4th of july Word Searches

Happy Birthday, Michael!! 2025-08-02

14 Items: FunMexicoEnsenadaAdultsonlyto the leftto the righta great leapgroup of twomonth of loveseven of themmost of Earthbackwards loopdrive with easebefore an audience

modern history 2023-07-17

20 Items: 1918 CE: The end of _____ _____ _.1904 CE: The Russo- _____ War begins.1933 CE: Adolf Hitler became the Chancellor of _____.1925 CE: Benito _____ gains dictatorial powers in Italy.1925 CE: Hitler's autobiography, ____ _____ is published.1928 CE: _____ _____ was created at the Walt Disney Studio....

8th Science 1st Semester 2026-01-05

27 Items: Basic unit of matterhow compact an object isNeutral charged subatomic particlealso called the gravitational forcea process of making food for plantsPositively charged subatomic particleNegatively charged subatomic particlethe amount of space an object occupiesdescribes what happens in a phenomenonsubstances that have pH scale of 0 to 6...

Vocabulary Vines Word Search 63-66 2024-09-20

12 Items: of a shiplike a startoward a shipthe wrong namethe act of namingwritten with lighta particle of lightsailor of the starsnaming of the starssailor of the universeput together with lightdistribution in the environment

Channel Islands Word Hunt 2026-05-07

20 Items: Nocturnal animalon Santa Cruz Islandhome to point Bennetholds the twin peaksmechanism of evolutionhome to the painted caveContains Torrey pine treesorganisms that create foodconsisting of volcanic flowscomposed of the Earth's crustmost common rock on the islandfundamental geological processcontains the 40-foot-tall arch...

Unit 4 Review 2026-02-04

13 Items: Branch that makes the lawsBranch that enforces the lawsDate in February of your quiz________________ of ConfederationLaw or change to the ConstitutionState with the most electoral votesThis document is the law of the landBeginning paragraph of the ConstitutionTakes over if the president dies/resignsTotal # of amendments in the Constitution...

Individuals Word Search 2026-02-24

15 Items: Which method uses propaganda?What color represents communism?What is the symbol of communism?What is one advantage of communism?What is one advantage of capitalism?What drives innovation in capitalism?What is one disadvantage of communism?system aims to eliminate class divide?What is one disadvantage of capitalism?...

Nursing Shortage 2026-04-11

15 Items: A lack of staff nursesNursing leadership teamNurse-to-patient ______Known for their code of ethicsLevel of care needed for a patientTerm for keeping nurses in their jobsThe desired degree for registered nursesThe rate of deaths per x number of patientsWorking beyond the regular full time scheduleThe amount of money that a nurse makes a year...

Yom Kippur 5.0 2024-10-06

20 Items: “Rest” Hebrew“Soul” Hebrew“holy” Hebrew“peace” HebrewA trumpet blast“Passover”Hebrew“Oil Press” Hebrewa rams horn, HebrewThe Day of Atonement“appointed time” HebrewUnleavened Bread, Hebrewa unit of measure, Hebrewof or related to the moon.“make an appointment” Hebrewliterally, Head of the Year”“statute” or “ordinance” Hebrew...

Heart Ridge Word Search (get 10 of 30 to proceed...) 2025-06-23

30 Items: BirdCodeCareDevotionKateri...Theotokos50 Psalms... Ricky... MartinSon of GodHippy internLodging hereYou are hereI love my...Current PopeBigfoot's nameDown by the...Bigfoot speciesMost recent PopeFalling with styleSong about clothingLily of the MohawksFoster father of JesusWiped the face of ChristI've got... like a riverMost recent Papal Encyclical...

BIOLOGY 2025-10-31

20 Items: SA and AVPhagocytosisRelaxation of heartValves of left sideProduces antibodiesContraction of heartValves of right sideSmallest blood vesselsLargest artery in the bodyCarries oxygen and carbon dioxideThinner-walled chambers of the heartThicker-walled chambers of the heartWhen blood goes from atria to ventricle...

Year 9 English 2024-07-05

35 Items: The ____ Plot 1605______ kills Duncan'half-formed ______''Be the ____ under't'Tennyson was Poet _______Genre of Macbeth: ________'I carving out me _______'Who kills Macbeth? ___________A commanding verb is an ______Poem by Carole Rumes 'The ____'Post __________ Stress Disorder'Straight I unloosed her ______'Playwright of 'Macbeth': _________...

