4th of july Word Searches

speelangs 2 2025-05-16

12 Items: dawn in Latinpleasantly warmstrikingly brighthaving a pearly lusterpossessing or deserving gloryextremely and uncomfortably hota state of seclusion or isolationthe quality or state of being happyrelating to the regions beyond the earthradiating rays or reflecting beams of lightenergetic, exciting, and full of enthusiasm...

∞ Official Big Mountain Word Search ∞ 2025-06-01

25 Items: How you made it back homeThe ___ Deconstruction plantThe X-2 Transmitter ___ ArrayA scientist aware of his flawsMobius' home; Forbidden to you!The honorifics of the Think TankThe leader and head voice of the DomeThe programmed fate of the Think TankA loyal companion, through and throughThe third piece removed from your body...

10 spil 2019-03-18

13 Items: offspikwoldcsgotanksfisserobloxageriols2018fortnitelollipopcounterblox

Text Structure Word Search 2019-05-31

13 Items: oftextcauseordereffectproblemcomparesolutionsequencecontraststructureimportancechronological

Name: ___________________ Lesson 17.2 2023-02-22

13 Items: onsoofisbuthowfindthisfromcamemanyellenwhere

Massimo Finder 1 2024-08-31

13 Items: ofFithimdippigkidwinseethemistskipwhatwant

Sparkles from the Wheel 2017-04-21

17 Items: InoofNoWaltHearGrasspoetrythingsstrokeLeavesrealismWhitmanStreetsAmericaSingingsimplest

Gold M100W 2018-02-15

16 Items: itinoftobetheandwasthatMondayFridaySundayTuesdayThursdaySaturdayWednesday

My Room 2022-03-12

16 Items: ofBedRugLamptableChestShelfChairPosterPillowCarpetClothesBedsidedrawersCurtainsWardrobe

Word Search Large Print for Adults: 4000+ 2025-04-02

18 Items: ofonofandtheandCalmEasyEyesFullEnjoyHoursBrainGamesMentalVarietyRelaxingStimulation

My Word Search 2025-07-27

18 Items: IamyismyisofatandlotbestnamehavefriendFarizaschoolFarishafriends

Wedding 2024-07-08

34 Items: Name of Trevor's baby nephewCaseys uncle who lives in WashingtonName of Casey's brother who loves musicCaseys cousin who is a Barre instructorCasey's cousin who has been to AntarticaName of Casey's brother who loves to golfPlayed baseball with Trevor in high schoolMark's wife who played softball in collegeName of Casey's niece who played volleyball...

Endocrine System 2022-08-04

20 Items: also know as alpha cellThyroid gland secretes itparathyroid gland targetsparathyroid gland producesThyroid gland also make thisanother name for insulin cellsanother hormone found in thymushyposecretion of growth hormonepromotes sodium & water retentionthis hormone is for tissue growthantagonist of the parathyroid gland...

TKAM CH 15-20 Vocabulary 2025-03-28

20 Items: tactless; boldappearance; facestrike out; erasestaggered; stumbledthe esophagus; throatintimidating; bullyingan unpleasant situationa particular course of actiondirect and unreserved in speechwashings; the process of bathinga feeling of resentment or ill-willwith great anger, hatred, or ill-willfamiliar; having personal knowledge of...

Jessi and Jonathan 2025-06-30

30 Items: Wedding MonthWedding ColorGroom’s ProfessionBride’s professionWedding Venue CityGroom’s Middle NameGrade Jessi TeachesBride’s New Last NameHoneymoon DestinationColor of Groom’s EyesColor of Bride’s EyesCity Bride Grew Up InCity Groom Grew Up InCity Jonathan ProposedBride’s Birthday MonthGroom’s Birthday MonthMonth Jonathan Proposed...

Cycle 1 Vocabulary Week 6 2024-10-02

12 Items: the action or fact of forming a united wholethe basic chemical building blocks of mattera flat, 2-dimensional, surface which extends infinitely farThe difference between the lowest and highest values; outputa legal entity that is separate and distinct from its ownersgeneral plan of organization, arrangement, or choice of material...

