4th of july Word Searches

World War 2 2024-03-25

16 Items: frankd-dayhitlerharborpattonaircraftcarriershirohitoof midwayrooseveltof berlinhohocausttechnologyd. rooseveltof world war 2internment camps

Famous Landmarks 2025-07-01

15 Items: BenFujiItzaTowerMahalPicchuCanyonKhalifaPyramidsRushmoreColosseumof LibertyOpera Housethe RedeemerWall of China

4th Grade 2020-08-26

5 Items: catdogbearliontiger

4th Amendment 2024-02-23

5 Items: Allowed colonial officials to conduct warrantless searches for untaxed items.Prevents the government from using evidence gathered in violation of the US Constitution.Reasonable grounds or evidence to believe that a crime has been committed or that a person has committed a crime....

Vocab word search 2024-04-26

12 Items: the part of your hand near your thumbA shocking moment, a great surprise of amazementlock of hair. A piece of hair hanging like a curlA fast movement of something or where you twitch.you achieve something a victory, you are successful.steadily into someone or something with a dead stare...

M4 Forces and motion 2024-02-01

11 Items: Energy of moving things. _______________another name for air resistance _________The turning effect of force. _____________energy stored in a hot object _____________The heaviness of an object caused by gravity _______When an object has equal moments of force __________The upward push of a liquid or gas on an object________...

Philosophy of Love of God 2025-04-23

18 Items: RasaSevaPremaBhavaRadhaDasyaTearsSakhyaKrishnaEcstasyMadhuryaVatsalyaSambandhaAbhidheyaPrayojanaChaitanyaMadhurya-RasaDivine-Couple

Earth and Space 2025-03-13

21 Items: The red planetThe Jewel of the SkyThe planet we live onTo light something upThis planet is a dwarf planetThis means the moon is growingWhat we see in the sky at nightThis means the moon is shrinkingA group of stars creating a shapeThis planet is closest to the SunThis planet has a tilt of 90 degreesThis planet is furthest from the sun...

Important Political Documents 2025-03-05

10 Items: ActActMagnaCartaBillofRightsofVersaillesProclamationof IndependenceU.S.ConstitutionFederalistPapersDeclaration of Human Rights

Intro to Geography 2025-06-30

12 Items: Half of the globeWhere something or someone isThe study of Earth and its peoplePlant life in a specific locationThe seven large landmasses of EarthThe largest bodies of water on EarthHow people relate in the physical worldA naturally formed feature on Earth's surfaceHow people or things get from one place to another...

WORKERS 2024-02-01

16 Items: DEGREE OF RISK AT WORKPAID MONTHLY AT A FIXED RATETHINKING SKILLS OR REPETITIVEFEELING HAPPY AND CONTENT AT WORKLEVEL OF EDUCATION REQUIRED TO DO A JOBA FIXED AMOUNT PAID PER ITEM PRODUCED OR SOLDADDITIONAL BENEFITS WHICH HAVE MONETARY VALUEOPPORTUNITIES FOR PROGRESSION WITHIN THE FIRMPERCENTAGE OF VALUE OF PRODUCTS OR SERVICES SOLD...

Periodic Table History 2024-11-22

11 Items: “Hey you!”…this is a member of the “Coinage Traid”Groups of 3 elements that all share similar propertiesBesides silver, this element was also a member of the “Coinage Triad”German chemist who organized elements in order of increasing atomic massOrganized elements into groups of 3 elements that all had similar properties...

Accretion Word Search 2024-02-06

13 Items: This is a measure of mass per unit volume.______________This is a measure of the quantity of matter._______________This is a celestial body in orbit around a star.______________the force that causes objects with mass to attract one another._____________This is the path which one body follows around another body in space.______________...

Diseases and Disorders of the Skin 2024-10-28

30 Items: persistent itchingover-production of pigmentabnormal growth of the skinredness caused by inflammationcluster of boils caused by staphabnormally thick build-up of cellsflat spot or discoloration on the skindead cells that form over a wound/blemishoccurs when follicles become clogged with oilcontagious infection around the eye; pink eye...

