4th of july Word Searches

jogos 2025-04-15

19 Items: fifahalomariosoniczeldaportalrobloxcrysismegamenfortnitefreefireelden-ringgod-of-warsubnauticadonkey-kongbrawl-starsnico-nextbotsstreet-fighterworld-of-warcraft

Madhubani Wordseach 2023-07-19

18 Items: Madhubani painting were made duringWhich Madhubani motif symbolises fertility?Which flower is used to create the orange colorMithila Museum is located in this part of JapanHow many styles of Madhubani paintings are thereMadhubani was originally painted on which surface?In Madhubani paintings, Lotus is a symbol of which gender...

4th grade vocabulary 2021-01-29

10 Items: eatknitwearringplaywantenjoytravelborrowpractice

Environmental Science 2025-05-15

20 Items: ALBEDOTRAGEDYCONVECTIONCORALREEFSBIODIVERSITYWater that is safe to drinkCost-benefit analysis involves ___ assessmentDeepwater ___ spill made front page news in 2010Storing rainwater is one method to ___ freshwaterthe transfer of energy as heat through a materialLakes that create an abundance of nutrients are __...

The Rutherfords 2025-06-29

10 Items: Where did we meet?Name of the best man.Month of the wedding.Month we got engaged.Who was first to rsvp?Colour of the wedding.Second name of the groom.Name of the maid of honor.who made the wedding cake.What type of suit is the groom wearing?

yay 2023-03-20

26 Items: a piece of hardwarea voltile memory storagethe brains of the computerwhat the computer puts outthe little square on photossomething that is programmedinside the CPU to process datathe same as solid state storageused in the resolution of photosa way of storing quick use memoryhow to give power to the computersomething made using computer logic...

paiges wordsearch 2023-12-18

19 Items: a soundour galaxywhat we live onwere we live inthe study of the universeknown as the little dipperthe belief on constellationsare stars of youre birth monthcontellation of the northern skywere a planet goes around the suna rock that falls from earth to spacelumps of rock or iron that orbits the suna big constellation that looks like a spoon...

Rock Word Search 2024-11-13

26 Items: - A use or marble.Mountains - Where Granite is found.- What is a common sedimentary rock?- What type of rock is coal classified as?- What type of rock forms from cooled magma?- What are limestone and sandstone used for?- What is an example of an intrusive igneous rock?- What is an example of an extrusive igneous rock?...

IRS Puzzle 2024-12-17

25 Items: M in MIR stands forThesaurus stands for ________A video consists of a sequence ofweb scale discovery services provide?A search system is called a __________ system.the process of removing stop words from a query?Information System Consists of __________ programsimilarity between two vectors by measuring Angle?...

Ms. Lynch's 4th Grade Class 2025-05-13

18 Items: AbelJanaJaseLuisHarryIsaacJacobLyrikRamonRandyRiverCarterKaidenKeilynJasmineMsLynchIsabellaPrinceton

Let's play! 2024-10-08

35 Items: mayonesixtentwofivefourjulyjunenineaprileightmarchseventhreeaugustautumnelevenfridaymondayspringsummersundaytwelvewinterjanuaryoctobertuesdaydecemberfebruarynovembersaturdaythursdayseptemberwednesday

Presidents: James Madison - Word Search 2024-10-10

35 Items: WarJulyMindAltarTermsDesignEstateLawyerUnitedCollegeFreedomLibertyTyrannyWilliamAmericanCongressGovernorMovementPurchaseShadwellVirginiaWritingsEducationJeffersonLouisianaPoliticalPresidentSecretaryMonticelloPlantationUniversityDeclarationIndependenceRevolutionaryCorrespondence

Nick&Jess 2024-08-26

40 Items: Best Man's nameTheir first dateThe couple's dogBride's middle nameFather of the GroomFather of the BrideThe Groom's hometownMaid of Honour's nameHoneymoon DestinationThe Brides professionDating app they met onGrade Jess is teachingNick's favourite storeBride's birthday monthNick's favourite hobbyJess's favourite hobbyThe month Nick proposed...

Pathophysiology - Ch. 15 + 16 Terms 2024-11-05

20 Items: Double visionBlood glucose levels riseParalysis of the upper eyelidA ringing or buzzing in the earsExcessive thirst caused by dehydrationExcessive amounts of ketones in the bloodActivated by a change in chemical concentrationInvoluntary, abnormal rapid movement of one or both eyesStimulates appetite; lack of nutrients entering the cells...