Cycle 1 Vocabulary Week 7 2024-10-16

12 Items: A layer of gases surrounding Earththe action or fact of forming a united wholethe basic chemical building blocks of matterA comparison of two numbers, shown as a ratioa flat, 2-dimensional, surface which extends infinitely farA meeting of people face to face, especially for consultationbring (goods or services) into a country from abroad for sale....

Vocabulary Treasure Hunt. 2013-12-13

19 Items: ofLawwaveOpaquePigmentSpectrumRadiationReflectionReflectionAbsorptionScatteringRefractionDiffractionTransparentTranslucentInterferenceTransmissionElectromagneticElectromagnetic

The Presidency 2017-05-23

17 Items: ofvetooathleaderofficecitizenprimarypopularideologyelectionpresidentincumbentdemocracyconventionnominationsovereigntyconstitution

World History-Chapter 1 Terms 2021-08-15

18 Items: oferaviewbiaspointfossilsourcesourcespeciesprimaryartifactevidencesecondaryscholarlyconclusionarchaeologypaleontologyanthropology

Enkelvoudige en samengestelde zinnen 2025-05-25

17 Items: EnOfAlsPuntOmdatKommaBijzinHoofdzinZinsdeelOnderwerpVoegwoordWerkwoordEnkelvoudigPersoonsvormSamengesteldWerkwoordelijkNaamwoordelijk

MONDAY 2014-10-03

15 Items: onsoofallnottheandhoppopcallfallwallballtallwhat

Spelling Lesson 13 ~ Puzzle 4 2017-01-02

15 Items: ofoffpaidenemyreferaroundimaginefamiliarparallelreligionshepherdeverybodyimmediatecompletelyconscience

Search 47 - Shakespearean Quotations 2019-05-09

16 Items: OfTheDidRunActOneOneTrueLoveNeverNightDreamSceneCourseSmoothMidsummers

Merry Word Search 2023-12-24

15 Items: abeofcanforthismerrythreecoursedinnervoucherqualityredeemedchristmasquestionable

HFW 2024-09-15

15 Items: togoofandwasthearecatratmatmugjugzapzigzag

Unit 14 Word Search 2024-12-03

15 Items: ofwaswhosaidsomeworldearthagainpeopleschoolcountryAmericabecauselibraryordinary

List 2 2025-06-23

15 Items: ofrackrakelicklikebackbakekickfakerockmakewhathavesocksbikes

El Capibara con Botas 2024-05-07

15 Items: treeboatbootssharkwebbedhe hasblowpipethey escapehe/she spitscapital of Ecuadorlas montañas en Ecuadorla selva más grande del mundoislands off the coast of EcuadorCarlos necesita plantar las ______.the region of Ecuador with the Pacific to the east

Sarah 2020-05-26

18 Items: ofFireAnnaElsapianoWingsHarryDobbyrobotPotterTalonsGrampaGrammaHagridGrangerHermioneWashingtonBroadbranch

alliteration.  2022-01-12

19 Items: AaofatpotandwasLilyPeterlovedlivedpaperPickedlilacslodge.pickledpeppers.Paisleysperfect.

How many sight words can you find? 2024-06-06

18 Items: atasofitistomyinbeifdotheandwasforsaidtheywith

CH 2 Review 2024-09-26

17 Items: muscle shrinkagethis term mean sacthis term means footthis term means bluethis term means deathweak and brittle bonesthis term means tensionthe shaft of the long bonethis term means developmentlines the inside of the bonechronic muscle pain and fatiguethe innermost layer of the HAIRthis term means vertebrae or spine...

Unidad 2B 2024-02-01

30 Items: ofmyflagdeskdooryourclocktablechairtherein/onposterscreenwindowbehindWhere?it's abookbagnext tonext tocomputerkeyboardon top ofunderneathwastebasketin front ofWhat is this?computer mousepencil sharpenerthere is/there are

A puzzling gift 2022-12-24

13 Items: Not dadA type of fallSomeone specialA place to stayA very wide roadSaturday to SundayThe opposite of oldLike "fork", with a whyThe first month of the yearA place where things are madeThe opposite of black and whiteThe number between Five and SevenSaving the Manor, or Nailed It, or similar

Comedy Subgenres 2024-03-19

11 Items: A comedy which is expressed through the medium of song and dance.Those comedies which spin a lighter view on morbid matters of society.Comedies that break up the tension of drama with different speech or physical based bits.A combination of Romantic and Slapstick comedies, these comedies started to emerge around the 1930s....