War of 1812 2024-10-23

9 Items: DCActHawksOrleansJacksonof GhentFederalistImpressmentof Good Feelings

ED SHEERAN 2024-03-12

22 Items: plusninaGirlboattidesTimesdivideequalsOf YouA MessHabitsPeopleperfectshiversmultiplysubtractOut Louddo I KnowVariationsphotographof the Border6 collaborations project

Unit 7 Earth Science 2025-03-18

29 Items: EonEraDecayEpochMoldsCastsDatingFossilFossilDatingPeriodExtinctPangaeaMesozoicCenozoicHalf-lifePaleozoicTime Scaleextinctionbone/shellUnconformityRelationshipsCyanobacteriaPhotosynthesisof Superpositionof Cross-cuttingUniformitarianism(Radiometric) Datingof Original Horizontality

summer week 1 spellings 2025-05-09

20 Items: MiteDoughCuffsCountHeartFlightPlightFacialAdmireBicyclebeing meanCompletionAdventurousCompositionComprehensionfind the meaning ofattaching using tapeacting without thinkinglarge amount of happinessthe period when a monarch rules

Root Word Vocabulary List #2 2024-11-25

15 Items: a mistaken belief ___________________based on a mistaken belief ________________a person who is worldly ___________________pitifully sad or lonely ____________________to politely restrain an impulse ______________having the traits of a sophomore _____________to abandon someone/something _________________...

Norse mythology Week 1 2025-03-23

12 Items: the frost giant whose sweat created the first man and womanThe world inhabited by humans, located in the middle of Yggdrasil's branches.One of the Nine Worlds, it is the home of the Aesir gods, including Odin and Thor.A majestic hall where warriors who died in battle are received by Odin, the chief god....

Ancient Rome Vocab #1 2024-04-29

16 Items: A person who is highly educated.A public office in the Roman Republic.A war between citizens of the same country.To break away from or rise against authority, a rebellion.A powerful body of 300 members that advised Roman leaders.The governing and advisory council in the Roman constitution....

Electric Vocab 2023-05-16

20 Items: the sound made by a flash of lightningThe flow of electric charges along a pathvisible electrical discharge from a cloudA path along which electric charges can flowThe build up of electric charges on an objectA circuit that has a break in its path, will not workA circuit that does not have a break in its path, will work...

Harbor Me Vocabulary Quiz 2025-04-10

27 Items: HeaterImperfectTo shelterSpanish word for riceSpanish word for pastryState of being never-endingThe act of coming back to lifePuerto Rican shaved ice dessertUncertain, indefinite, or unclearHaving been reborn in another bodyKilling of one person by another; murderOffering resistance to something or someone...

Charlies science word search about space 2024-05-16

13 Items: smallest planetthe number of planetsother large ice giantsun a large hotter suna large planet with ringssmall star in center of planetsa magnetic rock that floats in spaceThe largest planet in our solar systema planet that's very hot with volcanosbelt a belt of astroids that floats in the solar system...

History of Floral Design Vocabulary 2025-01-23

12 Items: filler flowers of the ikebanasides or halved which are the samecreated by the Greek; horn of plentysomething to add decoration or attractivenessappears natural and not artificial or arrangedprimary line of the ikebana representing heaventertiary line of the ikebana representing earthflowers/ foliage to be worn or hung up for décor...

science 7th grade bella porter 2024-05-16

15 Items: two lower chambers in the heartthe place where two or more bones are connectedThe Ability to maintain a stable internal environmentcardiovascular system provides blood supply throughout the bodycell the building blocks of plants and are found in green plantsorganelles found in plant and algae cells that perform photosynthesis...

bodrun 2025-02-13

10 Items: the city bacame partaccording to historianthe name of the knightsone of the Seven Wondersa source of livelihood and fthe name of a famous shipwreckimportant chapels built by theBodrum is an important harbor inthe historic name of the modern citythe time in antiquity when the city

unit 11 2024-05-01

16 Items: best measure for water quality87% of freshwater is located herestage of treatment that separates solidsstage of treatment that removes nutrientsdischarge pollution from a specific locationan area that can hold water in soil particlesalong coastlines saltwater can move into aquifersUnderground tank contains wastewater from the house...