POM-States of Matter Challenge 2024-08-02

20 Items: stored energyenergy of motionthe ability to do workanything that has mass and volumethe amount of matter in somethingthe device that measures temperaturethe amount of space something takes upthe process in which a liquid turns into a gasthe process in which a gas turns into a liquidstate of matter whose particles slide past each other...

Hyperlightslice Word Search 2026-05-09

47 Items: One big bugHeroic starshipGrumpy ExecutiveReally big doughShady corporationStowaway engineerGaseous quik-stopSweet Mushcat twinPlanet of hogglersStarship infestorsStinky mushcat twinColossal sun-seekersPizza-loving vagabondCommunications expertSpace station squaredWand-weilding wandererMobile starship repairMischievous star-farers...

Spring Fling Trivia Word Search 2026-03-30

24 Items: Man's best friend (3)The largest ocean on Earth (7)A shark has this many bones (4)The number of feet in a yard (5)The first animal to be cloned (5)A fermented Korean cabbage dish (6)1994 Disney movie, "The ___ King" (4)The longest bone in the human body (5)The country where coffee originated (8)Commonly known as a fear of spiders (13)...

Ch. 4 Medterm Vocab Signs, Symptoms, Diseases, Disorders 2025-04-10

50 Items: scaringrown naila torn or jagged woundabnormally smooth skinfibrous tumor of the skina pinpoint skin hemorrhagean overgrowth of scar tissuea symptom of intense itchingabnormal redness of the skinskin wound caused by scrapinginflammation of a sweat glandtissue related death of cellsabnormally light colored skina discolored flat spot, freckle...

CALENDRIER 2022-07-13

8 Items: JULYMARCHAPRILMONDAYSPRINGJANUARYDECEMBERTHURSDAY

Adam and Eve 2022-07-18

15 Items: evegodmanadamgoodevillovefruitangelwomandeathserpentof Lifeof Edenfreewill

Giant Summer Word Search 2024-03-27

35 Items: bagiceballbeesjulyjunebeachfruitgrasshumidaugustbikingcruisedivinggardenboatingcampingfishingflowersfrisbeehammockholidaybarbecuebaseballcanoeingcharcoalkickballbadmintondandelionfirefliesfireworkshopscotchbasketballhamburgersbutterflies

Days and Months 2025-05-20

35 Items: MaymaiJuneJulyreedeMarchmärtsApriljuunijuuliMondayFridaySundayaprillAugustTuesdaylaupäevJanuaryjaanuarOctoberThursdaySaturdaypühapäevFebruaryveebruaroktooberNovemberDecemberesmaspäevteisipäevWednesdaykolmapäevneljapäevSeptemberdetsember

bridal shower 2026-04-06

35 Items: VEILVOWSCAKELOVEJULYNICKBRIDEGROOMVENUEMUSICUSHERUNITEPHOTOSSHOWERTUXEDOFAMILYREADERFLOWERSDANCINGFRIENDSWEDDINGCEREMONYANAMARIEHONEYMOONGROOMSMENRECEPTIONBRIDESMAIDCOMMITMENTFIRSTDANCEATTENDANTSCELEBRATIONBRIDALPARTYWEDDINGDRESSVIDEOGRAPHERCOCKTAILHOUR

Unit 1: Forces & Motion Word Search! 2025-12-01

22 Items: A quantity or aggregate of matter usually of considerable size.Acts between objects at rest, preventing them from starting to move.Is a net force acting on an object that changes its state of motion.The force that resists relative motion between two bodies in contact.Is a force that is opposed by an equal force in the opposite direction....

Beshelach 5.0 2025-02-02

16 Items: “Yam Suf”“mitzvot”The Seventh DayWho saved Israel?“Bread from heaven”The meaning of “Beshelach”The place of extreme hunger.The place of the bitter waters.The seabed for the children of Israel.at this stop there was no water supplyThis stop was at the edge of the wilderness.The place of the 12 springs and 70 palm trees...

Revision time 2023-08-29

17 Items: to shoutsynonym of tombsynonym of expelopposite of strongcloth used at the top of a bedname of the poems main charactera very scary or frightening dreama bird of prey that eats dead animalssocially correct and with good manners.ugly and unpleasant.Similiar to ghoulishkind, helpful and caring for other people...

