11-08

23 Items: winnerto worryurge to vomitfeeling relaxedthe guilty personable to do somethinga main branch of a treea false or mistaken ideathe removal of somethinglover of mankind; doer of goodwanting to know more about thingsthe season between summer and winterouter covering or sleeve for a letterthe hardest mineral on the Moh's scale...

Voices of Strength 2024-07-20

20 Items: legal entitlements.relating to the home or family.the right to express an opinion.action taken to improve a situation.the quality or state of being strong.public support for a cause or policy.a safe place for those escaping abuse.knowledge or perception of a situation.a condition of being safe or sheltered.the state of being free within society....

Globalization 2025-08-19

27 Items: RejectRelated to homeTesting somethingUsing something upTiring someone outThe buildings of a cityIn relation to somethingTo make sure of somethingThe opposite of inconvenienceTo erase or eliminate somethingThe increase of prices over timeTo leave something or someone outHistorical network of trade routesSomething you are good at is your......

Final Practice 1 2026-03-26

25 Items: more than enoughto feel satisfiedprovide evidence forleave out or excludepertaining to beautyto aid the progress ofclearly express in wordsthe writer's word choicesubtle difference in meaningnot important or significantnon-literal meaning of a wordapparently contradictory termswhen something is about to happenmultiple possible meanings of a text...

Science: whole year 2 2026-05-18

21 Items: NUMBERSCHESAPEAKE BAYLARGEST PLANETMEASURES HUMIDITYGREAT DISMAL SWAMPMEASURES TEMPERATURENUMBER OF WATERSHEDS IN VIRGINIACURRENTLY LIVING OR ONCE LIVING THINGSNEGATIVELY CHARGED PARTICLE INSIDE AN ATOMPOSITIVELY CHARGED PARTICLE INSIDE AN ATOMADD THESE TO NUMBERS SO THEY AREN’T NAKED!ONE OF THESE AROUND THE SUN TAKES 365 DAYS...

idk 2026-03-20

9 Items: dinosaurpyroraptort-rex's rivala famous type of raptorbasically a ancient tankthe giraffe of dinosaursthe king of the dinosaursa armored dino like triceratopspart of its name is a feature of it

PARLAIMENTARY VOCABULARY 2026-03-06

10 Items: StateMotionQuorumDebateDelegateof Orderof ReplyPresidentSecretaryPrivilege