4th of july Word Searches

Mexico's Culture 2024-05-09

12 Items: an example of Mexican artofficial name of our countryan example of a Mexican sportofficial language of our countryscientists who study human cultureculture can change when the ___________ changesan example of a thing/element that makes up a cultureanother example of a thing/element that makes up a culture...

Electrons in Atoms 2024-12-06

24 Items: The shape of a “p” type orbitalThe shape of an “s” type orbitalHas the electron configuration 1s²2s¹The number of orbitals in a“p” type sublevelHas the abbreviated configuration [Ne]3s²3p⁵The number of orbitals in a “d” type sublevelThe number of orbitals in an “s” type sublevelThe number of orbitals in an “f” type sublevel...

Analyst Word Search 2025-10-25

28 Items: – Person managing a pool of assets– Ownership value in a company or asset– The original sum of money invested or loaned– Estimating future financial or market trends– The chance of loss or uncertainty in outcomes– Recording and reporting financial transactions– Moral principles guiding right and wrong behavior...

Word search 2025-10-25

28 Items: – Person managing a pool of assets– Ownership value in a company or asset– The original sum of money invested or loaned– Estimating future financial or market trends– The chance of loss or uncertainty in outcomes– Recording and reporting financial transactions– Moral principles guiding right and wrong behavior...

cha 2025-10-26

28 Items: – Person managing a pool of assets– Ownership value in a company or asset– The original sum of money invested or loaned– Estimating future financial or market trends– The chance of loss or uncertainty in outcomes– Recording and reporting financial transactions– Moral principles guiding right and wrong behavior...

EASTER 2025-04-13

33 Items: TOMBLOTSTHEMLIFELORDJUDASCROSSCHRISTSAVIORSUPPERANGELSSUNDAYSPRINGBROTHERROBBERSREDEEMERADVOCATESOLDIERSEMMANUELPASSOVERNEPHITESAND OMEGAMAGDALENEOF THORNSHAPPINESSROLLED AWAYIS NOT HEREIS FINISHEDSPIRIT WORLDONE OF ISRAELOF GETHSEMANEOF JESUS CHRISTABOUT THE BUNNY

MRS. LUHRING'S 4TH GRADE 2025-08-21

16 Items: WILLCRUZJACKABELGRACEHEIDIAARONJOVEEHAYDENKAYLEEFINLEYHAYDENTIMOTHYGILBERTEMERSONLUHRING

Macroeconomics Wordsearch 2024-04-24

14 Items: total amount gainedassets of a businessCreator of Capitalismthe amount of a productthe makers of a productthe buyers of a productwant of a certain productfounder of a new businessa greater demand than supplyamount gained after all expensesthe current price a product is sold atwhen a business fights another for customers...

Lunes Word Search 2025-01-29

13 Items: mayJulyJuneAprilmarchMondayFridaySundayTuesdayJanuaryThursdaySaturdayWednesday

Doesn’t matter 2025-01-29

13 Items: mayJulyJuneMondayFridaySundayTuesdayJanuaryOctoberThursdaySaturdayFebruaryWednesday

Lunes Word Search 2025-01-29

13 Items: mayJulyJunemarchAprilMondayFridaySundayTuesdayJanuaryThursdaySaturdayWednesday

World Landmarks 2023-02-10

20 Items: BenTowerMahaluluruFallsSophiaMosqueMosqueMosqueAlHaramKhalifaAnNabawicolosseumof Libertyof CordobaOpera HouseGate BridgeBlue MosqueLane MosqueWall of China

Chapter 15 Vocabulary Review 2024-03-06

34 Items: A brand that can be spokenThe overall perception of a brandLines of transport owned by shippersThe sum of related individual product itemsA distribution system without intermediariesA brand that cannot be spoken; a company logoThe collection of a firm’s total product linesThe similarity of product lines in a product mix...