Year 7 so far! 2023-05-26

28 Items: Organelle that contains DNA (n)The smallest unit of matter (a)The force caused by gravity (w)Multiple atoms bonded together (m)Different atoms bonded together (c)Used to separate soluble solids (c)Change of state from solid to gas (s)Type of energy linked to movement (k)The unit of measurement for force (n)Change of state from gas to liquid (c)...

Askiathegreat Word Search 2024-10-04

21 Items: Africa's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from AlexandriaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacevast tract of land characterized bywet and dry seasonsthe world's longest and second deepest freshwater lake...

Elementary Vocab 1 2024-03-04

20 Items: 一月一百一些一個一個一起七十七月T 恤(大)船...的...點鐘一雙、一對(短程的)旅行room (家裡的)餐廳1. 也;2. 太...1. 大約;2. 關於...1. 年紀、年齡;2. 老的

Lines Word Search 2024-07-30

13 Items: Chest tubes are also referred to as.Oxygen makes up what percent of atmospheric gases?Name the condition of decreased oxygen concentration in the blood.what tube does not require verification of placement by radiography?Which type of catheter is the most common cause of nosocomial infection?...

Biology Word Search - Kiki 9b 2024-06-11

15 Items: the coloring in a leafa reagent that tests a leaf for starchA part of a plant that attracts pollinatorsA part of a cell that supports and protectsA part of the vascular bundle that carries waterAn organ that is responsible for transport in plantsthe product of using iodine on a leaf after photosynthesis...

Property & Commercial Insurance Terms 2022-07-06

20 Items: rateperilbaileehazardpremiumrobberyindemnifyvandalismThe chance of lossThe date on which a policy endsLegally binding contract of insuranceA request by an insured for insuranceA person entrusting goods to another.Risks, perils or properties defined in the policy as not covered...

Engineering Words 2024-09-27

20 Items: Body of an aircraftknowledge of any kindanother word for ramphow the universe worksforceful or rough forcespeeding up of an objectsudden stoppage of motioncan hold or lift an objectforce of any object with massa study that focuses on numberssome thing that uses air to ratatepushing pulling or moving somethinga group of simple engineered sytems...

Mrs. White's 4th grade class 2023-05-18

30 Items: k12tallmathlsoadogscatsshortsmartfunnyhappystaarfifthfriendsummerkahootgimkitfourthmoviesonlinecameraenglishscienceblooketexcitinglearningsunshinecomputerswimmingsocialstudiesiwillmissyousomuch

Coming Distractions- Lesson 7 (4th) 2023-10-01

20 Items: puttoolwoolbushhookroofsoupbloomstoolproofprovegroupbrookboothgroomshampoofoolishcrookedraccooncookbook

lesson 20- Sacagawea (4th Grade) 2024-01-19

20 Items: lumberpepperborrowthirtyattendcanyondangersoccerengineseldomeffortmillioncollectplasticsupportperfecttrafficfortunepicturesurvive

4th Grade L8 Spelling Words 2024-02-06

20 Items: preyonioncableankleslowlysquashcarrotjunglepuzzledimplelettucespinachcrumblefreckleknucklehabitatimitatesprinklepredatorcamouflage

L1 Word Search - 4th Grade 2024-06-17

20 Items: oxenspeedcatchrolledfingerexceptelevenitselfstolenbuttonorphanbargaincertainopinioncompassequatorcouldn'tlatitudeabsolutelongitude

L12 Word Search - 4th Grade 2024-07-07

20 Items: goalslidecoachshownblownbrassswingsbecameviolinpasturelecturemixturemoisturepunctureadventuresculptureconductorliteraturepercussioninstruments

Mrs. Winston's Fantastic 4th Graders 2024-08-07

21 Items: LucaJackWillCadeAsherBellaCalebTitusParkerTenleeCollinHannahKenzieHarperGraysonBradleyJacksonNeylandWilliamSavannaCaroline

Mrs. Welch's 4th Grade Class 2024-08-09

28 Items: IsaRyanDejaFinnJannaMicahFelixKensiTavinBryceSarahRyderChloeEmeryHarlowAlisonHunterPeytonKhylanGabrielKinsleePrestonJasreenCharlieAnnaliseBenjaminEmilianaCharliegh

