4th of july Word Searches

4th Grade Phonics 2020-11-15

15 Items: bugcuprungumsungunfunrugpugnutmudbuntubdrumbutter

4th Grade Afterschool 2024-11-20

15 Items: NalaEvinJimmyCamilaElijahYutingJoscyahZariyahLa'NiqueMuhammadCatherineChristineSeilynnahValentinaJohncarlos

4th Grade Rocks! 2025-08-11

15 Items: ThyAleJackLucyEviePabloJacobEthanDanielAmeliaLillianBraydenAnabelenIsabellaChristopher

Colorful Calendar Connections 2025-01-04

59 Items: MayPeaRedOpalJuneJulyRoseLilyAquaPinkRubyNavyGrayPearlTopazMarchAprilDaisyPoppyAsterGloryHollyGreenBrownGarnetAugustVioletCosmosPurpleOrangeSilverDiamondEmeraldPeridotJanuaryOctoberJonquilSeafoamAmethystSapphireFebruaryNovemberDecemberSnowdropPrimroseDaffodilHawthornLarkspurMarigoldRubyStoneTurquoiseSeptemberCarnationGladiolusNarcissusAquamarine...

Government 2025-10-23

16 Items: lawsmayorrightsjudicialgovernorof rightof powercongressexecutivepresidentpresidentcompromiselegislativeconstitutionresponsibilityof representitives

Light - Reflection and Refraction 2025-04-22

31 Items: light-rayreal-imagefocal-pointconvex-lensray-diagramfocal-lengthincident-raylens-formulaconcave-lensstraight-linevirtual-imageconvex-mirrorreflected-rayrefracted-raypower-of-lensconcave-mirrorprincipal-axismirror-formulaoptical-centerimage-formationprincipal-focussign-conventionspherical-mirrorrefractive-indexlateral-inversionangle-of-incidence...

Darker than Black  2016-03-09

27 Items: HeiMaoYinBaiWeiJulySuouMakiMinaXiaoHuangAmberAprilHavocShionDollsBritaGeminiMisakiŌtsukaBerthaAmagiriHellsGateNovember11ContractorBlackReaperHeavensGate

fabric 2025-12-10

26 Items: MayDayJuneJulyFallTimeDateWeekYearYearMarchAprilMonthAugustSpringSummerAutumnWinterJanuaryOctoberWeekdayWeekendFebruaryNovemberDecemberSeptember

Onomatopoeia Word Search 2025-09-29

20 Items: An example of blendingCompounding break+fastAn example of compoundingAn example of foreclippingShortening the end of a wordStudy of the meaning of wordsTaking words from another languageA word borrowed from India (Hindi)Words that imitate sounds are calledCombining two words to make a new oneUsing part of a word to form a new one...

Basic EKG Terms 2025-07-08

19 Items: irregular heart rhythmtop chambers of the heartthe pacemaker of the heartbottom chambers of the heartheart rate of less than 60 bpmpertaining to the heart muscledemonstrates contraction of atriaheart rate of greater than 100 bpmatria quiver; high risk for strokeHeart is located on right side of chestmarks to evaluate size of cardiac complexes...

Biology final review 2022-12-15

24 Items: Center of cellBasic unit of lifeNegatively charged ionsolute is dissolved inIndividual living thingconcentration of H ionsProduces hydroxide ionsSubstance that dissolvedforms H ions in solutioncontains one type of atomDiffer in number of neutronsEvenly distributed componentsSmallest functional unit of lifeElectrons are shared between atoms...

Couples wknd 2023-03-19

15 Items: Mr. FailsMr. HoldenMr. WillisMrs. FailsMrs. HoldenMrs. WillisMr. CrawfordMr. CatchingsMrs. CrawfordMrs. CatchingsSince Feb 1994Since Sept 1992Since July 1987Since July 1994Since June 1992

4th Language Foundations 2024-09-30

16 Items: tankmaskslinkflockslicksmackgrillcrampcrookblimpclothrabbitmuffincontestpadlockfootpad

4th Grade Spelling 2024-11-20

16 Items: payworewearkeptkeeppaidkneltkneelsleptsleepspokespeakstoodstandcreptcreep

Guitar Word Search 2025-06-30

7 Items: LakeJulyBibleGuitarJoyfulPepperPinterest

colors 12-word search 2023-03-15

12 Items: the color of nightthe color of grapesthe color of tangerinesthe color of a dandelionthe color of a snowflakethe color of strawberriesthe color of a tree's trunkthe color of lips of a babythe color of the Mediterranean Seathe color of a cloud during a stormthe color of the sky in good weatherthe color of leaves in spring and summer