Classic Horror Movies 2022-10-20

15 Items: ManManblobkongmummyof waxpeopledraculanosferatufrankensteinof the operadangerous gameon haunted hillof Frankenstein"from the Black Lagoon

Mr. Gerald's Flurry's FOT 2025 Message I 2025-10-10

32 Items: lawjoyGodrockcrownpeaceZadoklightstonetruththronehastenof GodFlurryo fhopeAdullamcastoutloyaltyAmaziahnobilityhappinessAntiochusof safetyArmstronggovernmentcommissionrevelationpreparationof the Agesking-priestspurificationrighteousness

Summer 2021-06-14

35 Items: HotfanJulyJunerelaxHumidSunnyActiveJetskiAugustsurfersweatySailingSandalsfishingflowersIcecreamRoadTripbarbecueseashoreswimmingbaseballlemonadeSunKissedSunScreenSurfBoardfireworksslipflopslightningsandcastlebackpackingfishingboatbathingsuitAirConditionerIndependenceDay

Hozier 2025-01-06

28 Items: JulyHozierTooSweetFareWellWhoWeAreSonOfNyxEmpireNowFirstTimeFrancescaThatYouAreFirstLightAnythingButUnknown/NthSwanUponLedaHymnToVirgilEatYourYoungAllThingsEndDeSelby(Part1)DeSelby(Part2)DamageGetsDoneNobody’sSoldierButcheredTongueICarrion(Icarian)WildflowerAndBarleyThroughMe(TheFlood)Abstract(Psychopomp)UnrealUnearthUnending...

english vocabulary 2025-03-28

35 Items: redearhatbluenosehaireyesjulysocksscarfpantswhiteshoesskirtwindybrownshirtsunnydressmouthrainyblacksnowymarchcloudysundayshortsyellowstormyjanuarytuesdayoctoberdecemberthursdaywednesday

Colors 4th Grade 2025-11-03

11 Items: redbluegoldgreenwhiteblackbrownyelloworangepurplesilver

Presidents: John Adams - Word Search 2024-10-10

34 Items: WarFarmJulyNavyAdamsParisEpochaEuropeFranceLawyerQuincySecondTreatyUnitedAmericaCollegeHarvardHistorySupportAdvocateAmericanCongressDiplomatBraintreeMemorablePoliticalPresidentQuasi-WarGovernmentContinentalDeclarationIndependenceMassachusettsRevolutionary

Unit 8 APES review 2024-04-30

20 Items: Where over 50% of MSW ends upA common exposure route through the airA common exposure route through the skinA common exposure route through food/ waterIncrease in death rate occurs over a large areaType of waste that is mostly chemical and constructionType of disease not caused by pathogens and can be genetic...

Human Impact Vocabulary 2025-05-19

15 Items: Reusing materialsWhere animals liveA stock of materialsNo longer exists, dies outHumans clear trees to build housesVariety of habitats and ecosystemsPrevention of wasteful use of a resourceProduction and disharge of gas or radiationDeplete the stock of fish in a body of waterWeather conditions over a long period of time...

Ch. 11 Hair Removal Vocab 2025-11-06

31 Items: Also known as bandingThe border of the lip lineThe anatomical name for the underarmThe soft, downy hair found on a fetusNecessary for hair growth and nourishmentA resin used in the manufacture of soft waxSecretes sebum to lubricate the skin and the hairThe area between the eyebrows at the top of the nose...

English Law Word Search 2023-09-13

25 Items: Dealt with major civil casesWrote the first Law Code of EnglandA systematic collection of statutes.A written law passed by a legislative bodyA difficult or painful experience, a trialA court of equity, as distinguished from a common-law court.A legal document giving certain rights to a person or company...

Nonfiction Memoir VST 2025-10-09

20 Items: To give a false representation ofa state that is controlled and protected by another.(of a person) not recognized as a citizen of any country.An organized, state-sponsored attack on a group of people.a person who carries out a harmful, illegal, or immoral act.To surrender often after negotiation of terms, to cease resisting...

CH6 - Human Impact 2022-12-20

16 Items: Pollutants that are released into the air.________________________Contamination of Earth's land, water, or air.________________________A specific source of pollution that can be identified.________________________The removal of forests to use the land for other reasons.________________________...

Mrs. Zaborowski's 4th Graders 2025-08-26

16 Items: LiamDeanLuisBrodyJamesAlisaOliveDevlinBrandyElodieMillieGraysenIsabellaIsabelleCharlotteChristopher

Random Words Game (July 2022) 2022-07-05

13 Items: okrbipoequityqualitybrownbagintegrityinnovationefficiencydatacentriccornerstoneatomeesbuzzpeoplecentriccustomercentric

Carbondioxide Word Search 2024-05-16

15 Items: Produces Atphas a formula of C6H12O6The site of Photosynthesissingle member of a speciesHas a chemical formula of CO2when a liquid turns into a gaswhen a gas turns into a liquidwhen water is released from the cloudsliquid that fills up the inside of a cellConverts light energy into chemical energyall the living and non living things in an area...