CCES Wisers Extended: Word Search 2023-02-22

15 Items: ilayaparademinifairfielddemoboardgamesartcontestthewitnesssportsgamesName of your schooltheme for this yeargroup _____ of Todaygroup ____ of Tomorrowgroup _____ of Yesterdaybeing celebrated right nowWhat you call the students who goes to your school

Unit 2 Vocabulary 2025-11-13

18 Items: ATPwateratomsleavesoxygenstomatadioxideglucosesunlightsubscriptmoleculesrespirationcoefficientchloroplastchlorophyllmitochondriaphotosynthesisof conservation of matter

Random Words Game (July 2022) 2022-07-05

13 Items: okrbipoequityqualitybrownbagintegrityinnovationefficiencydatacentriccornerstoneatomeesbuzzpeoplecentriccustomercentric

Quest 2 2022-10-15

12 Items: The Ancient of Knowledge.Home to the Vermilion elves.A young keeper, blind at birth.Known as the "Jewel of the South."The main antagonist of the Warminster Series.The animal species the Faircloth family breeds.Incanus Dru'Waith is a ____ elf and an assassin.Erud's magical tome is called The Tome of ________....

Unit 13 Vocabulary Word Search 2023-03-29

20 Items: To charmDull, boringGive care forTo set on fireNoisy confusionExtremely funnyLarge and heavyWell thought ofTo humble oneselfWork done by handOf or like a motherTo lose interest inTo change continuallyTo make or become smallerTo love and respect dearlyA narrative of heroic exploitsTo say suddenly or without thinking...

The Birth of Christ 2025-09-24

22 Items: Gift #1Gift #2Gift #3ProphetessUpper roomThe “Great”God with UsSong of MaryOne who savesThe messengersNo room in the…Led the wisemenCame from the eastMary laid him in a…She wrapped him in…Earthly father of JesusEarthly mother of JesusTown of Jesus’ childhoodTown where Jesus was bornFirst visitors of baby JesusBrought Mary and Joseph to Bethlehem...

​🇨​​🇦​​🇷​​🇸​​🇴​​🇳​ ​🇼​​🇴​​🇷​​🇩​ ​🇸​​🇪​​🇦​​🇷​​🇨​​🇭​ 2024-05-16

15 Items: What humans BreatheThe end of A long boneAre ocean currents related to windHow Carbon moves out of the atmosphereThe process were liquid turns into gasZone of the ocean that has a lot of sunlightA flexible material found on the ends of bonesThe less muscular of the two types of blood vesselsThe more muscular of the two types of blood vessels...

Let's play! 2024-10-08

35 Items: mayonesixtentwofivefourjulyjunenineaprileightmarchseventhreeaugustautumnelevenfridaymondayspringsummersundaytwelvewinterjanuaryoctobertuesdaydecemberfebruarynovembersaturdaythursdayseptemberwednesday

Presidents: James Madison - Word Search 2024-10-10

35 Items: WarJulyMindAltarTermsDesignEstateLawyerUnitedCollegeFreedomLibertyTyrannyWilliamAmericanCongressGovernorMovementPurchaseShadwellVirginiaWritingsEducationJeffersonLouisianaPoliticalPresidentSecretaryMonticelloPlantationUniversityDeclarationIndependenceRevolutionaryCorrespondence

Word Search 2,423,762 2026-05-12

35 Items: helpfindneckfootnoseoverintojulyawaywhenwantthinkcouldaftergreenbootsmouththoseabovescarfanklewherebreadtheselittlejacketseventysweaterbetweenoutsidequarterstomachaddressshoulderclassroom

LAST DAY OF SCHOOL 2024-05-30

35 Items: - A member of the SenateThe leader of a state governmentThe part of government that makes lawsThe leader of a city or town governmentThe process of choosing leaders by votingA change or addition to a constitution or lawDuties or things that people are expected to do- The process of running for a political office...

. 2025-01-29

13 Items: MayJulyJuneMarchAprilMondayFridaySundayTuesdayJanuaryThursdaySaturdayWednesday

Spanish 2025-01-29

13 Items: MayJulyAprilmarchMondayFridaySundayAugustTuesdayJanuaryThursdaySaturdayWednesday

Mr Richie 4th Grade 2020-12-08

16 Items: redevabluelimejoseissacpurpleyellowjaydenamonguscrewmateimpostorvictoriajonathanmrrichiealexandra

Room 217 is The Best 2022-08-29

28 Items: samavaremyliamandyjackmateohazeljacobcarsonannikaoliviadominozephyrsawyeradriancedricpolinacharlierussellamolikacarolineannamikabrooklyncharlotteThe name of our schoolThe name of your teacherThe name of Principal Malone's pug

Energy Word Search 2025-10-30

20 Items: What allows us to see. (5)The smallest unit of life. (4)A push or a pull on an object. (5)What makes things warm or hot. (4)The control centre of the cell. (7)An object that attracts some metals. (6)A group of cells that work together. (6)The pull that keeps us on the ground. (7)A state of matter with a fixed shape. (5)...