David Berkowitz Word Search 2025-01-09

10 Items: Target of his attacks.Gun used in his shooting sprees.His reason for targeting young women.What he sent during his killing sprees.Type of bullet found at his crime scenes.The supposed motifortion of his killings.Where he served for part of his sentence.Person who inspired his alias "Son of Sam."Alias David Berkowitz used during his killings....

The Roman Empire 2025-04-27

10 Items: A male ruler ?A female ruler ?A group of humans?A male monarch who rules an empire ?The form of government by ‘the people’ ?The form of government by kings or queens ?The head of this emperor was found on a coin ?A group of people who make and enforce rules ?He marched his army from Gaul to Rome to take power ?...

4th Grade Art with Maestra Hawley 2024-01-19

32 Items: artgluelineformyarnclayspacevaluecolorshapepaperelsolpainthawleycrespopencilcrayonsprimarytexturecleanupmaestrastickerorganiccollagescissorsportraitsculpturegeometriclandscapecolorwheelmonochromaticaccordionbook

Lesson 24-Owen & Mzee (4th grade) 2024-02-26

20 Items: supplysinglemiddlesettlesampleturtlehundredexplainpilgriminsteadmonsteraddressfartherathleteorchardkingdomsurprisesandwichcompletealthough

Mr. Ross 4th Grade 24-25 2024-08-14

33 Items: OwenXaviAbelNoahErickBryanAmaniSofiaRomanDiegoCalebAveryChiaraRobertAdysonAiyanaAnabelJaylenAlbertoKameronBriannaAbigailAnthonyAudrinaLizbethBrooklynGenesisFJackelynEmmanuelGenesisRJonathanEsmeraldaSebastian

4th Grade Spelling Words - Week 29 2025-04-01

20 Items: abletableuncleanklemaplepebbledoublecuddlebundlecandlecradlefiddlewafflejuggletacklecoupleturtlebattlebottlehustle

Tzitzit- clues only 2024-06-03

10 Items: Shearing the wool off the sheepThe uniquely colored string among tzitzitTzitzit should not be cut using this materialSpecial piece of fabric at the top of a tallitThe Tzitzit garment that you wear during prayerThe Tzitzit garment that you wear throughout the dayNumber of total strings that each corner is made up of...

#FINDINGDAHL - Matilda 2024-12-09

10 Items: Miss Honey's first name.The name of the librarian.Miss Trunchbull's real name.The name of Matilda's brother.The name of Miss Honey's father.Age when Matilda started reading.The name of Matilda's favorite author.The boy who ate Miss Trunchbull's cake.Animal that was in Miss Trunchbull's glass.A book full of mystery according to Matilda.

Next Gen July 27, 2025 2025-07-25

10 Items: hopegreenpeoplesearchhundredrejoicereturnsshepherdstrengthsheepfold

Word Search 2024-10-16

12 Items: In which genre did Joyce write only one work, "Exiles"?Who was James Joyce’s lifelong partner and eventual wife?Joyce briefly studied medicine at the University of ______.What is the genre of "A Portrait of the Artist as a Young Man"?Who is the idealized love interest of Stephen Dedalus in the novel?...

Article 1 Review 2024-09-11

15 Items: Length of a Senate termCongress can declare thisMinimum age to be a SenatorThe power to raise and collectType of legislature Congress isThe President serves as Commander-inThe chamber where impeachment beginsThe group in Congress that reviews billsLength of a House of Representatives termThe chamber that holds impeachment trials...