Catch! Teenieping 2025-03-18

37 Items: IanJunKyleSarahKoreanLalapingHappyingJoahpingMaskpingNanapingTruepingDrMonziuTrustpingLuckypingHeartroseJellypingSweetpingTangypingHeartKingGigglepingTeeheepingFluffypingShashapingHarmonyTownQueenStellaQueenBelitaTeenieCatcherOkeydokeypingSugarBerryPactEmotionsKingdomMysticHeartWingJewelHeartWingPhoneThe Teenieping of loveThe Teenieping of Hope...

Christmas Words # 2 2024-03-04

40 Items: joyonespinelovespellaromatreestreesClausseasonheartsmelodywarmthlightssmilesseasonlightsgivingsmilesessencefestivemagicalcinnamonfamiliesornamentserenitymemorieschristmasof givingmerrimentnostalgiaaffectionsnowflakesgracefullytraditionsenchantmentof Memoriesof nostalgiaof affectionof traditions

LS-4-1 Unit 3 Lessons 1-3 Evolution and Natural Selection 2023-10-24

19 Items: early pre-birth stage of development.total DNA present in the nucleus of each cellheredity changes in groups of living organisms over timeanything that has or once had the characteristics of lifecarbon compound joined by peptide bonds; building block of proteingroups of individuals of the same species that live in the same area...

Gingivitis Word Search 2025-10-01

25 Items: An area of pathology.The study of disease.Medical term for a bruise.Inflammation of the tongue.Inflammation of the gingival tissue.Malignant tumor in epithelial tissueReferring to the area below the gingiva.Referring to the area above the gingiva.Closed cell or pouch with a definite wall.Malignant disorder of the lymphoid tissue....

Harry Potter Wordsearch 2023-09-26

16 Items: ronscarStonePotterMalfoyPrinceof FireHallowsKnow Whohogwartshermionegryffindordumbledoreof Secretsof Azkabanof the Phoenix

Important Word Search 2025-11-10

25 Items: MayMoonWolfMeltWormSnowJuneJulyshineTrailShapeNorthMarchAprilNativeSpecialHarvestQuarterJanuaryFebruaryNovemberDecemberImportantStrawberrySeptember October

Science Vocabulary Word Search chapter 11 (Lin) 2024-05-07

37 Items: Water in the form of a gasThe distance above sea levelA device that measures wind speedA device that measures temperatureThe inner layer of the ThermosphereThe outer layer of the thermosphereWinds that blow over short distancesThe outermost layer of earth's atmosphereAn instrument used to measure air pressure...

DNA Structure 2025-03-10

16 Items: the scientist who took Photo 51the twisting ladder shape of DNAthe name of the sugar molecule in DNAthe abbreviation for deoxyribonucleic acidone of the bases in DNA that pairs with Adenineone of the bases in DNA that pairs with Guanineone of the bases in DNA that pairs with thymineone of the bases in DNA that pairs with cytosine...

Grandma's Birthday- Find the words to unlock your birthday surprise 2025-06-07

15 Items: After the factFour minus oneStay a short timeThe opposite of sadAn annual celebrationA place to come and goThe country Lauren livesA mode of transportationThe state in which you liveA device to carry belongingsThe seventh month of the yearA traditional game that involves diceThe absolute best feeling in the world...

Damanuel 2025-11-11

12 Items: The god of warThe god of loveThe god of fireThe god of musicThe god of the seaThe god of lightingThe god of celebrationThe messengers of godsThe god of war and wisdomThe god of animals and huntingThe gods of fields and farmingA person who can speak to gods

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

Birthday puzzle 2025-06-14

6 Items: LesJulyTicketsWenesdaySixteenthMiserables

Rachel & Matthew 2024-07-18

20 Items: THEIR OCCUPATIONTHE APP THEY MET ONBRIDE'S MIDDLE NAMETHEIR FAVOURITE FOODNAME OF THE BEST MANTHE NAME OF THEIR DOGCOLOUR OF GROOM'S EYESTHE MONTH MATT PROPOSEDTHE NAME OF THEIR STREETA SPORT THEY PLAY TOGETHERMASCOT OF THEIR UNIVERSITYTHE LOCATION OF THEIR HONEYMOONTHE LOCATION OF THEIR FIRST DATETHE MONTH THEY BOUGHT THEIR HOME...