Mr Richie 4th Grade 2020-12-08

16 Items: redevabluelimejoseissacpurpleyellowjaydenamonguscrewmateimpostorvictoriajonathanmrrichiealexandra

Agency Administration 2021-04-22

19 Items: BeatZoneSectorBriberyPerjuryPrecinctMoochingShoppingChiselingShakedownExtortionCorruptionMeat-EaterFavoritismGrass-EaterRank-StructureCode-of-EthicsUnity-of-CommandOperational-Strategies

Term 4 Review 2022-10-05

13 Items: a text typeHuman _____an IB attributeanother text typean English B themeanother IB attributeanother English B themepart of the core of the DPthe number of IB attributesthe number of English B themesanother part of the core of the DPa strategy for reading comprehensionanother strategy for reading comprehension

chapter 2 - tools of environmental science 2023-09-06

17 Items: factor of interestchance that something will happen.representations of objects or systems.the probability of an unwanted outcome.associations between two or more events.a procedure designed to test a hypothesisgroup that receives the experimental treatmenta piece of information we gather using our senses...

GIFTS OF THE HOLY SPIRIT 2023-06-23

9 Items: faithhealingmiraclesprophecyof wisdomof spiritsof tonguesof knowledgekinds of tongues

Motiondiagram Word Search 2025-09-15

18 Items: Displacementthe sum of two or more vectorsthe difference between two timestotal distance divided by total timeThe length of a path between two pointsGreatness of size, strength, or importanceA quantity that has magnitude and directionA physical quantity that has magnitude only.the location of an object at a particular instant...

Compact Word Search 2023-10-06

11 Items: a compact's usual shapea synonym of compactingwhat a compact can carryan antonym of compactingtype of makeup that boldens lipstype of makeup that tans your facetype of makeup that boldens eyelashestype of makeup that colors your eyelidssomething to apply powder onto your facetype of makeup that makes your cheeks rosey...

LGAW Crossword 2024-02-28

18 Items: The Tla'amin Nation NewsletterElected Executive Head of the Tla'amin Nation.How staff present information to elected officialsElected Executive Head of the City of Powell River.The name of elected officials for the Tla'amin NationCampsite and Park managed by the City of Powell River.Elected Executive head of the qathet Regional District....

Elements of Art & Principles of Design 2024-11-01

17 Items: the lightness or darkness of a colora mark that is longer than it is widecreated by lines and are two-dimensionalelements that are repeated in a predictable wayis using different versions of elements in one work of artcreated when light strikes an object and reflects to an eyeused to create a sense of organized movement in a work of art...

Executive Branch 2025-04-21

17 Items: A press secretary or press officera body within the US Executive Brancha key agency within the Executive Officethe senior staff officer of a service or command.a body of people representing the states of the USan intentional disclosure of something secret or private.a formally concluded and ratified agreement between countries....

Units 44 and 45 Part 2 2024-01-18

62 Items: votedpublicnationalby votingto be sent(color) silver(color) copper(neuter) the wood(neuter) the metal(feminine) the voteof or made of glassof or made of plastic(feminine) the revolutionwooden, of or made of wood(feminine) the (law) treatyof or made of stone or rock(neuter) the (rock) diamond(masculine) the (male) slaveof or made of metal, metallic...

Crust Word Search 2024-11-14

25 Items: - What is the innermost part of the Earth called?- What is the outermost layer of the Earth called?Ridge - What is an example of a divergent boundary?- What forms when magma reaches the Earth's surface?- What is the layer beneath the Earth's crust called?Wegener - Who proposed the theory of continental drift?...

Lipids 2025-09-12

17 Items: reaction to make soapsugar-containing lipidthe simplest type of glycolipidthe most common glycosphingolipidbackbone of all phosphoglyceridesproteins that allow for membrane fusionprocess responsible for making trans double bondscarbon found at the distal end of a fatty acid chainproteins that span the membrane and are embedded in it...

Andres Bonifacio and the Katipunan 2025-08-08

12 Items: The lowest rank in KatipunanThe birthplace of Andres BonifacioLocation of the Bonifacio monumentThe Father of the Philippine RevolutionThe rank in Katipunan that uses the password RizalThe rank in Katipunan that uses the password GOMBURZAWhat the Katipunan members tore in the Cry of Pugadlawin...