Mr. Daniel's 4th Grade Class 2024-08-11

28 Items: LilyKaliKobyBryceRileyPeytonMeliahJustinJasiahSheilyColterMorganDallasJaydenTaylorZacheusCedrickJasmineJohonnaCameronBhushanRichardCharisseMarcelloChristianBenny-RayElizabethSebastian

Ms. Wylie's 4th Grade Class 2024-08-12

24 Items: GiaJaceLucyDemiLucaAriaCaliJaxonLoganWylieArooshElijahLandonLandryEverlyNathanDraganCatelynMagathiBraydenVictoriaHridhaanPriyankaVaishnavi

Miss Donsbough's 4th Grade Class 2024-08-12

26 Items: IvyLeoLiamWillLeviRoseKateCoraGrayEthanElenaEllieAminaCarsonConnorJosephLawsonMilanaSophiaDeniseMakenaSophieKennedyKendallDanieleFletcher

Our 4th Grade Class Family 2024-08-20

33 Items: MiaJackOonaAlexAriaLillyJamesJesseMasonDylanEthanColinSioneOliviaAadenBOliverPhilipAidenDGeorgeAshtonAidenLAndrewZacharyAudrinaElliottJoaquinCassidySavannahGraziellaAlejandroSebastianBSebastianSAlessandra

Day 1 in 4th grade 2024-08-23

30 Items: BellExpoTeelChairTimerVinylMusicRecessPencilmarkerEraserLeaderTeacherStudentCrayonsTimbersBackpackScissorsLunchbagPaintingMarinersClassroomGluestickCafeteriaHaverkostplaygroundHighlighterSaintHelensFourthGradeRecordPlayer

Mrs. Lackas' Awesome 4th Graders! 2024-08-30

25 Items: CJAyahOwenElanWillLiamSurajMaddyLucasArnavOscarJuliaMicahHenrySamiraSophieAyeshaBrooksElianaSophiaShravyaMariamaDivyanshMichelleGabriella

Mrs. Kerber's 4th Grade Class 2024-08-31

23 Items: EmmaJadaSageBethTylerCalebJaxonParkerHarperDanielDakotaKalynnHunterAdalynAislynJosephCalvinJamisonYulianaBrilynnKennedySullivanNickolas

4th Grade Spelling Bee Words 2024-11-14

50 Items: murkyquillpatiowagonsmocktingedodgymotionterrorbraidscastlewrenchindeedstifledimpleharboruproarseveresuperbgrovesharvestcostumegerbilsvillagebrothermistakereunionballoonpromiseexactlytwinklesnickerstumblenaturalbanditsoutcomeghostlybiologycaptivejumblednaughtycrittersnonsensechampionconvincespeckledWednesdaychildhoodstreamershopscotch

Who's who in 4th grade! 2025-01-14

52 Items: beejohnwillwolfalexemmaarlojunelolanaomijosietrippcourthelencalebrowansimongracepippaalicebryanrykerelliekrebssesinameliewintonmatteobrookszakzakdrukmodeclancamdendaphnemorgantruittmurraywilderisabelhuntermillerconnorwilsonkeelercoopermaxwellfrancesbarclaywilliamwaverleymeredithmontgomery

4th grade Vocabulary Unit 7 2025-03-08

25 Items: damflowpipepondwellhosepumpdrainflushplantbanksfloodhumidvaporsteamfaucetbucketcanalsdroughtirrigatebacteriareservoirpracticalrespectedadvertising

1st and 4th Grade Leaders 2025-03-19

45 Items: MiaIanRushEvanKingAbbyEllaRyanMicahAbnelKarliTarynJasonZakaiCohenTy'ellRichieBrycenJaydenAhnestJustinLawsonJaydenSawyerChanyaThomasJordanJalaehKanylaElijahRaelynnNataleeJa'SiahCamilleErlindaTristanAddisonMadisonOpheliaJanelleMarceloPenelopeCharlestynChristopherChristopher

4th Grade Year 2024-2025 2025-06-02

24 Items: LeoAlmaalanHazelNaomiDanaeJosueDanielMailenBraianMoisesGothamCamilamanuelIsraelJulianHNatalieJulianRAnthonyGianninaJenniferIsabellaVictoriaMrsSolorio