EARTHQUAKE AND FAULTS 2017-08-14

14 Items: OFRINGFIREEARTHSPACEFAULTSCALEPACIFICTSUNAMIRICHTEREPICENTERMAGNITUDEINTENSITYEARTHQUAKES

TRICKY WORDS 2023-09-17

14 Items: ofistoonearetwowassaidsayswerehavesomeoncefrom

Heart Word Review - Schwa!! 2024-03-27

14 Items: aofonewasthefromcomesomenonewhatotheraboutnothinganother

Samuel's Instant Words 2025-04-02

14 Items: oftoinisitheontheandyouwasforarethat

Psalm 119:160 (Micah) 2025-05-14

16 Items: ofisofThesumandoneYourwordyourtrutheveryrulesenduresforeverrighteous

Chapter 25 Vocabulary 2025-01-28

15 Items: native to a regionnot mapped; unknownto take advantage ofthe established customs of a peoplea property of land usually with a large housethe extension of a nation’s power over other landsa governor who ruled as a representative of a monarchto send a product or service for sale to another country...

No Credible Threat 2025-07-03

35 Items: Who manages a spy?What is a secret code?What is a false identity?Who is an infiltrated spy?What did they squeeze past?What were cameras compared to?What aura did Ron Evans exude?What is short for intelligence?What is a captured communication?What is an origin of information?Who hurried alongside the lawyers?What is a pre-mission instruction?...

Political Cartoon 2024-02-12

40 Items: biasfactnewsclueclaimethoshumorironylogosmediatopictitlepathosrightsbubblesymbolbubbleanalogycaptioncartoonopinionof viewcartoonanalysisevaluatelabelingliteracybandwagonrelevancerepudiatesymbolismpersuasivepropagandastereotypeadvertisingcredibilityperspectivestereotypesexaggerationof the press

Nursing Shortage Word Search 2024-03-27

28 Items: carerolesnursessafetymakingvaluesof carestaffingshortagepoliciesworkforceretentionhealthcaremanagementleadershipengagementregulationenvironmentobligationsof practicedevelopmentsatisfactioncommunicationcollaborationreimbursementin healthcareresponsibilitiesnurselicensurecompact

CHAPTER 6 WORD SEARCH 2024-10-10

36 Items: ArmyLockeKeplerNewtonMethodRightsReasonGalileoGravityLibertyConcordVoltaireRousseauContractFranklinPatriotsTelescopeof PowersJeffersonTea PartyLexingtonLoyalistsRevolutionCopernicusGeocentricHypothesisRevolutionWashingtonMontesquieuPhilosophesHeliocentricConstitutionEnlightenmentEnlightenmentExperimentationof Independence

Moses Word Search 2025-05-29

39 Items: GogoGodCryRestMeetWorkIdleTaskTaleMosesAaronEgyptStrawServeSmiteBlameFeastHebrewBricksMortarBurdenPharaohBurdensCommandDeliverOppressMultiplyReproachSacrificeSacrificeWildernessOppressionTaskmastersDeliveranceentreatmentSabbath/restIdle/idlenessof the children of Israel

Cells 2025-08-01

23 Items: Makes ribosomesThe powerhouse of the cellThe control center of the cellOrganism that makes its own foodGuides proteins to the Golgi BodyUsing the sun's energy to make foodOrganism that cannot make its own foodControls what goes in and out of nucleusDiffusion of water across cell membranesWhere photosynthesis takes place, is green...