Math 6 Vocabulary 2023-04-18

15 Items: Part of a wholePer one hundredA comparison of two ratiosA comparison of two quantitiesThe measurement of the space aPositive or Negative Whole NumberA statement of an order relationshipA math statement that shows equalityThe measure around the outside of a circleThe measurement of the outside of a polygonMath phrase with numbers and operation sign...

Anointing of the Sick 2025-05-22

10 Items: What number sacrament is Anointing of the Sick?or Priests, Who can perform Anointing of the Sick?with Illness, Who can receive the Anointing of the Sick?Who cannot perform the sacrament of Anointing of the Sick?of the Sick, What oil is used as a sign of Gods grace and healing?Grace, What is the gift from God that heals and sanctifies our soul?...

4th Grade List #20 2023-01-05

16 Items: jacketfatherkingdompumpkindolphinfartherlobsterinspectathletewhetherinstantchildrencompletepurchasesandwichcomplain

Mrs. Zaborowski's 4th graders 2025-08-26

16 Items: LiamDeanLuisBrodyJamesAlisaOliveDevlinBrandyElodieMillieGraysenIsabellaIsabelleCharlotteChristopher

Ms. Luna's 4th Graders 2025-09-02

16 Items: LunaCoenAriaSarahJesseVivianMarcusEvelynJulianCharlieJocelynRaphaelSawyerHVincentSawyerKArielle

Executive Branch 2025-04-21

17 Items: A press secretary or press officera body within the US Executive Brancha key agency within the Executive Officethe senior staff officer of a service or command.a body of people representing the states of the USan intentional disclosure of something secret or private.a formally concluded and ratified agreement between countries....

Benchmark 2025-09-30

18 Items: inferthemeclaimrevealpropeleffectexcerptarticlepassageconveyssuggestof viewdevelopsnarratorargumentchallengecontributesof an article

Polish Verb Mogę 2025-11-04

30 Items: the form of "móc" in present tense for "ja" (I) meaning "I am able to"the form of "móc" in past tense for "on" (he) meaning "he was able to"the form of "móc" in present tense for "my" (we) meaning "we are able to"the form of "móc" in past tense for "ona" (she) meaning "she was able to"...

Environmental Science- Species 2025-02-18

17 Items: Likely to become endangeredIn immediate jeopardy of extinctionType of limiting factor; ex. diseaseType of limiting factor; ex. droughtspecies with no living individuals remainingType of growth represented by a J-shaped curveType of growth represented by a S-shaped curveSurvivorship curve that shows consistent mortality...

C8 Word Search 2015-07-26

36 Items: MayJuneJulyoldernewerbadlyMarchAprillargerslowlyAugustyoungerthinnerlongestlighterthickercarefulquietlyJanuaryOctoberbirthdayheaviestdirtiestcleanestsloppilyFebruaryNovemberDecemberHalloweenbeautifuldeliciousdifficultSeptembercarelesslyinterestingcomfortable

Summer 2021-04-27

36 Items: FunIceBikeFlipHulaJulyJumpropeJunePoolSnowparkBeachflopsHoopscreamconesThemeMoviesSplashCampingFishingPartiesPicnicsHolidayCarnivalCookoutsParadiseSwimmingFirefliesFireworksPopsiclesSprinklerSunscreenSunglassesRollercoaster

Birthday party mother 2023-03-21

37 Items: boywkdbeercakecokegirljunejulylovewinemarscomefantapepsimusicchrissweetmarchaprilwarpsfantapeopledrinksfamilysisterauntiesummerballoonbrothersausagechickenjanuarybirthdayinvolvedsandwichfavouriteenjoyning

SUMMER VACATION 2023-05-16

36 Items: junejulypoolbeachrelaxaugustbikingfamilyhikingsportssummerlotioncampingfishinghammockpicnicsreadinghotdogssandalsboatingbarbecueicecreamlemonadememoriesswimmingvacationsunshinegardeningpopsiclestravelingsunscreenflipflopswatermelonhamburgerssunglassesstrawberries

Wedding Word Search 2024-06-23

36 Items: cakejulyloverenovowsalterbrideducksgroommilespartyringstoasttrustwhitechristchurchdinnerfamilygospelbouquetdancingflowersforeverpromisevanillaweddingceremonyfebruarygonzalespicturesfirstkisshoneymooninstagramofficiantcommitment