Ancient Greece 2025-05-06

28 Items: God of the SeaKing of the godsGoddess of the HuntGod of the UnderworldHe had the golden touchGod of the sun and musicGoddess of Beauty and LoveShe opened the mythical boxEpic poem about the Trojan WarKnown as the "Father of Medicine"Goddess of wisdom and war strategyCity-State that developed DemocracySparta was considered this government...

U6 Vocab 2023-11-09

36 Items: A seasonal wind.the coldest climateThe climate of a small area3rd layer of the atmosphereWinds that blow from west to eastThe lowest layer of Earth's atmosphereA thin layer of gases surrounding Earthwhen a cold front overtakes a warm frontThe outermost layer of Earth's atmosphere.A person who studies the different climates....

Biology Chapter 11 Vocabulary Word Search 2024-03-19

25 Items: formation of a new speciesthe variety of alleles in a populationthe changes in a population's genetic structurethe effect of chance on a population's gene poola speciation that occurs via a geographic separationa speciation that occurs in the same geographic spacean evolution that results in similar forms on different species...

Polish Verb Wiedzieć 2025-11-04

24 Items: the form of "wiedzieć" in past tense for "on" (he) meaning "he knew (facts)"the form of "wiedzieć" in present tense for "ja" (I) meaning "I know (facts)"the form of "wiedzieć" in present tense for "my" (we) meaning "we know (facts)"the form of "wiedzieć" in past tense for "ona" (she) meaning "she knew (facts)"...

doesn’t matter 2025-01-29

13 Items: MayJulyAgustMondayFridaySundayTuesdayOctoberThursdaySaturdayDecemberWednesdaySeptember

Famous Landmarks Around the World 2024-12-18

20 Items: BenFujiSignItzaTowerMahalPicchuCanyonCastleEverestFamiliaof GizaAlhambraColosseumStonehengeOpera HouseGate Bridgethe RedeemerWall of Chinaof Versailles

Colors 4th Grade 2025-11-03

11 Items: redbluegoldgreenwhiteblackbrownyelloworangepurplesilver

Mitosis 2023-02-21

17 Items: The life of a cell.Two Identical Cells.The last phase of mitosis.The second stage of meiosisThe first stage in cell division.An organism of one or more cells.The process by which a cell divides.Division of the cytoplasm of a cell.To repeat or copy (something) exactly.The process in reproduction and growth cells....

Aiden 7th grade 2024-05-16

15 Items: the driest of all the biomesthe biological variation that occurs within speciesa ridge of rock in the sea formed by the growth and deposit of coral.the variety of different habitats, communities and ecological processesthe variety of life in the world or in a particular habitat or ecosystem....

Slappy Word Search 2024-07-22

20 Items: NightZombiesBeware!of a Dummyof the Jack!in DreamlandFriend SlappyBlood Is Backand the Beastwith the StarsBirthday to YouGhost of Slappyof the SquawkerAlive! It's Alive!from Shudder Mansionof the Invisible BoyAm Slappy's Evil TwinDo Not Feed the WeirdoDummy Meets the Mummy!Call Me the Night Howler!

CVA Review Game 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Breed Word Search 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

8th Grade Forces and Energy Chapter 4 Hints 2024-01-04

13 Items: scientific ruleenergy of electric chargesability to do work or cause changeenergy of stretched or compressed objectsenergy that an object has due to its motionpotential energy stored in the nucleus of an atompotential energy that depends on the height of an objectform of potential energy that is stored in chemical bonds between atoms...

vocab definitions 2026-01-05

20 Items: To removeTo supportA remainder ofLying face downIndifferent boredTo trouble, hauntFull of tiny holesTo support, nourishTo reduce to nothingOf little importanceA pang of conscienceElaborately decoratedSerious and dignifiedShowing concern or careTo feel or express regretA person of no importanceTo read thoroughly and carefully...