Spelling List #4 - 4th Grade 2025-06-10

20 Items: diecryslyshyspymindpiessighkitefilewipelinetimeclimbpridealiketwiceflightinsideminding

Spelling List #5 - 4th Grade 2025-06-10

20 Items: owntowwoeboltmostmoldflowknowmowsmolesolewokegoalfoamlowerstonestovechosestolegroan

4th/5th Explorer Club Kids 2025-06-26

68 Items: ZoeKruMiaGwenGabeEzraSnowEmmaIzzyAddyTamiBevaEllaEvanLeviLilyMaxxOwenBeauJacobAidenMeeyaAveryAidynRowanNolanSullyEthanHenrySilasFionaOzzieWillaAkselAidenAsherJennyLandonDakotaEastonIsayahCarterCaydenSophiaParkerAmeliaBrennaOliverLilithHaydenTybaltJulianHarperKillianCadenceCharleyMerrittEverettTristanBrixtenScarlettFletcherHumphreyVivienneBrooklyn...

No Fixed Address Wordsearch 2024-12-13

17 Items: Felix's new friendA piece of writingUsed to add flavor to foodTo solidify, mostly by coolingThe main character in this storyA french delicacy, made of snailsShowing or feeling common emotionsResembling a palace, being spaciousThe act of giving back what was owedMake things seem better than they areA large problem, a time of intense difficulty...

Medical Term Ch 2 2024-01-17

16 Items: Out ofWithinControlThe study ofA specialistGrowth or formationThe study of diseaseCondition produced by diseaseCommonly known as belly button or navelA disease producing microorganism such as a virusProvides protective padding, insulation, and supportThe basic structural and functional units of the body...

Chromatography Word Search 2024-08-15

20 Items: Fluid exiting the columnFluid entering the columnThe result of overloadingA measure of peak separationStationary phase lines the columnStationary phase fills the columnRequires a low volatility analyteConstant mobile phase compositionDetector signal vs. retention timeTime from injection until detectionRatio of retention time between peaks...

Dynamics Word Search 2022-06-18

98 Items: machohmspowervoltsrangetensioninertiavoltagecurrentamperesammeterdynamicscircuitsvectors-distancenet-forceradiationhalf-lifeharmonicsohm’s-lawvoltmeterkinematicsbeta-decaysoundwavessupersonicresistancemax-heightforce-fieldlatent-heatatomic-massalpha-decaygamma-decayreflectionswavelengthselectricitynormal-forcetrigonometrydisplacementacceleration...

Clay's Vocab 2023-09-26

23 Items: made a choiceto show clearlycontaining nothingyoung cows or bullsa quantity of somethingto form a mental pictureto total numbers togetherreflection of sound wavesa way to get into somethinga value that does not changea breaking of a law or promisedownward measurement from a surfacea sweet, brown food that is made from cocoa...

Law 2024-01-19

20 Items: physicalpersonCreator of the "eye for eye" theoryThe name of the Codex for Civil lawSince we are born we have certain ...Basic unit of a legal system is a .....Meaning of the sword Lady justice holdsCopyright lasts for ... years after deathOnly one legal system in place is called...the state of being legally and officially true...

unit 9 2024-05-01

20 Items: another name for petroleuminclude coal, oil, natural gasmost common form of hydro powergas cleanest burning fossil fuelsmall bubbles of NG trapped in iceany organic materials, including wastessomething that doesn't occur continuouslyusing a fuel for both electricity and heatareas with consistent wind with many turbines...

M3 Parts of a Flower 2023-09-04

14 Items: the male gamete of a flower.Tough outer coat of the seed.Sweet, sugary fluid found in flowers.Part of the flower that stores pollen.Type of organ flowers are to the plant.Colorful part to attract insects and birds.Part of the flower that holds up the anther.The place where the male and female games fuse....