Wyoming Word Search 2025-03-06

14 Items: What is Carly’s middle name?What is the best man’s name?What is David’s middle name?What state are they moving to?What month is Carly’s birthday?What instrument does David play?What day of the week is it today?Pacific Where did David go to college?What is the name of the maid of honor?Which state do David’s parents live in?...

you 2022-10-08

13 Items: my best friend & boyfriendthe name of our OG icee guyyour favorite types of mintsthe brand of your favorite candyone of your favorite cracker/chip/snacksthe type of hats you often model in Rossyou hate McDonald’s and In N Out’s _____your favorite cookies (with chocolate chips)the nickname I call you when you’re being silly...

Chapter 5, 7, 9 2023-02-14

22 Items: means nearer the headsuffix meaning diseaseword root meaning heartpressure induced traumacrew resource managementsuffix meaning inflammationmeans further from the trunkwhat occurs after the word rootdecreasing the angle of a jointfilter blood within the kidneyswhat occurs before the word root1-3 years old, pulse rate 90-150...

Mollys Wordsearch 2023-12-18

20 Items: the big bearthe small bearthe study of planetsorbit around the sunthe galexy we live inour solar systim is in onethe study of constellationsthe bigger spoon in the skythe smaller spoon in the skyif a meteor touched a groundalso knowen as a shooting stara formation of stars in the skyan object that light bounces off of...

The Respiratory system 2025-01-16

20 Items: ThroatWindpipeVoice boxTiny blood vesselsProtects the lungsCells that hold mucus____ lobes on the left lung____ lobes on the right lungTiny sacs at the end of bronchiolesAir tubes that branch off the tracheaExternal part of the respiratory systemObtain oxygen and remove carbon dioxideSlows down air to moisten and warm it up...

Listen To Me! 2-3 2023-08-09

44 Items: maywalkrestlawntripjunejulysmarttimidbravefunnygamesbooksmusicplantcleantablevisittastyfoggymarchaprilactivehonestpolitepuzzledinnerdishespalacetemplefamousaugustgarbagelaundryjanuaryoctobersiwmmingfestivalfebruarynovemberdecemberbadmintonseptembercompetition

Summer Word Search 2024-05-16

45 Items: funsunhotbbqmaypoollakeboatjulyjunesandbreakbeachoceanpartygamessummersportsaugusttravelshortssandalsflowerssunburnfishingcookoutnoschoolswimmingvacationsunshineicecreamfloatiessunscreenpoolpartysleepoverbeachballmosquitossunglassessleepinginwatermelongraduationsummercampbathingsuitsummerschoolwaterballoon

Cat Word Search 2024-05-22

42 Items: catbathotsunufocowboylionhailmastbikefishjulyjunerockgoldgirlkingzebrahippoclockchipsperezplutobrillqueensofiatrainsticketplanetnissanpoliceschooldallasprinceacademyelephantskeletonrailroadtornadoeshelicopterMan's best friend

Erik & Abbey 2024-07-11

45 Items: zooeriklovekissjulywifeabbeybridegroomringspennytreesmillerhikingfamilynaturesummerforeverhusbandfinallyawkwarddancingbelovedweddingwilliamseternityabbicadesquirrelkayakinglaughterdevotioncocktailshoneymoondanapointcelebratetwentiethadventurebigbearlakejustmarriedlookoutpointintothewoodsfifteenyearstimeaftertimesweetsomethingpartnersincrime

Monday Word Search 2025-03-17

44 Items: MAYJUNEJULYMARCHAPRILMONDAYFRIDAYSUNDAYAUGUSTEASTERTUESDAYJANUARYOCTOBERWEEKONEWEEKTWORAMADANTHURSDAYSATURDAYFEBRUARYNOVEMBERDECEMBERWEEKFOURWEEKFIVELABORDAYHANUKKAHWEDNESDAYSEPTEMBERWEEKTHREECHRISTMASHALLOWEENMOTHERSDAYFATHERSDAYNEWYEARSDAYMEMORIALDAYVETERANSDAYCOLUMBUSDAYWINTERBREAKTHANKSGIVINGVALENTINESDAYSPRINGEQUINOXAUTUMNEQUINOXWINTERSOLSTICE...