Renal Function 2025-12-02

18 Items: Loop of __________elevated blood ureaprimary protein nitrogenincreases RBC productionprimary extracellular cationfunctional unit of the kidneydecreased profusion of kidneysconverted to urea in the livertubular absorptions and ______high levels of lipids in the blooddirectly proportional to muscle massbuild up of uric acid crystals in joints...

De maanden van het jaar 2022-12-11

12 Items: MayJuneJulyMarchAprilAugustJanuaryOctoberFebruaryNovemberDecemberSeptember

Months 2024-03-12

12 Items: maimärtsjuunijuuliaprillaugustjaanuarveebruaroktoobernovemberseptemberdetsember

CHOSEN AND CALLED: REFINED BY HIS FIRE 2026-05-20

22 Items: (v. 7) – A result of proven faith.(v. 9) – The end result of our faith.(v. 10) – The "material" of the furnace.(v. 3) – Our expectation is a "living" one.(Isaiah 48 v. 10) – Purified by the Creator.(v. 7) – What the fire proves about our walk.(v. 2) – How we were chosen according to God.(v. 18) – The measure of God's provided peace....

Chapter 3, Part 1: Applied Terminology for Blood, Lymphatics, and Immunity 2026-03-30

50 Items: A RED CELLA THORN CELLSELF ANTIBODYFIBER PRODUCERA GRANULE CELLSTUDY OF BLOODRED LOVING/LOVERTHE RED PRODUCERPROCESS OF GLUINGANTIBODY PRODUCERAGAINST HISTAMINEBLUE LOVING/LOVERAN ALLERGY PRODUCERPROCESS OF CLOTTINGA CONDITION OF "BILE"A DISEASE OF CLOTTINGPERTAINING TO REDNESSACT OF BREAKING BLOODPERTAINING TO THE NECKPERTAINING TO SWELLING...

4th Spelling Practice 2024-04-11

11 Items: hurtswordsshirtmurkyworstmarketcarpetshorterburningperhapsherding

4th grade colours 2026-04-27

11 Items: REDBLUEPINKGRAYGREENBROWNBLACKWHITEYELLOWORANGEPURPLE

౿𝗊υɑ𝗍ꪱᜒ𝗈𐓣 𝗏𝗈ɕɑᑲ 2025-10-08

18 Items: .terminversevariableconstantoppositeequationconstancycoefficientof a specified kindto variation or changesorder, nature, or effectnumber that is not a fraction; a whole number.any real number that cannot be expressed as a simple fractionof the factors of a product considered in relation to a specific factor...

Chapter 3 2025-02-10

15 Items: fallforceforcefieldforceweightgravityinertiafrictionvelocityresistance1st law of motion2nd law of motion3rd law of motionof conservation of momentum

Light Waves - Amplify 2025-12-15

18 Items: to take into give offto pass througha range of wavelengthsan object that emits lightthe maximum height of a waveto bounce off without absorbinghow often or fast something happensto form a mental picture of somethingthe ability to make things move or changeanything that has mass and takes up spacea type of invisible light that is beyond violet...

Photo 1 - Semester 1 2025-12-17

18 Items: A device to take photos.Different between light and dark.The ability to take close-up photos.The lightness or darkness of a colorHow the elements in a photo are arrangedUsing reflective surfaces to mirror an image.The images displayed together as one artwork.How much of the image is in focus from front to back....

Module 6 Week 2 -Nature's Wonders 2024-02-15

12 Items: to sendstate ofhas no endthe centerstrong angervery interestingnot doing anythingmade up of living mattercan't understand somethingmade up of things that are differentact of, state of, result of an actionwhen moving objects crash intro each other

2026-06-21: Loving When It Hurts 2026-06-21

18 Items: First point: Love ___Second point: Love ___Point 2(i): Forgiveness ___The role our ushers don't playPoint 2(ii): Unforgiveness ___Point 2(iii): Unforgiveness ___What many fathers struggle to sayThe first component of 'Hard Work'The second component of 'Hard Work'The second component of 'Heart Work'The first component of 'Heart Work' in application...

History & Wildlife Conservation 2024-01-17

27 Items: value to earn moneyfirst national parkfather of soil conservationpublished a book about birdssystem of safe wildlife areaspart of USDA to manage forestsvalue to enjoy wildlife's beautyfather of the conservation movementpopulation is close to becoming extinctthe use of natural resources for profitpopulation is close to being endangered...