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Askiathegreat Word Search 2024-10-04

27 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Central Nervous System/Trauma 2024-01-03

16 Items: Penetrating chest trauma could lead to aType of stroke makes up 87% of all strokesThe most common type of primary brain tumor.A fracture that heals in a faulty position is termedOutermost layer of the meninges and is tough and fibrous.What imaging modality is best utilized for skeletal trauma?...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Eggnog, Word Search 2024-11-26

35 Items: Where does Santa Claus supposedly live?What is the innermost part of the Earth called?What is the outermost layer of the Earth called?Mountains, Where in Ireland can you find granite?What is molten rock on the Earth’s surface called?Where in Northern Ireland can you find basalt columns?What is molten rock beneath the Earth’s surface called?...

Ambassador Word Search 2025-04-21

17 Items: Actionof Management and BudgetA group of presidential advisersan intentional disclosure of something secret or privatea formally concluded and ratified agreement between countriesSecurity Council a group of high-ranking government officialsthe action of forgiving or being forgiven for an error or offense...

Vegetable Production Unit 19 2024-10-01

17 Items: soil.other organisms.to wholesale markets.— the cultivation of vegetables.(monocot) — plant with one seed leaf.(dicot) — plant with two seed leaves.— an area deficient in rainfall; dry.— removal of heat by immersing in cold water.— plants grown from seed in special structures.— an area partially deficient in rainfall; dry....

WH40K 2024-06-04

100 Items: - The Chaos God of war, blood, and skulls.- The Chaos God of change, fate, and sorcery.- The Chaos God of excess, pleasure, and pain.- The Chaos God of decay, disease, and despair.- The heavily armored suits worn by Space Marines.- The immortal ruler and psychic beacon of humanity.- A versatile combat exoskeleton used by T'au warriors....

Random Words Game (July 2022) 2022-07-05

13 Items: okrbipoequityqualitybrownbagintegrityinnovationefficiencydatacentriccornerstoneatomeesbuzzpeoplecentriccustomercentric

jacob 7th grade 2024-05-16

15 Items: a group of living organismsthe variety of life on Earthis defined as the number of different species.a large naturally occurring community of floraa large open area of country covered with grassa state of balance between continuing processes.is a hot, moist biome where it rains all year longabandon in a way considered disloyal or treacherous....

Tourist Destinations 2024-09-16

15 Items: The Big AppleThe city of loveThe eternal cityThe city that never sleepsHome of the Sydney Opera HouseThe capital of the United KingdomBirthplace of Western civilizationFamous for its canals and gondolasThe city divided during the Cold WarFamous for its skyscrapers and luxuryKnown for its houseboats and bicyclesWhere the Pyramids of Giza are located...

Unit 4: Spelling Quiz 3 2022-12-16

30 Items: an advantagepeacefulnessunintentionalto make worseaccountabilityentirely; completelyfeelings of sympathyimpenetrable by lightat every time; foreverone of the United Statesto accept as true or realone half of a school yearthe quality of being calmright fine; satisfactory; goodone who is sent out on a missionthe principle of life; vigor; energy...

A Long Walk to Water 2024-12-05

25 Items: - very large or immense- extreme scarcity of food- empty, lacking vegetationrepeated or reflected sound- a shortage or lack of something- in the middle of; surrounded by- to speak softly or in a low voice- walked slowly and with heavy stepsa time of intense difficulty or danger- unyielding; persistent in a harsh way...

Days of the week/ 6 months 2025-01-29

13 Items: mayJulyJuneAprilmarchMondayFridaySundayTuesdayOctoberThursdaySaturdayWednesday

Lunes Word Search 2025-01-29

13 Items: mayJulyJunemarchmondayFridaySundayaugustTuesdayJanuaryThursdaySaturdayWednesday

S 2025-01-29

13 Items: JuneJulyAprilMondayFridaySundayTuesdayJanuaryThursdaySaturdayFebruaryWednesdaySeptember

Days and months 2025-01-29

13 Items: mayJulyAprilMondayFridaySundayTuesdayJanuarySaturdayThursdayFebruaryWednesdaySeptember

yada yada 2025-01-29

13 Items: MayJuneJulyMarchaprilMondayFridaySundayAugustTuesdayThursdaySaturdayWednesday

Endocrine System Word Search 2023-04-07

20 Items: promotes constructive metabolisma hormone produced in the pancreasa body system that produces hormonesthe human bodies main source of energyan excess of glucose in the bloodstreamdeficiency of glucose in the bloodstreama medication that treats type 2 diabetesa hormone produced by the pituitary gland...