English IH Vocabulary Unit 1 2024-01-11

15 Items: reluctanceouter; marginalfond of arguingsneaky; secretivedestroy completelyextremely poisonousnot fitting; absurdflattery; admirationoverabundance; excessable to see differencesself-satisfaction; smugnesssoak through thoroughly; drenchindifference; casual lack of concernworn through till the threads show; shabby...

story 18 2014-02-11

20 Items: ofsetsitoffwinourarewhenthanthenlosewerequitloosewe'rewherequietquitewhosewho's

Poetry  2019-04-15

20 Items: ofthefreemoodpoemverserhymestanzarhythmsimilelyricalspeakerlanguagemetaphorhyperbolerepetitionfigurativealliterationonomatopoeiapersonification

Week of 3/18 2019-03-22

20 Items: ofdayappsheatfirstsmarthomesvoicespringwarmeroutdoorcontrolcoolinginternetactivatedactivitiesconnectionsmartphoneappliancestemperature

My Dod Ned 2023-11-12

20 Items: iofmyhenobennedhasbadyaprubwagvettheputlicksaidyoursniffcrash

Faithful God - Chelsea Stanley 2023-12-09

22 Items: beofheheisyoucangodyouhisandsurethislovesneveralonebreaksalwayshappenswhateverpromisesfaithful

Heart Words 2025-01-31

20 Items: bymyofgowhofortheywerewanttalkwalkyourgoeshavetherewheretheircouldwouldshould

Snap Words 2025-02-05

20 Items: ofareanysawwasbestbackthenthatwhenwhatmoretheysaidyourneverthinktherewherelittle

Matteo 2025-02-27

20 Items: ofwhohasareawaysayssomeherewithhavecomesaidfromdosehelpwhatgoodthiswherewe’re

Xtreme Xplorers 4th quarter Bonus verse Ephesians 6:13a 2025-04-07

23 Items: SoOnOfSoOfBeToPutTheGodTheDayYouMayFullWhenEvilAbleYourArmorComesStandGround

science 2014-03-04

19 Items: ofdnagenepooltheoryclonesinheritnaturalhabitatspeciesadaptiontaxonomymutationselectionevolutionevolutionoffspringspeciationcompetition

Earthquake 2016-03-04

19 Items: ofCellRingfireCoreCoreCrustInnerOuterPangeaMantleVolcanoOceanicDivergentTransformConvectionConvergentEarthquakeContinental

buildings  2016-11-28

20 Items: ofbigbentallpisasmalltowerpainttowertowerschooleiffelpalacebricksmuseumstatueLondonleaningbuildingbuckingham

We Word Search 2022-12-19

19 Items: weofthetheformunionpeopleunitedstatesordainjusticedefensewelfarelibertyblessingsposterityestablishtranquilityconstitution

SIGHT WORDS 2025-04-01

18 Items: DOGONOOFONAREBADFORHADHASOFFSEEDOESDOWNGOODHAVEHERESAID

Types of Technology 2023-08-01

8 Items: A type of technology that includes video assistant referees and flying drones?A type of technology that finds its applications in space flight and airplane design?A type of technology used by farmers who handle large scale production and management.A type of technology that encompasses digital marketing, data management and E-commerce?...

Senses Psychology 2025-03-27

13 Items: signalsConverts stimulus into neural messagesSpecialized neurons that are activated byone teaspoon of sugar in 2 gallons of waterThe minimum noticeable change in a stimulus.JND is proportional to strength of the stimulusthe tick of a watch 20 feet away in a silent rooma candle flame from 30 miles away on a clear night...

Early Republic 2025-02-18

11 Items: PartyDebateConvention-Republicansof ConfederationA system of governmentA group of advisors to the President.The official way to confirm somethingA ceremony to mark the beginning of a new presidentchange or addition to a legal or statutory documentearlier event or action that is regarded as an example or guide

Vocabulary Word Search 2024-07-26

25 Items: The type of storyThe main characterSomeone in the storyWhere a story takes placeWhy the author wrote the storyThe ending of a story or resolveThe point of the story or main ideaThe point of the story or main ideaThe perspective the story is written inWhat happens in the story or the summaryThe reader, watcher or listener of a story...

Northern Renaissance and Protestant Reformation 2024-10-29

37 Items: Inventor of the printing pressSimpler Anglican worship styleChurch split with multiple popesPeriod of papal residence in AvignonProtestant church governed by eldersPope who excommunicated Martin LutherBelief contradicting Church teachingsBuying and selling of Church positionsEveryday language spoken by the people...

osteichthyes 2025-04-30

23 Items: anemones.activities.fertilization.class of fish characterized by bony skeletons.Fish that migrate from freshwater to the ocean to spawn.Organs used by bony fish for extracting oxygen from water.An air-filled sac in many bony fish that helps control buoyancy.The tail fin, the main source of propulsion for forward movement....