Natural Resources 2024-03-10

25 Items: resources that occur naturallymixture of gases surrounding earth3 types of inexhaustible resourcesremains of decomposed plants & animals3 types of renewable natural resourcesnatural resources used to provide energycycle where water is continuously renewednatural inorganic substances on or in earth2 types of of nonrenewable natural resources...

CH 4 2025-10-09

21 Items: structural shape of dnasmaller simple moleculesmolecules that an enzyme reacts withthe hereditary material in organismstype of respiration that requires oxygenthe process of creating protein moleculesbreakdown larger molecules into smaller onesbuilds large molecules from smaller moleculesa substance that speeds up a chemical reaction...

Vocabulary unit 11 2025-05-19

18 Items: A mark indicating the quality of a student's work.The grounds and buildings of a university or college.A college or university student who's not a graduate student.A first-year student at a university, college, or high school.Based on or characterized by the methods and principles of science....

chapter 1 Physics 2025-08-31

18 Items: the action of measuring something.the quality or state of being correct or precise.the quality, condition, or fact of being exact and accurate.a science that deals with matter and energy and their interactionsdescribes how one variable changes in proportion to the square of another...

Cards 26-50 2025-02-03

13 Items: Who vetoes bills?Who is the Governor of Virginia?What is the capital of Virginia?In what month do we elect the president?How many years do we elect a president for?How many justices are on the Supreme Court?What is the highest court in the United States?What political party does the President represent?...

Chemistry, Physics, and Energy 2023-05-14

20 Items: measured in Newtonsmeasured in mL or cm^3they make up the periodic tablemetals are good examples of thesethe first step in the water cyclethe formula for it is mass/volumeplastics are good examples of thesethe formula for it is distance/timea phase change, the opposite of depositionthere are two types of it-positive and negative...

ELA Word Search 2024-01-08

26 Items: Time orderExtreme exaggerationThe problem of a storyPerson telling the storyGood guy or hero of a storyOpposition's claim/argumentTo restate in your own wordsSequence of events in a storyBad guy or villain of a storyA word with a similar meaningThe time and place of a storyConversation between charactersMain idea of a text (two words)...

6th Grade Final Review 2025-12-12

33 Items: stored energyball on a hillenergy in motionhow energy movesall living thingsstored in nucleusall water on earthcauses earthquakesheating of objectsability to do workspring or rubberbandcurrents in a circuitwaves, voice, speakercar, skateboard, walkingcauses seafloor spreadingpush or pull of an objectprocess of changing position...

Federalists 2022-11-29

23 Items: votemoneypowersenatestrongstatesof repslibertyslaveryfreedomtaxationcongresscoloniesjudiciaryexecutivepresidentof rightsagreementfederalistgovernmentconventionsconstitutionratification

DNA Word Search - Talin Smith 2025-02-21

20 Items: - The twisted-ladder shape of DNA.Characteristic of pyrimidines (t & c)- Structures in cells that contain DNA.- The sugar component of a DNA nucleotide.- Weak bonds that hold DNA bases together.- DNA consists of two complementary strands.Characteristic of purines (adenine & guanine).A nitrogen base in DNA that pairs with thymine....

Evaporation Word Search 2025-01-23

25 Items: How many maine plate tectonic locations are there?Which part of the water cyle does gas turn to liquid?What is the term for measuring the acidity of a liquid?What is the name of a tidal current that leaves the land?What is the process of converting liquid water into vapor water?plain What is the flat ocean floor that covers 50% of the ocean?...

Global II Review 2025-05-22

24 Items: "Gold, God, and Glory"Heroes in a half-shellLouis XIV's fancy house.Earth-centric solar systemSeafaring Scandinavian warriorsA region of religious significanceThe capital of the Byzantine Empire.The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever....

Meses del año 2022-12-10

12 Items: MayJuneJulyMarchAprilAugustJanuaryOctoberFebruaryNovemberDecemberSeptember

Los Meses 2024-02-28

12 Items: MayJuneJulyMarchAprilAugustJanuaryOctoberFebruaryNovemberDecemberSeptember

Monday Word Search 2025-01-29

12 Items: LunesEneroJunioJulioMartesJuevesSabadoViernesDomingoMiercolesDiciembreSeptiembre

Ecology 2025-01-24

26 Items: that has or once had all the characteristics of lifefactor-Any living factor in an organism’s environmentNumber of different species living in a specific areadiversity-The variety of genes within a given speciescommunity and all the nonliving factors that affect itdiversity-The variety of ecosystems within a given region...