Seasons, Months and Colours 2019-10-01

27 Items: mayredjunejulypinkgreybluemarchaprilwhitegreenblackbrownspringsummerautumnwinteraugustyellowpurpleorangejanuaryoctoberfebruarynovemberdecemberseptember

January Word Search 2023-11-19

27 Items: mytenageonetwohowyounamefivejunejulyninegoodpuppymarchthreeaprilsevenkittenaugustjanuaryoctoberbirthdayfebruarydecembernovemberseptember

Names 2025-09-28

27 Items: MAYRAINJUNEJULYMARCHAPRILAUGUSTJANUARYFLOWERSOCTOBERFEBRUARYNOVEMBERDECEMBERFIREWORKSSEPTEMBERHALLOWEENCHRISTMASTHANKSGIVINGMOMSBIRTHDAYVALENTINESDAYSTPATRICKSDAYADAMSBIRTHDAYALEXSBIRTHDAYALEXKSBIRTHDAYSUMMERVACATIONTAYLORSBIRTHDAYKATELYNSBIRTHDAY

Love Word Search 2025-11-10

27 Items: MayLoveKissHugsDateJuneJulyOkraCakeKatyTrustHeartLemonCrumblSevensDonutsForeverPartnerRomancePassionPromiseCatfishTownInnLaughterTogetherSoulmateMemories

banana 2025-11-14

27 Items: sunMaynoonmoonJuneJulynightlunchMarchAprildinnerMondayFridaySundayAugustmorningTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberbreakfastWednesdaySeptember

Create your ideal setlist with the first 8 songs you see 2025-12-04

27 Items: IfIRunGrowHomeOhNoJulyAloneShameJosieAdoreCoverLetGoCologneAspirinCryBabyLavenderComeBackHurricaneIfIdKnownToBeAloneHoldingOnBrownEyesUpAtNightBreatheOutWannaBeYouLoveInTheDarkSaturdayMourning

Famous Landmarks Word Search 2023-04-14

20 Items: petrabig-bentaj-mahalcolosseumstonehengeeiffel-towermachu-picchugrand-canyontower-bridgeburj-khalifachichen-itzaniagara-fallsmount-rushmorepyramids-of-gizastatue-of-libertysydney-opera-housegolden-gate-bridgegreat-wall-of-chinachrist-the-redeemeracropolis-of-athens

Bamidbar 5.0 2025-05-25

23 Items: “Mishkan”Hebrew, “Bamidbar”The Rosh of a man?Aaron’s firstborn.The son of Shedeur.Eleazar and IthamarThe chief prince of the Levites.The Levites belong to _________???This tribe numbered 41,500in the census.This tribe numbered 59,300 in the census.This tribe numbered 45,650 In the census.This tribe numbered 57,400 in the census....

National Bison Month Word Search 2025-07-14

10 Items: A baby bisonU.S. park where bison roamThe natural habitat for bisonThe national mammal of the U.S.Group of bison traveling togetherConservation status in some regionsDescribes bison's origin in North AmericaThis month celebrates the bison as a national symbolYou need this legal term to enter a protected bison habitat...

Ch 4 The Muscular System 2025-04-20

24 Items: Inflammation of a fasciaArm or leg toward midlineArm or leg away from midlineExtreme slowness in movementAbnormal involuntary movementSurgical suturing of a muscleSurgical suturing of a tendonParalysis of all 4 extremitiesA condition of abnormal muscle toneAbnormally increased muscle activityLacking normal muscle tone or strength...

Cell Organelles 2022-10-06

29 Items: the DNA of a prokaryotethe carrier of genetic informaciónhelps in the storage of proteins and lipids.An organelle that helps sequester waste productsynthesizes and stores proteins, bound with ribosomesthe basic unit of life in organisms of the kingdom Plantae.the basic unit of life in organisms of the kingdom Animalia....

ServSafe Review 2025-09-10

20 Items: Big nine allergenBig nine allergenBig nine allergenCooked to 165 degreesCooked to 155 degreesCooked to 145 degreesCooked to 135 degreesFirst step of washing dishesThird step of washing dishesFifth step of washing dishesSecond step of washing dishesFourth step of washing dishesReducing pathogens on a surfacePlaced on the top shelf of the fridge...