INDUSTRIAL REVOLUTION WORD SEARCH 2016-01-07

14 Items: OFLABORUNIONSSPHEREMONROESOCIALDOCTRINEINFLUENCECOMMUNISMSOCIALISMDARWINISMINDUSTRIALREVOLUTIONCAPITALISM

list 6 2024-01-28

14 Items: ofyoudollbellwellwillpuffcuffblesscrosssniffstuffhendrickhanewich

Caesar 2024-12-06

14 Items: OfDieTheButManyOnceTimesTheirNeverTasteBeforeDeathsCowardsValiant

19th Century History 2023-03-14

18 Items: to legally voidthe right to votethe idea of withdrawing,system of underground routesexpansion of the united states in size.an individual who wanted to end slaverynative americans forced from their landsemployment based on friendship and loyaltythe way of getting territory through living or by force...

Preeclampsia-May 1 Name: ________________________ 2025-05-06

15 Items: Severe headache may signal worsening preeclampsia.Ongoing assessment of blood pressure, urine, and symptoms.Includes preterm birth, maternal stroke, and fetal distress.Swelling in the hands, face, or feet caused by fluid retention.Presence of protein in the urine, indicating kidney involvement....

Biotic/Abiotic Factors and Levels of Organization 2023-04-16

8 Items: The smallest unit of living thingsThe parts of Earth where life existsThese are non-living things in an ecosystemThese are living or once-living things in an ecosystemAll of the populations of different species in an areaAny living thing that eats, grows, makes waste, and diesA group of organisms of the same species in the same area...

Diencephalon 2023-11-29

9 Items: What does the diencephalon release?What happens when the diencephalon is damaged?Where the diencephalon is located within the brain.What segment of the diencephalon produces hormones?What segment of the diencephalon produces melatonin?What ventricle of the brain contains the diencephalon?The diencephalon is superior to what part of the brain?...

Paulina & Matias 2024-09-27

25 Items: The Couple's SongKendrick vs. DrakeThe Bride's first jobThe Groom's first jobThe Bride's birthday monthThe Name of the Groom's barThe Bride's favourite movieThe Groom's favourite hobbyThe Name of the couple's catWhere the couple got engagedThe Couple's first date spotThe name of the wedding venueHow did the couple first meet?...

Maria Word Search 2025-04-24

28 Items: brides middle namegrooms middle namefirst date locationgrooms birthday monthbrides birthday monthbrides favorite storegrooms favorite sporthoneymoon destinationbride favorite tv showgrooms favorite dessertbrides favorite holidaygrooms favorite holidaymonth couple got engageddating anniversary monthnumber of grooms siblingsnumber of brides siblings...

CDs and Money Markets Savings Accounts 2025-07-01

20 Items: Length of time a CD lastsCD ______ can change at anytimeCD stands for ______ of depositNothing _____ people more than peopleNew money to DuTrac = money market ______A money market is a type of ______ accountHow often is money market interest compoundedFrequency in which dividends are posted to a CD...

emilys word search 2022-11-28

10 Items: lowest part of transverse wavewavelength is measured in metershighest part of a transverse wavemeasurement of maximum displacementdistance of one complete wave cyclemaximum displacement in a longitudinal wavemaximum displacement in a longitudinal wavemoves the medium parallel to the wave motionmoves the medium perpendicular to the wave motion...

David's Cool Waves Word Search 2022-11-28

10 Items: lowest point on a wavehighest point on a wavearea of maximum displacementarea of maximum displacementmeasurement of maximum displacementis the measurement of the frequencywave moves in medium parallel wave motionis the distance of one complete wave cyclewave that moves the medium perpendicular wave motion...

David's Cool Waves Word Search 2022-11-28

10 Items: lowest point on a wavehighest point on a wavethe measurement of the frequencymeasurement of maximum displacementthe distance of one complete wave cyclewave moves in medium parallel wave motionarea of maximum displacement in a longitudinal wave.area of maximum displacement in a longitudinal wave.wave that moves the medium perpendicular wave motion...