Literary Terms 1 2025-12-08

19 Items: Creators of texts.rhyme Imperfect rhyme.Repetition of vowel sounds.Multiple possible meanings.rhyme Rhyme within a line.Intended readers or listeners.Harsh discordant sounds in text.Something out of its time period.Short story illustrating a point.techniques Methods to persuade.Words that imitate natural sounds....

ch 16 vocab 2025-04-10

14 Items: vertical column in the periodic table.number of protons in an atom's nucleus.particle in the nucleus with an electric charge of 1+.particle of matter that makes up protons and neutrons.atom of an element that has a specific number of neutrons.electrically neutral particle inside the nucleus of an atom....

4th Grade List #20 2023-01-05

16 Items: jacketfatherkingdompumpkindolphinfartherlobsterinspectathletewhetherinstantchildrencompletepurchasesandwichcomplain

Mrs. Zaborowski's 4th graders 2025-08-26

16 Items: LiamDeanLuisBrodyJamesAlisaOliveDevlinBrandyElodieMillieGraysenIsabellaIsabelleCharlotteChristopher

Ms. Luna's 4th Graders 2025-09-02

16 Items: LunaCoenAriaSarahJesseVivianMarcusEvelynJulianCharlieJocelynRaphaelSawyerHVincentSawyerKArielle

4th Grade learning journey 2026-06-22

16 Items: dynamicexcitingvaluableengagingrewardinginspiringmemorablemeaningfulfulfillingcontinuousmotivatingempoweringchallengingeducationalenlighteningunforgettable

Wonders of the world 2025-08-15

28 Items: ItzaPetraMahalTowerFallsPicchuCanyonmodernuniquefamousboringEverestof GizaancientcrowdedBorealisstunninghorribleColosseumbeautifulof Libertyimpressivemysteriousfascinatingthe RedeemerBarrier ReefbreathtakingWall of China

Mr. Gerald's Flurry's FOT 2025 Message I 2025-10-10

32 Items: lawjoyGodrockcrownpeaceZadoklightstonetruththronehastenof GodFlurryo fhopeAdullamcastoutloyaltyAmaziahnobilityhappinessAntiochusof safetyArmstronggovernmentcommissionrevelationpreparationkingpriestsof the Agespurificationrighteousness

Purcom Set 1 word puzzle 2022-12-15

25 Items: Full command in 2 languages.The most famous dead language."What are they talking about?"Sender gives a message to whom?Hearing things through language.Order is issued through language.The Latin word for "communication""meaning are in people, not words"Obstructs exchange of communication.Responses to the messages of the sender....

MRS. LUHRING'S 4TH GRADE 2025-08-21

16 Items: WILLCRUZJACKABELGRACEHEIDIAARONJOVEEHAYDENKAYLEEFINLEYHAYDENTIMOTHYGILBERTEMERSONLUHRING

4th Grade 2025-2026 2026-05-12

15 Items: samjakeoonamiloadamenzoelliebennyaaronnorahtessajeremylindenrylandamelia

US 4th NW review 2026-05-15

15 Items: 1896 gold rush in Alaska/Canada.Country the U.S. invaded after 9/11.Steve Jobs revolutionary 2007 device.SAY NO Nancy Reagan's anti-drug slogan.Ethnic background of Justice Sotomayor.Primary civic responsibility of a citizen.Process that made steel production efficient.First female Supreme Court Justice (Last Name)....

All things quality 2022-12-13

18 Items: a name of a QC xxxquality is a "xxxxx" not an actpeople representative for qualityquality can improve this "12 letters"a brand of chocolates "quality xxxxxx"one of Bede's values (POD - 6 letters)best place to work (company name "xxxx")a brand / manufacturer of quality cars (Swedish)quality can improve this with customers / clients...

Mrs. Zaborowski's 4th Graders 2025-08-26

16 Items: LiamDeanLuisBrodyJamesAlisaOliveDevlinBrandyElodieMillieGraysenIsabellaIsabelleCharlotteChristopher

Design principles of hair 2026-06-16

18 Items: Also known as CircleAlso known as MoldingEvaporate quickly and easilyThe curl sits completely on its basePosition and prominence of facial bonesThe area within or surrounding a hairdesignA combination of lines that outline a shapeThe aesthetic placement of shapes and linesAlso known as the Focal Point of a hairdesign...