James A. Garfield 2024-10-11

36 Items: JulyOhioTermCivilDeathShortTruthCareerLawyerOfficeReformSystemTragicUnitedCharlesGuiteauServiceEffortsHonestyEducatorGarfieldInjuriesDifficultMiserablePatronagePoliticalPresidentSeptemberCommitmentCorruptionGovernmentPresidencyRepublicanCongressmanTransparencyAssassination

Survivor Season 5-2 2025-03-17

36 Items: ElkRapSusRozRobSaroKariAntiHBICRoroRubyJulyLokiFozzyBellaChusiPearlYoshiLindyLadyKTribalComareMysticGraybaeSellersKitKattSurvivorDavesassVeronicaAlliancesBoltonBaeChallengesNextAdBishCompetitionKingdomkisserMotherofDevils

mixed vocabulary 2025-10-16

36 Items: hopjudoparkpoolrinkleftbendJulytrackrightfortysixtyfiftyaprilmarchhockeyskiingninetyeightythirtymondayfridayskatingrunningbowlingstadiumseventyswimmingfebruarysaturadobadmintoncartwheelhandstandwednesdaygymnasticsbasketball

Creation 2024-12-06

25 Items: SeaSkyManSinDayGodLandDeepLightWomanFruitImagePlantsBreathAnimalsof Edenof LifeSerpentEveningSabbathMorningDarknessCreationCovenantBlessing

Nindita, Maisya & Shofia Riddle 2023-02-23

25 Items: : separating the room: another name for loft: vertical height in stairs: the bottom part of the door: a very common type flooring: different levels of building: the bottom part of the window: highest level in the apartment: the lowest load-bearing part of building: the top element that covering the building...

EOG Vocab 2025-06-12

15 Items: ideaPlotclaimThemesimilestanzasummaryof viewSettingMetaphorEvidenceConflicthyperbolepoint of viewpersonification

Meiosis 2024-05-31

17 Items: period between two periods of mitosishaving chromosomes in homologous pairsa period in the life of the cell when it is conducting cell divisiona condition in which non-sister chromatids of homologous chromosomes exchange geneshaving a single, complete set of chromosomes, or one half of each pair of homologous chromosomes...

Chapter 4 Word Search 2023-11-16

34 Items: Organelle of protein synthesis.Viscous fluid enclosed by the nuclear envelope.Small circle of DNA in some bacteria and archaea.Long, slender cellular structure used for motility.Barrel-shaped organelle from which microtubules grow.This eukaryotic organelle specializes in producing ATP.Semifluid substance enclosed by a cell's plasma membrane....

About Karla & Liv 2018-10-03

36 Items: LivPinkJulyEmmaLaraLupePizzaCheerDanceBrodyDaisyPurgeKarlaYellowWinterEasterLupitaLonniePicklesNutellaDrPeperShannonRicardoTacobellNovemberJeremiahCristianRootbeerBaptistaApplebeesChristmasEnchiladasLamornitasStrawberriesRiceKrispiesPandaExpress

SUMMER VACATION 2023-05-16

36 Items: junejulypoolbeachrelaxaugustbikingfamilyhikingsportssummerlotioncampingfishinghammockpicnicsreadinghotdogssandalsboatingbarbecueicecreamlemonadememoriesswimmingvacationsunshinegardeningpopsiclestravelingsunscreenflipflopswatermelonhamburgerssunglassesstrawberries

Unit 7 Medical Insurance and Coding 2019-10-22

30 Items: plancaregroupschargewaiverlimitedmanagedmedigapmedicaremedicaidindemnityinsuranceco-paymentdeductiblegatekeeperindividualcoinsuranceout-of-areacoordinationfee-scheduleeffective-datefee-disclosurepatient-statesgroup-insurancemember-providerdiagnosis-relatedmedicare-fee-scheduleparticipating-providerexplanation-of-benefitsloss-of-income-benifits

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

Understanding the Times - Philosophy (AC, AD, AE, LP, & AR) 2025-04-17

13 Items: justified true belief.the belief that reality is ultimately divine.the belief that reality is composed solely of matter.the study of knowledge, truth, and the nature of ultimate reality.the denial of the existence or accessibility of an objective reality.the study of the relationship between the mind and the physical body....