Democracy & Mexico's Government 2024-10-01

9 Items: govlasts six yearsdebates and makes lawsare composed of judgesit's composed of deputies and senatorsapplies and makes sure laws are followedform of government that depends on the will of the peopleone _________ is to preserve and promote the dignity of the individualMexico's government _________ are the Presidency, the Congress, and the Courts

Bullying IS... 2017-03-02

20 Items: OfOrBeToItIsYouFunForMayMayNotMakeTheyAbleAnytimeSomeoneControlPatheticSomething

Narrative Word Search 2019-05-31

20 Items: ofplotviewtimepointthemeclimaxactionrisingactionperiodfallingsettingconflictelementsnarrativecharacterexpositionresolutioncharacterization

2020 LD PR 1&2 2020-09-09

19 Items: ofBedRugTopBunkDoorFlexNailChairChestCoverFrameTableBottomDrawerdrawersCushionFootboardHeadboard

serije i filmovi 2022-03-18

20 Items: dofusonmy13allareallgamdeadtallgirlthatblockshe'ssquiefridaydinastyeuphoria

chicago word search 2023-05-10

19 Items: ofandbeancubscoldcitybearshotdogmuseumchicagomidwestsciencewhitesoxillinoisindustrywindycitysearstowerlakemichiganmccormickplace

God IS With Us 2024-12-05

19 Items: ofGodMaryLukeMarkJohnsavesinspeaceJesusmightyprinceangelsJosephpeopleMatthewImmanuelwonderfulcounselor

The Word Search 2025-03-21

19 Items: HeAtOnItInIsAsToOfTheAndSheForAreWasYouHisThatWith

Chapter 4: Payments 2023-10-03

19 Items: Money in the form of bills or coins; money on hand or in the bankA restriction on the payment of all or any part of the balance in an account.___________ is the process of removing the physical paper check from the processing flow.A check deposited or otherwise negotiated at the bank on which it is drawn is an __-__ check....

And another on for Sherlock: Engineering Edition and some other questions 2025-05-06

18 Items: A citrus FruitAnother citrusCapital of TurkeyHello/Goodbye in ItalianLargest Country in AfricaCan Bob The Builder fix itThe name of Captain Holts dog in B99When viewing the composition of petroleum by weight, what chemical makes up the majority?...

Examples of Euphenisms 2024-05-04

5 Items: instead of died...instead of lied...instead of rich...instead of fired...instead of short...

civil rights terms 2023-01-15

15 Items: The right to vote in political elections.A written ordinance of Congress, or another legislative body; a statute.The systematic separation of people into racial or other ethnic groups in daily life.This Amendment abolished slavery and involuntary servitude, except as punishment for a crime....

Traditional Word Search 2024-11-21

17 Items: (0,0)number.overlaps.Parts per 100. The symbol is %the distance around the circle.get the values for the other quantity.How many parts of a whole; numerator over denominator.A radius is a line segment that goes from the center to the edge of a circle.A group of rectangles put together to represent a relationship between quantities....

Nervous System 2025-03-14

17 Items: Specialized cells that transmit nerve impulses.Nervous System (CNS) Comprises the brain and spinal cord.Nerves Nerves that carry commands from the brain to muscles.The part of the brain that coordinates movement and balance.The junction between two neurons where signals are transmitted....

Hair Structure, Functions & Types 2023-04-24

15 Items: The coat aids with...Hair growth occurs in cycle.What type of hair is the coat?What is below the skin surface?What condition causes hair loss?What part is above the skin surface?What is the middle level of the hair?What decides the pigment of the coat?What is the deepest layer of the hair?What hair is found nostrils and trachea?...

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Exoskeleton Word Search 2025-03-19

26 Items: an outer skeletonAn inner skeletonAttach bones to muscleAttach a bone to a bonelose of bone tissue in elderlyA bone that protects your brainside to side curve in the spineMuscles pull on bones to cause thisThese pull on bones to move your bodyOne percent of these are found in bonesFunction of a skeleton to ___ from danger...

History Chapter 14 Word Search Puzzle 2024-03-23

11 Items: the right to votethe use of little or no alcoholic drinkthe teaching of male and female students togethera person who strongly favors doing away with slaverya two-year school for training high school graduates as teachersa community based on a vision of a perfect society sought by reformers...