M2M 2024-02-04

12 Items: duom2mmayjulyMaritgirlsMarionMarionnorwaynorwaylorenskoglorenskog

Unit 3 Vocabulary Word Search 2023-10-04

14 Items: number of protons in the nucleus of an atomuncharged, subatomic particle located in the nucleusunit of mass equal to 1⁄12 of the mass of a 12C atomaverage mass of atoms of an element, expressed in amuthe lowest energy state of an atom or other particle.positively charged subatomic particle located in the nucleus...

4th Commandment 2022-10-09

10 Items: restsundaypraisesabbathworshipserviceremembercommunityconfessioncelebration

verbs 4th 2025-12-02

10 Items: goeatreadplayopendrinksleepwritepaintlisten

July Word Search 2025-09-16

6 Items: JulyAugustOctoberNovemberDecemberSeptember

July Word Search 2025-09-17

6 Items: JulyAugustOctoberNovemberDecemberSeptember

July Word Search 2025-09-18

6 Items: JulyAugustOctoberNovemberDecemberSeptember

Vayakhel 5.0 2025-03-15

16 Items: “Sh’mot”“Kippur”“Shittim””Yochanan”Son of BuziSon of Ahisamach“And he assembled”“To assemble together”Respond, sil vous plaitThe Holy One’s wedding ringHis name means, “In the shadow of G-d”to do, fashion, accomplish, to make, to build.This piece of furniture was made out of pure gold.The second piece of furniture made for the Mishkan....

HR 3B Crossword 2025-10-15

18 Items: LawWorthRightsRightsof LawEthicalJusticeJusticeContractLibertiesof PowersGovernmentParliamentand Balancesprocess of lawresponsibilityof the GovernedJudeo-Christian

MT 115 Kinesiology Final Review 2023-03-27

16 Items: action of rectus femorisaction of fibularis brevisaction of the serratus anteriorcommon attachment of the hamstringsorigin of the forearm extensor groupaction of the psoas major at the hipreturns blood from the legs to the heartorigin at inner surfaces of lower six ribsmuscle belly between the gastrocnemius heads...

4th Grade Groups 2025-03-25

16 Items: IANGIOMIANOERUBYVIDAJORGEYESSIREYNAVALERYRAFAELJEREMYKATERINRUSSELLGUERREROCARRILLO

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

March Madness 2024-02-09

15 Items: UC Santa BarbaraBaylor UniversityUniversity of IowaUniversity of MiamiUniversity of TexasNC State UniversityCreighton UniversityPrinceton UniversityUniversity of AuburnTexas A&M UniversityUniversity of HoustonUniversity of IndianaUniversity of MarylandUniversity of MissouriUniversity of West Virginia

4th grade 2025-12-10

10 Items: soleidlesoulpeekidolstarestairstealthrownthrone

Cell cycle Rogan Ciesielski 2025-01-17

24 Items: the first stage of mitosisa series of events that take place in a cellthe stage of the cell cycle when DNA is replicatedthe process by which cells increase in size and massthe first stage of the cell cycle in eukaryotic cellsthe initial stage of the cell cycle phase called interphasethe final stage of cell division in both mitosis and meiosis...

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

FNW Final Review 2024-04-26

20 Items: One of FCCLA's colorsFCCLA's official flowerA unit of energy found in foodOne way vegetables are classifiedOne of the parts of a grain kernelThe number of essential amino acidsThe main nutrient of the dairy groupAn example of a cultured dairy productWhen food choices are influenced by sensesThe number of calories in a gram of protein...

Athletic training vocab 2024-03-06

25 Items: Rotation to insideRotation to outsideRaising the shouldersLowering the shouldersPulling shoulders backBringing shoulders forwardMovement toward the midlineMovement away from the midlineTo decrease the angle of a jointTo increase the angle of a jointMovement around the axis of the bodyPointing the toes upward toward the knee...

BIO 345 Chapter 1 Word Search - MC 2025-09-05

20 Items: - A group of people- The cause of a disease- The physiology of altered health- Defects that are present at birth- A complication of signs and symptoms- Death rates for a specific population- A manifestation that is noted by an observer- Aggravation of symptoms and severity of the disease- The study of disease occurrence in human populations...