Griffith Observatory Glossary 2023-11-14

20 Items: a fluid state of matterthe study of space & everything in itthe layer of gas that surrounds Earththe 6th element & chemical basis for lifea place for observing & studying objects in spacea pure substance containing only one type of atoma celestial body of gas that generates light & heata zone around a star where temperatures are just right...

Renew Word Search 2024-02-23

20 Items: Land of the Long White Clouda position giving a good viewpersist in an activity or processsuppose to be the case, without proofresume (an activity) after an interruptiona particular sphere of activity or experiencethe state of being united or joined as a wholemake smaller or less in amount, degree, or size...

August Word Search 2025-06-02

20 Items: First dateHe loves youMonths togetherName of the priestGabriela's birthdaySébastien's best manGabriela's home townHoneymoon destinationSébastien's home townLocation of engagementGabriela's new surnameSébastien's middle nameMonth Sébastien proposedGabriela's Maid of HonorCity of first shared homeWho said I Love You firstWhere the couple first met...

4th Grade Vocabulary Words 2022-02-10

14 Items: defyvasteagertauntbrutalcomplexdeclineparchedrivalrycollapseshortagebountifulnegotiateboisterous

kassidys word search 2023-12-18

18 Items: big bareSmall bareshoting starare universespace reserchersgive off or glowa sistem of starscontalashon beliefwe are on ---- earthIcy body that releases gasespeace of rock still in spacesomeone that "lives" in spacelight bounceing off something12 hours of day 12 hours of nightthe moon is stuk in the earths ...longest or shortest day of the year...

MESOPOTAMIA 2024-09-28

16 Items: GULFRIVERTIGRISFARMERSODYSSEYCRESCENTOF BABELZIGGURATCUNEIFORMEUPHRATESHAMMURABIGATHERERSSUMERIANSPOLYTHEISMOF HAMMURABINEBUCHADNEZZAR

Coronation word search 2023-04-30

13 Items: The dog of royaltyThe King's first nameOne of the King's sonsThe name of the King's mumThe month of the coronationThe age of King Charles IIIThe name of the King's wifeThe city that the king lives inWhat the king wears on his headThe event that happens to crown the kingOne of the colours on the Union Jack flag...

Respiratory System Word Search 2023-12-20

17 Items: Pleura that lines the thoracic cavityEarly pulmonary tuberculosis is usuallypleura that adheres directly to the lung tissueCystic fibrosis is classified as a(n) __ diseaseFormation of a cavity within the lungs as a result of TBPleural effusion is considered a(n) __ pathologic conditionThe gas exchange between the lungs and the circulatory system...

Atom Word Search 2024-07-18

12 Items: Genetic materialBasic unit of matterBuilding block of lifeNerve cell in the bodyForce attracting objectsTest to prove a hypothesisStudy of matter and energyChange in species over timeCommunity of living organismsGroup of atoms bonded togetherProcess plants use to make foodStudy of substances and reactions

Word Search - French Revolution 2024-10-14

11 Items: Lowest estateStorming of the...The highest estateHighest class groupThe wife of the kingThe king of France was...Nuns, Priests are apart of the...Second highest from the top estateNot nuns, but apart of the nobilityThe main name of the revolt in FranceLowest class of people/the ones who did all the work

Dani 2nd Grade Spelling (18) 2014-01-28

35 Items: dopayowneyebuytootwoawaytheyeachbothknowgoesfindhighjulymeetmeatweekweaktrainwhalegreatcleanteethsheepbeachfloatlightoceanthrewpeopleraisinbehindbetween

Corsica Word Search 2023-11-24

18 Items: 1821: Died on May 5th on _____.1809: Defeated _____ at the Battle of Wagram.1804: Crowned himself _____ of the French.1769: Born on August 15th in _____, France.1785: Graduated from _____ academy in Paris.1793: Distinguished himself at the Siege of _____.1799: Led a _____ and became First Consul of France....

Crust Word Search 2024-11-15

25 Items: - What drives the movement of tectonic plates?- Where do most earthquakes and volcanoes occur?- What is the innermost part of the Earth called?- What is the outermost layer of the Earth called?- What forms when magma reaches the Earth's surface?- What is the layer beneath the Earth's crust called?...