Neoplasia 2025-05-16

6 Items: disorder arrangement of cellsbenign tumour of smooth musclebening tumour of blood vesselsmalignat tumour of blood vesselsmalignant tumour of smooth musclespread of tumours to distant site

Bootastic word search 2023-10-23

20 Items: the undeadgourd/squashRegion in RomaniaFearful/frightenedName of the holidayI'll suck your bloodI love mixing potionsNightmare before _____Nothing but skin and bonesWho you gonna call, _____!____ at the top of your lungsThis old mansion must be _____That sent chills down my _____Used to sweep the floor or fly onpractice of magic or use of spells...

Tower of Nero Word Search 2025-03-24

12 Items: Apollo — god of the sunCumae — one of Apollo’s oraclesDodona — one of Apollo’s oraclesErythaea — one of Apollo’s oraclesTrophonius — one of Apollo’s oraclesDelphi — the most famous of Apollo’s oraclesLester — Apollo once he got kicked off OlympusNectar — similar to ambrosia but in liquid formMeg — demigod daughter of Demeter and Apollo’s master...

Table Word Search 2024-10-22

20 Items: Tag for a row of a tableTag for the heading of a tableTag that starts a YouTube videoTag that signifies a YouTube videoTag for the content of a table cellAn HTML table border that is single-linedStyling using CSS in the <head> of your webpageA Div created inside another Div is an _____ DivA _____-lined border is the default table border...

Week 3 Review by Sharli Syed 2023-09-25

17 Items: What a substance is when it has a pH of 7._______ compounds are compounds that contain carbon.Simple sugars; links together to form carbohydrates.Breaks down monomers, separating them by "adding water."Substances that have an excess of H+ ions; pH less than 7.Measure used to express how basic or acidic a substance is....

Topic 1 Vocab 2024-12-05

18 Items: a living thingmade of a single cellan animal without a backbonesingle-celled organisms that lack a nucleus prokaryotesthe scientific study of how living things are classifieda group of similar cells that perform a specific functionthe process of grouping things based on their similarities...

Human Demand on Natural Resources 2024-03-10

17 Items: study of human populationsthree basic needs of humansarea outside a town or cityarea relating to a town or citypeople who study human populationsnumber of organisms in a given areadata collected about the human populationmeasurement of population per unit land areausing a natural resource without reducing its supply...

Energy 2023-06-14

20 Items: Energy linked to fuelThe rate of work doneVariable that you changeEnergy linked to movementVariable that you measureAlso know as thermal energyEnergy linked to luminous objectsPotential energy in raised objectsThe unit of measurement for energyEnergy cannot be created or _________Energy found in the nucleus of an atom...

Olivia & Guy 2025-02-17

23 Items: The couples dogthe wedding venueLivs place of workGuys place of workBrand of their carsBrides new last nameChore the groom doesLivs nickname for guyGuys nickname for livwhere they got engagedanother word for partnerCouples honeymoon destinationGuys favourite feature of livsthe place they plan to retire incolour of the bridesmaid dresses...

Government 2025-03-21

28 Items: 2-houseright to votenatural rights18th Amendmentsocial contractto stop an actiona.k.a Connecticut#abolished slaveryFirst 10 amendmentsway to delay a voteoutlines our governmentprotection from the lawmake up electoral collegeaccusation of wrong doinga.k.a necessary and properConstitution "law of the land"agreemnt, consent, signing e.g....

relational fears 2024-10-09

6 Items: gamophobiaproditiophobiafear of betrayalfear of commitmentfear of losing freedomfear of other people's expectations

ELA Q3 Review 2025-01-16

18 Items: Main idea __________Nonbiased __________Time order __________The problem of a story __________The paragraph of a poem __________The writers reason for writing __________Conversation between 2 characters __________Where and when a story takes place __________A word with the same or similar meaning __________...

Money Word Search 2025-01-16

15 Items: Items that are produced for sale.To set aside money for future use.A plan for managing income and expenses.Money that is owed by one party to another.The money made from business after expenses.The exchange of goods or services for money.Physical money in the form of coins and bills.Money received for work or through investments....