Weather Word Search 2024-05-06

37 Items: Water in the form of a gasThe distance above sea levelA device that measures wind speedA device that measures temperatureThe inner layer of the ThermosphereThe outer layer of the thermosphereWinds that blow over short distancesThe outermost layer of earth's atmosphereAn instrument used to measure air pressure...

Pr 1 2020 Wordsearch 1 2020-04-20

28 Items: MayJuneJulydoordeskMarchApriltablebooksMondayFridaySundayAugustwindowlightsTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberbookcaseWednesdaySeptemberprojectorwhiteboard

CALENDAR 2021-12-15

28 Items: MAYJUNEJULYMARCHAPRILFIRSTTHIRDFIFTHNINTHSUNDAYMONDAYFRIDAYAUGUSTSECONDEIGHTHTUESDAYJANUARYOCTOBERTWELFTHTHURSDAYSATURDAYFEBRUARYNOVEMBERDECEMBERWEDNESDAYSEPTEMBERBIRTHDATETWENTIETH

Word Search Qualifying worksheet 2025-07-23

15 Items: failureOpposite of fullOpposite of weakA huge water bodyOpposite of narrow- Opposite of liesPresident of India- capital of JapanNational animal of IndiaTop colour in Indian flagNatural flowing water stream- someone who governs a state- Father of Indian constitutionThe largest planet in our solar system...

Athletic training vocab 2022-08-29

25 Items: Rotation to insideRotation to outsideRaising the shouldersLowering the shouldersPulling shoulders backBringing shoulders forwardMovement toward the midlineMovement away from the midlineTo decrease the angle of a jointTo increase the angle of a jointMovement around the axis of the bodyPointing the toes upward toward the knee...

Birthday month 2023-02-07

28 Items: fryjunejulyyearhometimegoodweekcokemarchclassfantapepsiaugustoctberdinnerfamilyfriendjanuaryholidayweekendfebruarynovemberdecemberbirthdayhospatilshoppingseptember

STONE RIDGE COMMUNITY VOICE 2024-06-08

28 Items: freelevyloanjulychartfundssummerbudgetborrowassetsfourthenergyrepairsworkshopladderingcommunitygardeninghighlightsdishwasherfundraiserstoneridgecomparisonmembershipmaintenanceassessmentscelebrationinvestmentsaircondition

Matilda's Word Search 2025-07-22

28 Items: sunhotpooljulysurfsunnygrassbunnybirdsfruitbeachoceansportsummeryellowflowerauguststitchcoconutrainbowpopsicleicecreamtropicalpalmtreepineapplebutterflywatermelonawesomeMarley

months of the year 2024-04-07

6 Items: mayjunejulymarchjanuaryoctober

COLORING WORD SEARCH 2025-12-10

6 Items: JULYMINUSRULERAUTUMNCIRCLESPHERE

MONTHS OF THE YEAR  2020-05-21

6 Items: JULYAUGUSTOCTOBERNOVEMBERDECEMBERSEPTEMBER

Happy two months anniversary 2023-07-06

6 Items: twolovejulyhappymonthsanniversary

Phonics Pick 4- Week 3 2024-09-10

6 Items: JulyAugustOctoberNovemberDecemberSeptember

July Word Search 2025-09-18

6 Items: JulyAugustOctoberNovemberDecemberSeptember

F+S 2024-11-17

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

F+S 2024-11-18

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

Classic Literature 2025-10-03

27 Items: WARMANFANGTWISTCRUSOEISLANDGARDENBEAUTYMARNERMY CRYHOBBITMACHINEHATCHETKIDNAPPEDIT COURAGEOF THUNDERFERN GROWSFAHRENHEITCOPPERFIELDOF THE WILDTIME MACHINEFRANKENSTEINOF THE BEAVEROF TWO CITIESOF THE WORLDSFAMILY ROBINSONMAN AND THE SEA

fjahfahd 2023-01-23

6 Items: shyguyflywhycryjuly

das 2023-04-27

6 Items: junejulyapriljanuarynovemberfebruary

Grace & Emmanuel 2024-06-10

28 Items: Groom's middle nameBride's birthday monthGroom's birthday monthThe bride's middle nameMonth the groom proposedLocation of their honeymoonBride & groom's go-to drinkLocation the groom proposedLocation of their first dateGroom's favorite kind of foodThe couple's favorite TV showBride's favorite wedding movieChildhood nickname of the bride...