Here Word Search 2024-12-16

26 Items: VetoCabinetDemocracyDiplomacyFederalismImpeachmentBureaucracyTerm LimitsSupreme LawConstitutionSupreme CourtLandmark CaseBill of RightsThree BranchesElectoral VotesAge RequirementDirect DemocracyMajority OpinionFreedom of SpeechCommander in ChiefPopular SovereigntySeparation of PowersElectoral Vote ProcessRepresentative Democracy...

June 5-11 2023-05-13

24 Items: joylifeloveseeknisanfriendwisdomloyaltyhonestyjehovahprosperinherittogetherhezekiahpassoverhumilityholinessmarriagegatheringjerusalemof jehovahmotivationneutralityof Unleavened Bread

Unit 4 vocab 2025-11-21

19 Items: #BondbondbondruleMassrateanioncationproductreactionreactantcatalystreactionexothermicendothermicnomenclaturedecompositionof Conservation

Bailey & Justin's Search for Love 2025-11-18

22 Items: Where Justin worksBailey's maiden nameName of the best manJustin's middle nameNumber of bridesmaidsTheir favorite seasonColor of Bailey's eyesFavorite meal for bothTheir favorite NFL teamThe trip newlyweds takeBailey's cute dog's nameName of town they live inWhat month did he propose?Justin referee's this sportGroom's favorite college team...

6th Grade Bayou Bridges Glossary 2025-04-18

98 Items: lawsto imposeUnbearableto approvenot religiousmild or toleranta system of moneya chain of islandsto gather togethercoded or concealeddifficult to locateto grant or transfercruel, lacking mercyreduction in quantityto gain possession ofa branch of a religiona person who owes moneyto move goods illegallyrelease from enslavement...

Jesus’ Journeys 2025-12-13

12 Items: TombAngelHeavenCalvaryGabrielMichaelGolgothaSeraphimCherubimof OlivesStoneRolledof Gethsemane

Chinese Rulers, Dynasties, and Philosophers 2023-09-28

18 Items: The Shortest DynastyThe Last Dynasty of ChinaThe Last Emperor of ChinaThe First Emperor of ChinaThe First Dynasty in ChinaThe Longest Lasting DynastyThe Philosopher who Wrote The AnalectsBorn as a Peasant, but Became an EmperorA Philosopher Who Wrote "The Art of War"The Emperor Who Started the First DynastyThe Dynasty that was Founded in 202 B.C.E....

Mitosis And Meiosis 2024-08-08

17 Items: - The pairing of homologous chromosomes during meiosis.- Protein complexes that hold sister chromatids together.- The failure of chromosomes to separate properly during cell division.- The phase of the cell cycle where the cell grows and DNA is replicated.- The first stage of mitosis where chromosomes condense and become visible....

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

Skeletal System Word Search 2025-12-05

42 Items: Knee CapSolid boneCheek bonePorous boneMovable jointUpper jaw boneUpper arm boneImmovable jointMature bone cellBone building cellBone breaking cellBones of the wristBones of the ankleAny break in a boneConnects bone to boneVertebrae in the neckBone of the upper legSlightly movable jointOnly movable skull boneThe unit of compact bone...

Science Vocab Chapter 5 2024-01-16

14 Items: The SI base unit of thermodynamic temperature.The degree or intensity of heat present in a substance or object.A substance which doesn't readily allow the passage of heat or sound.The transfer of thermal energy from one physical system to another system.A natural process of heat transfer involving the movement of energy from one place to another....

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

A Tale of Two Cities 2024-05-10

26 Items: trotspilllumberrelishburiedinformshatterimaginedeliverentertainconstituteThe Shoemakerthe Golden Threadverbs found in ATOTCOwner of the wine shopthe mysterious messengerBanker from Tellson's BankTom's guard on the mail coachRecalled to this______________London and Paris are 2 of thesethe destination of the mail coach...

4th Grade Spelling 2025-09-11

11 Items: doubtdecidenervousseriousdecisiontomorrownecessarydisappearconquerorinterestinginformation

4th Grade Spelling 2025-01-21

10 Items: formmoresoarfourpouryourthornstormstoreboard

4th grade spelling 2025-10-28

10 Items: drawtowelpoweramountauthorcalmlynaughtyapplaudthousandmountain

Unit 5: Spelling Lesson 1 2023-01-12

25 Items: composed of onefoolish or sillyan eating establishmentcomposed of more than onea shortened form of a wordslanted cursive or type characterscomprising everything; comprehensiveconsisting of diverse things or membershappening as a minor result or by chancethat which had being before something elseuninfluenced by emotion; based on the factual...