States of Matter 2024-05-24

10 Items: S---- is a form of matter. ______________S---- is the form of an object. __________M--- is the ammount of matter an object has. ____________V----- is the amount of space an object takes up. ____________S---- is a form of matter that has its own size and shape. __________P------- is a characteristic or feature of an object. _______________...

Of Us 2025-01-14

17 Items: MTAYDSBubUCLALoveHopeBabeQuestRegisDizzySilasDreamMahalBloomSubaruLutherPrayer

Watershed 2025-03-28

17 Items: Water that falls from the sky.A waterway or path used to remove stormwater.The process of water being absorbed into the soil.The water that exists beneath the earth’s surface.A place where animals and plants live in a watershed.A natural or artificial body of water used to store water.Water that flows over the ground, often carrying pollutants....

party 2025-07-06

19 Items: HBCUSisterbrotherchurch,First carJr brothersummer jobActual ageearly yearsName of motherHigh high schoolstreet in Bottomsfavorite past timeL Name of father21 Actual birth datefavorite travel spotfavorite travel spotStreetformative yearsSchool 53 Decision school name of elementary

Elements and Compounds 2024-12-16

14 Items: Form when two or more different elements combineIt is a substance that is dissolved in a solventIt is the result of dissolving a solute in a solventIt is a substance which can dissolve other substancesA mixture in which the composition is uniform throughoutIt is the act of decreasing the concentration of a solution...

Word Roots from Latin and Greek (Advanced) 2025-04-14

10 Items: THERMAL : Related to heat or temperature.CREDIBLE : Capable of being believed or trusted.AQUATIC : Relating to water; living or growing in water.THERMOMETER : An instrument used to measure temperature.CHRONOLOGY : The study of time and the sequence of events.BIOLOGY : The scientific study of life and living organisms....

War of 1812 2024-10-23

9 Items: DCActHawksOrleansJacksonof GhentFederalistImpressmentof Good Feelings

Tutorial 12 2023-09-10

15 Items: __________ iterations is the third step of prototyping__________ basic requirements is the first step of prototypingThe advantage of prototyping include better __________ of user needsA problem with CASE technology as some tools do not interact effectively with some systems....

valentine's day article 2023-01-18

14 Items: There is no way of knowing for sure...if Valentine _______ at all.People did not always relate love with _______ in pre-Christian Roman society.The Romans were not all too thrilled by the spread of _________ for various reasons.The day has been named after one or more ______ of the early Christian era named Valentine or Valentinus....

Unit 6: Court cases 2024-02-05

11 Items: Modeled after the NAACPPolice must inform suspects of their rightsCreated to stop the discrimination of hispanicsCase over segregation based on language barriersAllowed undocumented children to attend public schoolNational Association of Latino Elected Officials UnidosTexas education system was discriminating based on wealth...

Bond Word Search 2023-08-14

9 Items: It's a type of clayDon't do drugs kids!"What's the ______ dear"the names ____ James ____Einsteins______ of relativityYou can put them on your fridge(of a reaction or process) accompanied by the release of heat.each of two or more different physical forms in which an element can exist...

Democracy & Mexico's Government 2024-10-01

9 Items: lasts six yearsdebates and makes lawsare composed of judgesit's composed of deputies and senatorshead of state; proposes and follows lawsapplies and makes sure laws are followedform of government that depends on the will of the peopleMexico's government _________ are the Presidency, the Congress, and the Courts...

Accretion Word Search 2024-02-06

13 Items: This is a measure of mass per unit volume.This is a measure of the quantity of matter.This is a celestial body in orbit around a star.the force that causes objects with mass to attract one anotherThis is the path which one body follows around another body in space.This is the measured value (always positive) from one point to another....

Chapter 2 - Age of Exploration - myWorld Social Studies 2023-01-26

16 Items: great harma conquerorto travel completely aroundan instrument used in navigationa person who buys and sells goodsa settlement far away from the country that rules ita group of nations or peoples ruled by a single authoritythe process of charting a course for a ship or an aircraftan organized group of people taking a journey for a purpose...