Kelly and Jason 2025-11-26

25 Items: The father of the brideThe father of the groomThe mother of the groomThe mother of the brideThe grooms favorite beerThe sport the groom playsThe couples favorite foodThe profession of the brideThe first cat the couple gotThe birth month of the groomThe birth month of the brideThe middle name of the brideThe middle name of the groom...

F+S 2024-11-17

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

F+S 2024-11-17

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

Reformation Word Search 2023-11-29

20 Items: VdietVIIIsectsTudorLutherCalvingenevaghettoCranmerof Trentof Avilatheocracyelizabethcanonizedof Loyolaindulgencewittenbergcompromisepredestination

FINAL GAME 2022-12-22

11 Items: Be QuickA JourneyBefore TwoCousins Dogs NameLong period of time(5x9)-(7x3) / (3x2)Jill's birthday monthWhere Aunt Kelly livesWhere the Bengals PlayNeeded to Enter an eventBig place that holds events

Periodic Trends 2024-12-09

16 Items: The most electronegative of - Cu, Au, AgThe largest atomic radius out of - Cu, Au, AgThe largest atomic radius out of - P, N, B, HThe smallest atomic radius out of - K, Fr, H, LiThe largest atomic radius out of - Cr, Ca, K, TiThe smallest atomic radius out of - Sc, Mn, Zn, FeThe largest electronegativity out of - C, Fe, Fr, Ga...

The Roman Colosseum 2025-11-25

24 Items: RomeItalyTunnelsTourismAqueductChariotsGladiatorsExecutionsEternalCityWorldWonderAmphitheatreArchaeologicalMonumentHow long did contests last?What was the colosseum a symbol of?What the colosseum was built on top ofWho conducted the Colosseum's creation?The kind of amphitheatre the colosseum isThe flooded naval battles in the colosseum...

Weather 2024-11-19

25 Items: Movement of airMeasures wind speedFrozen precipitationLiquid precipitationFrozen precipitationMeasures air pressureRotating column of airStudy of the atmosphereSound caused by lightningHigh-altitude wind currentRain, snow, sleet, or hailVolunteer weather spottersBoundary between air massesRadar technology for weatherPrediction of future weather...

Word Search 2025-10-22

30 Items: naar iets of iemand verwijzeniets beoordelen of inschattenvooral; voor het grootste deelhoe je over iets denkt of voeltde betekenis van iets uitleggenhet eindresultaat of de uitkomstde houding of sfeer in een tekstiets dat je van plan bent te doende reden waarom iets wordt gedaaneen gevoel van zorg of bezorgdheidiets wat helpt of een voordeel geeft...

M4 Vocabulary review 2024-09-02

15 Items: the energy of motionthe ability to do worktype of reaction A+B= ABtype of reaction AB= A+Btype of reaction AB+C= AC+Btype of reaction AB+CD= AC+BDmoves from areas of high to lowtype of energy stored in an objectreaction or process that takes in heatreaction or process that releases heatsubstances made from a chemical reaction...

Mr. Gerald's Flurry's FOT 2025 Message I 2025-10-10

32 Items: outlawjoyGodrockcrownpeaceZadoklightstonetruththronehastenof GodFlurryof hopeAdullamloyaltyAmaziahnobilityhappinessAntiochusof safetyArmstronggovernmentcommissionrevelationpreparationof the Agesking-priestspurificationrighteousness

End Of Month Reminders - July 2025-07-25

6 Items: CIIAuditCQIMeetingHAZCleaningLogWasteAreaInspectionPharmacyCleaningLogMyLearningTrainings

Gases Word Search_S2b 2024-11-20

21 Items: The Kelvin scaleThe SI unit of pressureTending to vaporize easily.An instrument used to measure atmospheric pressure.Average distance a molecule travels between collisionsThe pressure due to any individual component in a gas mixture.An instrument used to determine the pressure of a gaseous sample,...

Attic Word Search 2023-02-24

25 Items: the surface of a room that you walk onthe surface of a room that you walk ona window built into a roof to allow light inthe structure that covers or forms the top of a buildingthe part of a roof where the sloping sides join at the topbaked clay used for building walls, houses and other buildings...

Chapter 11 Word Search 2024-05-02

37 Items: water in the form of a gasthe distance above sea levelthe most outer layer with no endThe third layer of the atmospherea device that measures temperaturewhat wind speed can be measured withwinds that blow over short distancesthe way Earth's rotation makes winds curvethe amount of mass in a given volume of air...