PTE Arrangement 2024-09-09

20 Items: How many elements are there today?The periodic table have _____ rows.Elements are placed based on their what?Different types of atoms are called what?How many columns does the periodic table have?What is the first element on the Periodic Table?Each Row of the Period Table is called a ______.Periods represent the energy level of _________....

Maus Wordsearch 2025-05-15

20 Items: – The unified armed forces of Nazi Germany.– An organized massacre, especially of Jews.– The official secret police of Nazi Germany.– Yiddish term meaning "crazy" or "senseless."– Practical; concerned with the facts at hand.Mitzvah – A Jewish coming-of-age ceremony for boys.– A small house or cottage, usually single-storied....

Woodshop Vocab Word search 2025-11-24

25 Items: part of an inchA long guide on a toolProtected by a third wireHow accurate we want to beChange from one system to anotherthe large flat surface of many toolsA hand held tool that can cut curvesThe smooth round part of a drill bitThe ratio between real life and paperSitting around in class doing nothingPart of a tool that holds a drill bit...

The Word Search 2025-10-19

16 Items: WestZionto doSmithStormRefugeWitnessTithingMissouriChallengesSacraficesAdam-Ondi-Ahmanand Shine forthName of the Churchof the Twelve ApostlesChurch of Jesus Christ of Latter Day Saints

Digestive System Wordsearch!! 2025-04-02

15 Items: The process of swallowing is called?Pepsinogen is secreted by _____ ____?The eight front teeth are called _____?what is the root word for large intestinethe innermost layer of the alimentary canalSeptum dividing tongue into symmetrical halvesWhat is the excretion and elimination of wastes?The first part of the small intestine is the _____?...

Greta's Planet Wordsearch! 2023-12-18

20 Items: our galaxygives off lightwhen light bounces offsomething orbiting the sunMajor Latin name for big bearChris Hadfeild is one of theseA big ball of ice gas and rocka piece of rock still in spaceminor latin name for little beara group of stars making a picturea constellation making a big beara constellation making a little bear...

A Pound of Flesh 2024-11-11

24 Items: JewbondenvyhateloveangerenemygreedjudgeDucatsPortiaVenicevictimjealousAntonioShylockvillianof fleshBassaniomerchantChristianfriendshipmoneylenderMerchant of Venice

CHRISTMAS WORD SEARCH 2024-12-10

24 Items: JOYMARYJESUSADORECARDSANGELGREENMERCYLIGHTSOF GODMANGERJINGLEHEAVENEGGNOGSTABLESAVIORJOSEPHFAMILYSNOWMANOF PEACEPOINSETTANUTCRACKERHALLELUJAHGINGERBREAD

Challenger - Comet Vocabulary ALL - Word Search 2023-05-16

30 Items: The compactness of an object.To move in a circle or orbit around.The seven colors that make up white light.The title of elected US government officials.A group of stars that form a picture or a shape.The action of rotating around an axis or center.A comet that orbits the Sun in less than 200 years....

Renaissance word search 2024-10-08

15 Items: Had 6 wiveswrote 95 thesesof the archangelsbegan because tradeA painter and inventorThe hunt for "witches"The way of seeing peopleWhere the renaissance startedThe body of religious teachingsWas influenced by martin lutherTo make things smaller or largerMade one of the most accomplished sculptorsOne of the longest and brutal war in history...

Ch. 6 Rome 2025-11-06

15 Items: To block.Population count.Savior sent by God.Rapid rise of prices.To make fun of something.Plebeian elected official.Ruler with complete control.Members of the landholding upper class.to establish control over foreign land.Picture made form chips of colored stone.Bridge like structure that carried water.Supervisiors of Romes day to day business....

Advanced Science II 2023-02-28

25 Items: that are kept in poucheswhat type of organism is yeastwhat shark "bones" are made ofWhat is shed when you desquamateEarth's largest invertebrate animalfrom a Greek word meaning indivisibleCystitis is the infection of what organWhat is the only venomous British snakeThe per capita birth rate of a populationPlant Kingdom group with species of Mosses...