Industrial Revolution Vocabulary 2025-03-20

22 Items: Goods are made by hand in homesProduction of items using machines.To send items to another country for saleAn official ban on trade between countriesA system of money used in a specific country.Relating to farmer and small town ways of life.Goods are mass produced in factories by machinesMaterials in nature which are used to produce a good...

Week 8 Thursday 2023-10-06

25 Items: course of studyTo buy somethingMario's occupationWorthy of attentionwritten communicationto support with evidenceHappens at the same frequencyBelonging to a particular personFirst in the order of importancea math sentence with an equal signA number that is not a whole numbersharing an edge or boundary; touchingConvert waste into a reusable material...

Vocab: Manifest Destiny 2025-03-21

15 Items: Gold-seeking migrants who moved to California during the Gold Rush.Railroad Railroad built to span from Omaha, Nebraska to Sacramento, California.Trail A 2000-mile trail stretching through the Great Plains from western Missouri to the Oregon Territory....

General anesthesia and monitoring 2025-02-05

34 Items: flatlineonly measure SAPmeasures SAP, DAP, and MAPthe number of ET tube sizes to choosepressure remaining during resting phaseaverage pressure during the cardiac cycleET tube: largest possible but not to tightdoppler needs a cuff attached to a _________partially collapsed alveoli due to shallower breaths...

Annie's Surprise 60th Birthday Party! 2025-01-25

18 Items: Annie's maiden name.One of Annie's first jobs.Annie's favorite music genre.One of Annie's favorite candy.Country in Europe Ann has visited.Vehicle Nate is building for Annie.One of Annie's favorite things to do.Current dog's name (shared with Nate).Annie's summer occupation in childhood.One of Annie's favorite childhood candies....

SOL 7: Word Search 2023-12-04

11 Items: Our state's highest courtThe highest court in our nation (the U.S)This is the name of the state's legislative branchThe leader's position of the state's execute branchThe second in command of the federal executive branchThe second in command of the state's executive branchThis is the state's version of the House of Representatives...

Fred and Rosemary West 2025-02-05

11 Items: The fate of Fred WestThe maiden name of Rosemary West.The name of Fredrick's second daughterThe city the couple's crimes took place.Part of the punishment Rosemary West received.The name of Fred's first wife and eventual victim.The full name of the lead detective of the West Case.The job that Rosemary took up after getting with Fred....

Days, Months, Celebrations 2025-05-22

11 Items: First day of the week.The day you were born.Last month of the year.The beginning of spring.The start of the weekend.The last month of summer.People go to church on the day.The day of love with chocolate.A holy celebration with presents and Santa.Resurrection of Jesus, egg hunt and bunnies.Spooky, monsters, ´trick or treat´, costumes.

STARR Vocab Word Search 2023-01-24

37 Items: without awarenessa hostile challengea state of adversitystrengthen and supporta feeling of extreme joya feeling of evil to cometurn aside; turn away froma feeling of intense angerdepriving one of self-esteema longing for something pastextreme distress of body or mindmarked by deliberate deceptivenesscause someone to believe an untruth...

Ocean Motion 2025-04-01

23 Items: Ocean waves areThese ocean bulges are known asEach particle moves up and down called anThe area of ocean away from the Moon are the_______________ waves need a ________________Currents flow in the shape of the basin called- When a wave reaches shallow water, it slows downaffect water up to a depth of several hundred meters....

The Reign of Fulk 2023-04-19

12 Items: Captured from Fulk by ShamsSite of covent built by MelisendeCoastal town controlled by Hugh IIRecipients of the castle of BethgibelinMarried Pons’ son, Raymond II of TripoliNew governor of Damascus eager to work with FulkForced to stay in Latakia after being ousted from AntiochConstable of Jerusalem chosen by Melisende after Fulk’s death...

Mont: Y9 Area Conversion/Area of 2D shapes 2023-09-08

17 Items: A three-sided polygon.A rectangle with all sides of equal length.Units of measurement based on the metric system.Shapes that have two dimensions - length and width.A mathematical relationship or rule expressed in symbols.A part of a circle enclosed between two radii and an arc.A four-sided figure with opposite sides equal and parallel....

physical science 2025-03-10

18 Items: gaslawpointpointboyletheoryplasmaliquidelementbuoyancypressureof fusionexpansionof motionviscositysublimationhetrogeneousof vaporization