Principles of Design 2023-11-15

20 Items: .618Becoming oneCenter of attentionOne area to the wholeBalance Pleasing to the eyePhysical and visual stabilityEmphasize something in one areaEqual amounts of color and formStrong colors at the focal areaConsidered the divine proportionDissimlar amounts and placementsThe amount or number of materialMatching and blending materials together...

Thermal-Treatment Word Search 2024-05-28

30 Items: oreoxidewaterbelowcaco3fe2o3cementorganicbauxitealuminaceramicslimestonehazardousextractionmetallurgyenvironmentore-dressinghydrated-oredecompositiondecompositioncarbonate-oremelting-pointabsence-of-aircarbon-dioxidehigh-temperaturephase-transitionthermal-treatmentore-concentrationlimitted-supply-o2removal-of-volatile

4th Period ELA 2020-11-23

7 Items: verbnounTuckthemeWinnieTreegapcharacter

Henry's Sky Science Word Search 2023-12-18

14 Items: a small rock in spaceto discharge somethingthe study of the universedebris from an object in spacewhen light bounces off another objecttrain their whole lives to go into spacea big rock made up of dust and particleshappens when the sun crosses the equatora smaller constellation of the big dippera famous constellation that resembles a big bear...

Gavins word search 2022-11-28

10 Items: areas of maximum displacementareas of maximum displacementlowest part of transverse wavethe measurement of displacementhighest part of transverse wavewhat the frequency is measured inwave motion that is parallel to wavethe distance of one complete wave cyclewave motion that is perpendicular to wavethe second aspect you need is the wave ________

Mercury Word Search 2024-05-17

15 Items: big walls of iceii is the 4 plantit has its on cyclegas turn into liquidit used to be a plantit is the second form of a starthis planet has the most volcanoeswhich of the 4 earth Systems is rockhas the most rings out of any planetwhat planet is the close is to the sunit is earth Nader that moves around itit is the water of the 4 earth systems...

Blake's Sky Science Word Search! 2023-12-18

20 Items: AKA the Big DipperThe milky way is a _?AKA the Little Dipperwe live in what galaxy?The days spring and fall startThe study of stars and galaxiesA group of stars that make a pictureA metor that lands on Earths surfaceA constellation also known as Ursa MinorLight bouncing off of an emitting objectSomebody that goes up to space to explore...

Mr.Wordy.W.Wordison Wordsearch 2023-10-19

10 Items: Oldchance ofAdverb -lyDeath place------- centregeared and tieredleaders of countryseveral types of thingsannoying someone with courageseeing someone and knowing them

Jakobe's word search 2022-11-28

10 Items: is a measured in frequencylowest part of a transverse wavehighest part of a transverse waveis a area of maximum displacementis a area of maximum displacementis the distance of one complete wave cycleis the measurement of maximum displacementwhich moves the medium parallel to the wave motionis a number of waves or vibrations produced per second...

SCHOOL OF ROCK 2023-12-10

27 Items: A style of musicThe words of a songA musical dynamic meaning loudA musical dynamic meaning softOne musician singing or playing.playing or singing unaccompanied.A tuner helps a musician find this.a brass instrument seen in the moviea woodwind instrument seen in the moviea stringed instrument seen in the movieHelps a singer to be heard over the band....

WORD SEARCH (KIDS) 2025-01-25

20 Items: One of Nabi Muhammad’s sons.There are ____ pillars in Islam.The belief that there is only one God.The ninth month of the Islamic calendar.The place where Masjid an-Nabawi located.The full name of Nabi Muhammad’s first wife.The sura we are encouraged to read every Friday.The name of the month Nabi Muhammad was born in....

Leahs space themed word sherch 2023-12-18

10 Items: The start of springPeople that study spaceAlso known as Urisa minorAlso known as Urisa majourStars that make shapes in the skygive off, send forth,or dischargeThe reserch of eveything in the universeThe beliefs of the position of the starsmeans the sortist day of winter solsticeDust and ice particals that orbit the sun

4th grade vocab food and farm 2024-11-18

18 Items: grewcarecinchfeistycattlethoughpopularcontaintallestcrystalspalominoecstaticappealinglivestockexperienceconveniencealternativegrantpermission

James & Danielle 2025-05-02

25 Items: Proposal locationBride’s first nameGroom’s first nameGroom's Birth MonthNumber of groomsmenBride's Birth MonthCouple's first dateMonth of the weddingGroom’s favorite foodHoneymoon destinationCouple’s shared hobbyNumber of bridesmaidsName of wedding venueGroom’s favorite sportBride’s favorite flowerCouple's favorite drinkSong for the first dance...

Root Word Vocabulary List #2 2024-11-25

15 Items: a mistaken belief ___________________capable of making a mistake ___________based on a mistaken belief ________________the use of a fallacious argument __________to alter information to mislead ___________a person who is worldly ___________________pitifully sad or lonely ____________________to conceive of a desirable event ____________...

pathophysiology 2025-02-15

15 Items: a pocket of pusinflammation of the skininfection caused by mitesinfection caused by fungusinfection caused by a virusan abnormal mass of tissuestype 1 hypersensitivity reactioncontagious growth, caused by HPVA type of skin lesion in epidermisparasites that feed off human bloodinfection common in children/infants...

Third Word Search 2025-08-07

15 Items: The villainexaggerationThe main characterThe height of actionHints of what is to comeTime and Place of a storyComparing two unlike thingsMake fun of human weaknessesusing physical or personality traitsScheme The way in which a poem rhymesThe opposite of what you would think happensSomething which represents and idea or thought...

Norse Cosmology 2022-07-25

12 Items: The Realm of the Aesir is _____.The Realm of the Giants is _____.The realm of human beings is _______.Norse cosmology divided the universe into ____ realms.Bestla gave birth to the first of the gods: ____, Vili, and Ve.Odin's famous hall of _______, where his throne may have been located, is in Asgard....

Pekudei / Shemot Review 2025-03-23

45 Items: “accounts”Moses wife.Moses brother1/10 an ephah.the rams horn.The Seventh day.the second plagueThe eldest son of LeviMoses and Aaron’s motherMoses and Aaron’s fatherThe color of Aaron’s robeMiriam played what instrument.A _______ is not to be cursed.Israel left Egypt in this month.They attacked Israel at Rephidim.How many daughters did Yitro have?...

Force and Motion 2025-05-15

27 Items: speed in a directionan object changes its positiona push or pull acting on an objecta force that pulls objects toward each other\a measure of the amount of matter in a samplethe process of energy changing from one form to anothera force that acts in the opposite direction to movementfor every action, there is an equal and opposite reaction...

wood department 2025-01-23

30 Items: flooring comes from the bark of a treeto add a vintage or rustic look to woodis a type of glue used in some installations___________ flooring is always 100% waterproof________is our entry price pint vinyl flooringare a method for attaching wood to subflooringanother method of attaching wood to subflooring...

Jordan Word Search 2024-03-01

10 Items: Capital of JordanJordans HDI rankingJordans eastern borderThe currency in JordanJordans northern borderMain religion of JordanJordans southern borderThe major river in JordanType of government in JordanThe sea west of Jordan; lowest point in the world

Ethan Word Search 2023-12-18

18 Items: Our GalaxySmall icy objectThe Study of spaceA pattern of starsLooks like a big bearLooks like a big spoonLooks like a small bearLooks like a small spoonA rock in the solar systemThe study of ConstellationsOrbits a star and is in a sphereSun is excactly above the equatorSomeone who goes to space to studySomething that has planets stuck in it...

Personal Finance Vocab Word Search 2025-06-04

10 Items: Money that a company owesState of not being able to pay debtsMoney a person earns from providing services.Shows proof of someone's ownership of somethingAn amount of money that is paid after borrowing moneyA cost that a company needs to pay to continue making moneyA plan someone makes to keep track of how much they save and spend...